4V1DC

Ternary complex among two human derived single chain antibody fragments and cn2 toxin from scorpion centruroides noxius.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT LR, HEAVY CHAIN
publication title Optimal Neutralization of Centruroides Noxius Venom is Understood Through a Structural Complex between Two Antibody Fragments and the Cn2 Toxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Toxin/immune system
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4v1dC00
2LI7A 1T0ZA 2KBKA 1NE5A 1ZYVA 2ASCA 1LQHA 1GPTA 1JXCA 2YEOA 1T7EA 1ICAA 1NPIA 1KV0A 1JZBA 2NY9X 4KYPA 2N69A 4AEIA 2LR3A 1T7BA 2KYQA 2ATBA 1DJTA 2NY8X 1BCGA 1NRAA 1SN4A 1SN1A 2YC1C 4HHFA 2B68A 2B3CA 1AYJA 2GL1A 2BRZA 1P00A 1SNBA 2KGQA 2SN3A 4AB0A 2KPYA 2KSKA 1AHOA 1I6GA 2N66A 1GPSA 1BRZA 4HE7A 1B7DA 3E7UX 3PSMA 1CHZA 1OMYA 1BK8A 1OZZA 1T1TA 1L4VA 1PE4A 1ZYWA 1N4NA 1VNBA 1LQQA 1NH5A 2LT8A 1T7AA 1LQIA 4UJ0A 1SEGA 2LJ7A 1WWNA 1BMRA 1MR4A 1ZVGA 1PX9A 1FH3A 2LY5A 1PTXA 2KBHA 5CY0A 1VNAA 1ZUTA 1DQ7A 2N2RA 2E0HA 3E7RL 1NRBA 4CQKA 1B3CA 1I6FA 1ZVEA 2E3FA 1I2UA 2LKBA 1WMTA 2A7TA 2MZ0A 2E3GA 2N2QA 1ZFUA 1TI5A 2KBJA 1C55A 2I61A 1C56A 1ZU3A 1JZAA 4V1DC 4AAZA 5KK4A 2KJAA 1WT7A 1P0AA 1JKZA 2M8BB 1I2VA 2YBRC 2LY6A 2LJMA 1MYNA 1CN2A
chains in the Genus database with same CATH superfamily
2LI7A 3A8YA 1T0ZA 3ATUA 2QWMA 2KBKA 1NE5A 3LDLA 3AY9A 1ZYVA 1UGLA 2YILA 5AQOA 2QWQA 3D2FA 1KAYA 2ASCA 5AR0A 1S3XA 2MN5A 1LQHA 3KOXA 3QFUA 1GPTA 1JXCA 3L56A 3FZKA 5FPMA 3KOYA 4H5NA 2YEOA 1T7EA 2V7ZA 1NPIA 1KV0A 4IO8A 5BPNA 1ICAA 1JZBA 3D2FB 2NY9X 4KYPA 2YIOA 3KVGA 2BUPA 2N69A 5AQGA 4AEIA 1NGIA 2LR3A 1T7BA 5AQHA 4UAFE 5AQLA 2KYQA 3FZHA 3FZMA 3KOWA 5AQRA 4FSVA 4HWIA 2ATBA 5F0XA 2E2FA 5AQMA 1BA1A 3D2EA 1DJTA 1ATSA 3GDQA 3LDPA 2NY8X 1NGCA 2GMOA 4H5WA 1BCGA 1NRAA 1SN4A 2K35A 3KHWA 1SN1A 2YC1C 2QWPA 3C7NA 2B68A 2B3CA 4HHFA 5EY4A 2LN8A 1AYJA 3D2EB 2GL1A 2BRZA 1P00A 5EXWA 1SNBA 1BUPA 3GKUA 5FPDA 3R2VA 2KGQA 5F2RA 2SN3A 4AB0A 3C7NB 2KPYA 2KSKA 3LDOA 1ATRA 2D56A 5BN9A 1AHOA 1DKGD 2N66A 1I6GA 3LDQA 1GPSA 1BA0A 2QXLA 1BRZA 3QMLA 4HE7A 1B7DA 1YUWA 2E88A 3E7UX 