1I6GA

Nmr solution structure of the insect-specific neurotoxin variant 5 (cse-v5) from the scorpion centruroides sculpturatus ewing
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN V-5
publication title Solution structure of an insect-specific neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i6gA00
1ZU3A 2LT8A 2SN3A 1VNAA 1WWNA 2NY9X 5CY0A 2BRZA 1CN2A 1P0AA 1AHOA 2E0HA 1KV0A 1P00A 1LQIA 1C56A 1SNBA 1ZUTA 1TI5A 2N66A 1JXCA 1B3CA 2MZ0A 5KK4A 1MR4A 2E3GA 2NY8X 2KBKA 3E7RL 1SN4A 1GPSA 1DQ7A 1JZAA 1OZZA 1JZBA 1LQQA 1B7DA 1T7AA 1FH3A 1BCGA 2GL1A 1BK8A 2A7TA 2LI7A 2KJAA 1PE4A 1ZFUA 4HE7A 1VNBA 2YBRC 2LJ7A 4AB0A 1SEGA 2LKBA 4AAZA 1ZYWA 2N2QA 1NE5A 1T7EA 1C55A 1T0ZA 1CHZA 1I2VA 2KBHA 1DJTA 2N2RA 4KYPA 1BMRA 1T7BA 1I2UA 4UJ0A 2KPYA 1WMTA 1MYNA 1I6FA 1GPTA 1L4VA 1T1TA 2M8BB 2LJMA 2ASCA 1I6GA 1ICAA 1ZVEA 1LQHA 2E3FA 1AYJA 1WT7A 2LR3A 1NH5A 2KYQA 1ZYVA 2B3CA 2ATBA 2LY6A 4AEIA 3PSMA 4V1DC 1JKZA 1SN1A 1PX9A 3E7UX 1NRAA 1NRBA 2N69A 1NPIA 2KGQA 1ZVGA 2I61A 1OMYA 2B68A 2YEOA 1N4NA 1BRZA 2YC1C 4CQKA 2KBJA 1PTXA 4HHFA 2KSKA 2LY5A
chains in the Genus database with same CATH superfamily
3KOWA 5AQRA 1ZU3A 2JDQD 2LT8A 2SN3A 1VNAA 1WWNA 2YIOA 2VY6A 3ATUA 3LDNA 5EY4A 2NY9X 4FSVA 1HJOA 4HE7A 5CY0A 2BRZA 4FL9A 1CN2A 3KC6A 3KHWA 5EVZA 1P0AA 5AQYA 1AHOA 5AQIA 3C7NA 5AQUA 5EXWA 2E0HA 3R2VA 1KV0A 5AQOA 1P00A 1ATRA 1LQIA 1C56A 1SNBA 1ZUTA 1NGHA 1NGFA 2K35A 2E88A 2QXLA 3CQXA 5AQNA 1NGIA 1NGJA 1TI5A 2N66A 1JXCA 4GNIA 5FPDA 1B3CA 2MZ0A 1NGCA 4UAEF 5KK4A 1KAXA 1MR4A 2MN5A 5F0XA 2QWPA 2E3GA 5AQWA 2NY8X 2KBKA 3D2EB 3E7RL 1BA1A 1SN4A 1DQ7A 3GDQA 2V7ZA 1JZAA 1OZZA 1GPSA 3SF4D 1JZBA 1KAZA 1LQQA 2QWMA 1B7DA 3QFUA 3QFPA 1T7AA 5AQQA 1FH3A 3QMLA 1BCGA 4H5TA 2GL1A 4HWIA 3C7NB 3KP0A 4UAFE 1BK8A 5AQZA 3FZHA 2A7TA 3CW4A 3L6QA 1BA0A 2LI7A 2BUPA 1YUWA 2KJAA 4H5WA 1PE4A 1ZFUA 1DKGD 1NGAA 3FE1A 1VNBA 2YBRC 2LJ7A 3AY9A 1SEGA 2LKBA 3A8YA 1QQNA 3D2FA 4AB0A 3GL1A 5AQVA 4AAZA 5AQGA 1ZYWA 1NGEA 3M3ZA 1NGDA 3JXUA 5AQFA 4H5VA 5BN9A 2N2QA 2QW9A 1NE5A 2YIPA 1T7EA 3LDQA 1C55A 1K8BA 1T0ZA 1CHZA 1I2VA 2KBHA 1DJTA 2N2RA 4KYPA 2GMOA 3FZFA 1BMRA 5BPLA 1T7BA 5AQTA 1I2UA 4KBOA 5AR0A 2QWQA 4UJ0A 2KPYA 3QI7A 3BK3C 4IO8A 1WMTA 3LDPA 2KHOA 1MYNA 1I6FA 2D56A 2E2FA 1GPTA 1HX1A 1S3XA 3KOYA 1T1TA 2M8BB 1L4VA 3KOXA 2LJMA 2G2KA 3D2FB 3FZLA 3KVGA 1HPMA 1QQMA 2ASCA 1POIA 5F2RA 1I6GA 3GKUA 1ATSA 1ICAA 4H5RA 4H5NA 1ZVEA 2MBKA 5AQLA 1LQHA 2E3FA 2E8AA 1AYJA 3L4IA 3I33A 1WT7A 1BUPA 2LR3A 1NH5A 2KYQA 3HSCA 1ZYVA 3D2EA 3FZMA 2YILA 2B3CA 2LN8A 5AQMA 1QQOA 2ATBA 2LY6A 2QWOA 3ATVA 5AQXA 3LDLA 4AEIA 5F1XA 3PSMA 5BN8A 3IUCA 1KAYA 4V1DC 3LDOA 5EX5A 1JKZA 3KOZA 2QWLA 5AQHA 1SN1A 1PX9A 3E7UX 1NRAA 3KP1A 1NRBA 2N69A 3FZKA 5FPMA 1NPIA 2KGQA 1UGLA 5AQPA 2QWRA 5FPEA 5AQJA 5FPNA 5BPMA 1NGBA 1ZVGA 2I61A 1XRSB 5AQSA 1OMYA 2B68A 2QWNA 2YEOA 5BPNA 4UADE 1N4NA 1BRZA 2YC1C 3L56A 4CQKA 2KBJA 1PTXA 2KSKA 4HHFA 1NGGA 5AQKA 2LY5A
chains in the Genus database with same CATH topology
1ZU3A 2LT8A 2SN3A 1VNAA 1WWNA 2NY9X 5CY0A 2BRZA 1CN2A 1P0AA 1AHOA 2E0HA 1KV0A 1P00A 1LQIA 1C56A 1SNBA 1ZUTA 1TI5A 2N66A 1JXCA 1B3CA 2MZ0A 5KK4A 1MR4A 2E3GA 2NY8X 2KBKA 3E7RL 1SN4A 1GPSA 1DQ7A 1JZAA 1OZZA 1JZBA 1LQQA 1B7DA 1T7AA 1FH3A 1BCGA 2GL1A 1BK8A 2A7TA 2LI7A 2KJAA 1PE4A 1ZFUA 4HE7A 1VNBA 2YBRC 2LJ7A 4AB0A 1SEGA 2LKBA 4AAZA 1ZYWA 2N2QA 1NE5A 1T7EA 1C55A 1T0ZA 1CHZA 1I2VA 2KBHA 1DJTA 2N2RA 4KYPA 1BMRA 1T7BA 1I2UA 4UJ0A 2KPYA 1WMTA 1MYNA 1I6FA 1GPTA 1L4VA 1T1TA 2M8BB 2LJMA 2ASCA 1I6GA 1ICAA 1ZVEA 1LQHA 2E3FA 1AYJA 1WT7A 2LR3A 1NH5A 2KYQA 1ZYVA 2B3CA 2ATBA 2LY6A 4AEIA 3PSMA 4V1DC 1JKZA 1SN1A 1PX9A 3E7UX 1NRAA 1NRBA 2N69A 1NPIA 2KGQA 1ZVGA 2I61A 1OMYA 2B68A 2YEOA 1N4NA 1BRZA 2YC1C 4CQKA 2KBJA 1PTXA 4HHFA 2KSKA 2LY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU3 A;  2LT8 A;  2SN3 A;  1VNA A;  1WWN A;  2NY9 X;  5CY0 A;  2BRZ A;  1CN2 A;  1P0A A;  1AHO A;  2E0H A;  1KV0 A;  1P00 A;  1LQI A;  1C56 A;  1SNB A;  1ZUT A;  1TI5 A;  2N66 A;  1JXC A;  1B3C A;  2MZ0 A;  5KK4 A;  1MR4 A;  2E3G A;  2NY8 X;  2KBK A;  3E7R L;  1SN4 A;  1GPS A;  1DQ7 A;  1JZA A;  1OZZ A;  1JZB A;  1LQQ A;  1B7D A;  1T7A A;  1FH3 A;  1BCG A;  2GL1 A;  1BK8 A;  2A7T A;  2LI7 A;  2KJA A;  1PE4 A;  1ZFU A;  4HE7 A;  1VNB A;  2YBR C;  2LJ7 A;  4AB0 A;  1SEG A;  2LKB A;  4AAZ A;  1ZYW A;  2N2Q A;  1NE5 A;  1T7E A;  1C55 A;  1T0Z A;  1CHZ A;  1I2V A;  2KBH A;  1DJT A;  2N2R A;  4KYP A;  1BMR A;  1T7B A;  1I2U A;  