3PSMA 1CHZA 1OMYA 3BK3C 2JDQD 3L6QA 3ATVA 3CQXA 5AQTA 5BN8A 1BK8A 3KP1A 1OZZA 1T1TA 4FL9A 5FPNA 1PE4A 1L4VA 3M3ZA 5AQYA 1N4NA 1ZYWA 1VNBA 1K8BA 5AQQA 3I33A 2KHOA 1NGJA 4H5RA 2QWLA 1LQQA 4UAEF 1NH5A 2LT8A 1T7AA 4H5VA 1LQIA 3FZFA 5F1XA 4UJ0A 1SEGA 3HSCA 1HX1A 2LJ7A 5FPEA 4KBOA 1NGEA 1NGFA 1WWNA 2YIPA 1BMRA 1NGBA 1MR4A 1NGHA 1POIA 3L4IA 4GNIA 1ZVGA 5AQWA 1PX9A 1FH3A 5AQFA 1QQMA 2LY5A 4UADE 1XRSB 1PTXA 2KBHA 5EVZA 5CY0A 1VNAA 1ZUTA 3GL1A 5AQNA 3IUCA 1DQ7A 2N2RA 2G2KA 2QWOA 5AQUA 5AQJA 2E0HA 3FZLA 5AQZA 1NGAA 1NGGA 2QWNA 3E7RL 1NRBA 1HPMA 3KC6A 4CQKA 1B3CA 1I6FA 1ZVEA 3CW4A 2E3FA 1KAZA 2VY6A 5AQVA 1I2UA 2MBKA 2E8AA 1WMTA 2LKBA 1QQNA 3FE1A 5AQPA 5AQXA 2A7TA 2MZ0A 2E3GA 1HJOA 2N2QA 5EX5A 3KP0A 1ZFUA 3KOZA 1TI5A 2KBJA 3QI7A 1C55A 2I61A 1C56A 5AQIA 1ZU3A 1JZAA 4V1DC 4AAZA 5BPLA 5KK4A 3JXUA 4H5TA 2QW9A 2KJAA 3SF4D 1KAXA 1WT7A 5BPMA 1P0AA 1NGDA 3LDNA 5AQKA 1JKZA 2M8BB 2QWRA 3QFPA 2YBRC 1I2VA 1QQOA 2LY6A 2LJMA 1MYNA 5AQSA 1CN2A
chains in the Genus database with same CATH topology
2LI7A 1T0ZA 2KBKA 1NE5A 1ZYVA 2ASCA 1LQHA 1GPTA 1JXCA 2YEOA 1T7EA 1ICAA 1NPIA 1KV0A 1JZBA 2NY9X 4KYPA 2N69A 4AEIA 2LR3A 1T7BA 2KYQA 2ATBA 1DJTA 2NY8X 1BCGA 1NRAA 1SN4A 1SN1A 2YC1C 4HHFA 2B68A 2B3CA 1AYJA 2GL1A 2BRZA 1P00A 1SNBA 2KGQA 2SN3A 4AB0A 2KPYA 2KSKA 1AHOA 1I6GA 2N66A 1GPSA 1BRZA 4HE7A 1B7DA 3E7UX 3PSMA 1CHZA 1OMYA 1BK8A 1OZZA 1T1TA 1L4VA 1PE4A 1ZYWA 1N4NA 1VNBA 1LQQA 1NH5A 2LT8A 1T7AA 1LQIA 4UJ0A 1SEGA 2LJ7A 1WWNA 1BMRA 1MR4A 1ZVGA 1PX9A 1FH3A 2LY5A 1PTXA 2KBHA 5CY0A 1VNAA 1ZUTA 1DQ7A 2N2RA 2E0HA 3E7RL 1NRBA 4CQKA 1B3CA 1I6FA 1ZVEA 2E3FA 1I2UA 2LKBA 1WMTA 2A7TA 2MZ0A 2E3GA 2N2QA 1ZFUA 1TI5A 2KBJA 1C55A 2I61A 1C56A 1ZU3A 1JZAA 4V1DC 4AAZA 5KK4A 2KJAA 1WT7A 1P0AA 1JKZA 2M8BB 1I2VA 2YBRC 2LY6A 2LJMA 1MYNA 1CN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LI7 A;  1T0Z A;  2KBK A;  1NE5 A;  1ZYV A;  2ASC A;  1LQH A;  1GPT A;  1JXC A;  2YEO A;  1T7E A;  1ICA A;  1NPI A;  1KV0 A;  1JZB A;  2NY9 X;  4KYP A;  2N69 A;  4AEI A;  2LR3 A;  1T7B A;  2KYQ A;  2ATB A;  1DJT A;  2NY8 X;  1BCG A;  1NRA A;  1SN4 A;  1SN1 A;  2YC1 C;  4HHF