4UJ0 A;  2KPY A;  1WMT A;  1MYN A;  1I6F A;  1GPT A;  1L4V A;  1T1T A;  2M8B B;  2LJM A;  2ASC A;  1I6G A;  1ICA A;  1ZVE A;  1LQH A;  2E3F A;  1AYJ A;  1WT7 A;  2LR3 A;  1NH5 A;  2KYQ A;  1ZYV A;  2B3C A;  2ATB A;  2LY6 A;  4AEI A;  3PSM A;  4V1D C;  1JKZ A;  1SN1 A;  1PX9 A;  3E7U X;  1NRA A;  1NRB A;  2N69 A;  1NPI A;  2KGQ A;  1ZVG A;  2I61 A;  1OMY A;  2B68 A;  2YEO A;  1N4N A;  1BRZ A;  2YC1 C;  4CQK A;  2KBJ A;  1PTX A;  4HHF A;  2KSK A;  2LY5 A; 
#chains in the Genus database with same CATH topology
 3KOW A;  5AQR A;  1ZU3 A;  2JDQ D;  2LT8 A;  2SN3 A;  1VNA A;  1WWN A;  2YIO A;  2VY6 A;  3ATU A;  3LDN A;  5EY4 A;  2NY9 X;  4FSV A;  1HJO A;  4HE7 A;  5CY0 A;  2BRZ A;  4FL9 A;  1CN2 A;  3KC6 A;  3KHW A;  5EVZ A;  1P0A A;  5AQY A;  1AHO A;  5AQI A;  3C7N A;  5AQU A;  5EXW A;  2E0H A;  3R2V A;  1KV0 A;  5AQO A;  1P00 A;  1ATR A;  1LQI A;  1C56 A;  1SNB A;  1ZUT A;  1NGH A;  1NGF A;  2K35 A;  2E88 A;  2QXL A;  3CQX A;  5AQN A;  1NGI A;  1NGJ A;  1TI5 A;  2N66 A;  1JXC A;  4GNI A;  5FPD A;  1B3C A;  2MZ0 A;  1NGC A;  4UAE F;  5KK4 A;  1KAX A;  1MR4 A;  2MN5 A;  5F0X A;  2QWP A;  2E3G A;  5AQW A;  2NY8 X;  2KBK A;  3D2E B;  3E7R L;  1BA1 A;  1SN4 A;  1DQ7 A;  3GDQ A;  2V7Z A;  1JZA A;  1OZZ A;  1GPS A;  3SF4 D;  1JZB A;  1KAZ A;  1LQQ A;  2QWM A;  1B7D A;  3QFU A;  3QFP A;  1T7A A;  5AQQ A;  1FH3 A;  3QML A;  1BCG A;  4H5T A;  2GL1 A;  4HWI A;  3C7N B;  3KP0 A;  4UAF E;  1BK8 A;  5AQZ A;  3FZH A;  2A7T A;  3CW4 A;  3L6Q A;  1BA0 A;  2LI7 A;  2BUP A;  1YUW A;  2KJA A;  4H5W A;  1PE4 A;  1ZFU A;  1DKG D;  1NGA A;  3FE1 A;  1VNB A;  2YBR C;  2LJ7 A;  3AY9 A;  1SEG A;  2LKB A;  3A8Y A;  1QQN A;  3D2F A;  4AB0 A;  3GL1 A;  5AQV A;  4AAZ A;  5AQG A;  1ZYW A;  1NGE A;  3M3Z A;  1NGD A;  3JXU A;  5AQF A;  4H5V A;  5BN9 A;  2N2Q A;  2QW9 A;  1NE5 A;  2YIP A;  1T7E A;  3LDQ A;  1C55 A;  1K8B A;  1T0Z A;  1CHZ A;  1I2V A;  2KBH A;  1DJT A;  2N2R A;  4KYP A;  2GMO A;  3FZF A;  1BMR A;  5BPL A;  1T7B A;  5AQT A;  1I2U A;  4KBO A;  5AR0 A;  2QWQ A;  4UJ0 A;  2KPY A;  3QI7 A;  3BK3 C;  4IO8 A;  1WMT A;  3LDP A;  2KHO A;  1MYN A;  1I6F A;  2D56 A;  2E2F A;  1GPT A;  1HX1 A;  1S3X A;  3KOY A;  1T1T A;  2M8B B;  1L4V A;  3KOX A;  2LJM A;  2G2K A;  3D2F B;  3FZL A;  3KVG A;  1HPM A;  1QQM A;  2ASC A;  1POI A;  5F2R A;  1I6G A;  3GKU A;  1ATS A;  1ICA A;  4H5R A;  4H5N A;  1ZVE A;  2MBK A;  5AQL A;  1LQH A;  2E3F A;  2E8A A;  1AYJ A;  3L4I A;  3I33 A;  1WT7 A;  1BUP A;  2LR3 A;  1NH5 A;  2KYQ A;  3HSC A;  1ZYV A;  3D2E A;  3FZM A;  2YIL A;  2B3C A;  2LN8 A;  5AQM A;  1QQO A;  2ATB A;  2LY6 A;  2QWO A;  3ATV A;  5AQX A;  3LDL A;  4AEI A;  5F1X A;  3PSM A;  5BN8 A;  3IUC A;  1KAY A;  4V1D C;  3LDO A;  5EX5 A;  1JKZ A;  3KOZ A;  2QWL A;  5AQH A;  1SN1 A;  1PX9 A;  3E7U X;  1NRA A;  3KP1 A;  1NRB A;  2N69 A;  3FZK A;  5FPM A;  1NPI A;  2KGQ A;  1UGL A;  5AQP A;  2QWR A;  5FPE A;  5AQJ A;  5FPN A;  5BPM A;  1NGB A;  1ZVG A;  2I61 A;  1XRS B;  5AQS A;  1OMY A;  2B68 A;  2QWN A;  2YEO A;  5BPN A;  4UAD E;  1N4N A;  1BRZ A;  2YC1 C;  3L56 A;  4CQK A;  2KBJ A;  1PTX A;  2KSK A;  4HHF A;  1NGG A;  5AQK A;  2LY5 A; 
#chains in the Genus database with same CATH homology
 1ZU3 A;  2LT8 A;  2SN3 A;  1VNA A;  1WWN A;  2NY9 X;  5CY0 A;  2BRZ A;  1CN2 A;  1P0A A;  1AHO A;  2E0H A;  1KV0 A;  1P00 A;  1LQI A;  1C56 A;  1SNB A;  1ZUT A;  1TI5 A;  2N66 A;  1JXC A;  1B3C A;  2MZ0 A;  5KK4 A;  1MR4 A;  2E3G A;  2NY8 X;  2KBK A;  3E7R L;  1SN4 A;  1GPS A;  1DQ7 A;  1JZA A;  1OZZ A;  1JZB A;  1LQQ A;  1B7D A;  1T7A A;  1FH3 A;  1BCG A;  2GL1 A;  1BK8 A;  2A7T A;  2LI7 A;  2KJA A;  1PE4 A;  1ZFU A;  4HE7 A;  1VNB A;  2YBR C;  2LJ7 A;  4AB0 A;  1SEG A;  2LKB A;  4AAZ A;  1ZYW A;  2N2Q A;  1NE5 A;  1T7E A;  1C55 A;  1T0Z A;  1CHZ A;  1I2V A;  2KBH A;  1DJT A;  2N2R A;  4KYP A;  1BMR A;  1T7B A;  1I2U A;  4UJ0 A;  2KPY A;  1WMT A;  1MYN A;  1I6F A;  1GPT A;  1L4V A;  1T1T A;  2M8B B;  2LJM A;  2ASC A;  1I6G A;  1ICA A;  1ZVE A;  1LQH A;  2E3F A;  1AYJ A;  1WT7 A;  2LR3 A;  1NH5 A;  2KYQ A;  1ZYV A;  2B3C A;  2ATB A;  2LY6 A;  4AEI A;  3PSM A;  4V1D C;  1JKZ A;  1SN1 A;  1PX9 A;  3E7U X;  1NRA A;  1NRB A;  2N69 A;  1NPI A;  2KGQ A;  1ZVG A;  2I61 A;  1OMY A;  2B68 A;  2YEO A;  1N4N A;  1BRZ A;  2YC1 C;  4CQK A;  2KBJ A;  1PTX A;  4HHF A;  2KSK A;  2LY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...