A;  2B68 A;  2B3C A;  1AYJ A;  2GL1 A;  2BRZ A;  1P00 A;  1SNB A;  2KGQ A;  2SN3 A;  4AB0 A;  2KPY A;  2KSK A;  1AHO A;  1I6G A;  2N66 A;  1GPS A;  1BRZ A;  4HE7 A;  1B7D A;  3E7U X;  3PSM A;  1CHZ A;  1OMY A;  1BK8 A;  1OZZ A;  1T1T A;  1L4V A;  1PE4 A;  1ZYW A;  1N4N A;  1VNB A;  1LQQ A;  1NH5 A;  2LT8 A;  1T7A A;  1LQI A;  4UJ0 A;  1SEG A;  2LJ7 A;  1WWN A;  1BMR A;  1MR4 A;  1ZVG A;  1PX9 A;  1FH3 A;  2LY5 A;  1PTX A;  2KBH A;  5CY0 A;  1VNA A;  1ZUT A;  1DQ7 A;  2N2R A;  2E0H A;  3E7R L;  1NRB A;  4CQK A;  1B3C A;  1I6F A;  1ZVE A;  2E3F A;  1I2U A;  2LKB A;  1WMT A;  2A7T A;  2MZ0 A;  2E3G A;  2N2Q A;  1ZFU A;  1TI5 A;  2KBJ A;  1C55 A;  2I61 A;  1C56 A;  1ZU3 A;  1JZA A;  4V1D C;  4AAZ A;  5KK4 A;  2KJA A;  1WT7 A;  1P0A A;  1JKZ A;  2M8B B;  1I2V A;  2YBR C;  2LY6 A;  2LJM A;  1MYN A;  1CN2 A; 
#chains in the Genus database with same CATH topology
 2LI7 A;  3A8Y A;  1T0Z A;  3ATU A;  2QWM A;  2KBK A;  1NE5 A;  3LDL A;  3AY9 A;  1ZYV A;  1UGL A;  2YIL A;  5AQO A;  2QWQ A;  3D2F A;  1KAY A;  2ASC A;  5AR0 A;  1S3X A;  2MN5 A;  1LQH A;  3KOX A;  3QFU A;  1GPT A;  1JXC A;  3L56 A;  3FZK A;  5FPM A;  3KOY A;  4H5N A;  2YEO A;  1T7E A;  2V7Z A;  1NPI A;  1KV0 A;  4IO8 A;  5BPN A;  1ICA A;  1JZB A;  3D2F B;  2NY9 X;  4KYP A;  2YIO A;  3KVG A;  2BUP A;  2N69 A;  5AQG A;  4AEI A;  1NGI A;  2LR3 A;  1T7B A;  5AQH A;  4UAF E;  5AQL A;  2KYQ A;  3FZH A;  3FZM A;  3KOW A;  5AQR A;  4FSV A;  4HWI A;  2ATB A;  5F0X A;  2E2F A;  5AQM A;  1BA1 A;  3D2E A;  1DJT A;  1ATS A;  3GDQ A;  3LDP A;  2NY8 X;  1NGC A;  2GMO A;  4H5W A;  1BCG A;  1NRA A;  1SN4 A;  2K35 A;  3KHW A;  1SN1 A;  2YC1 C;  2QWP A;  3C7N A;  2B68 A;  2B3C A;  4HHF A;  5EY4 A;  2LN8 A;  1AYJ A;  3D2E B;  2GL1 A;  2BRZ A;  1P00 A;  5EXW A;  1SNB A;  1BUP A;  3GKU A;  5FPD A;  3R2V A;  2KGQ A;  5F2R A;  2SN3 A;  4AB0 A;  3C7N B;  2KPY A;  2KSK A;  3LDO A;  1ATR A;  2D56 A;  5BN9 A;  1AHO A;  1DKG D;  2N66 A;  1I6G A;  3LDQ A;  1GPS A;  1BA0 A;  2QXL A;  1BRZ A;  3QML A;  4HE7 A;  1B7D A;  1YUW A;  2E88 A;  3E7U X;  3PSM A;  1CHZ A;  1OMY A;  3BK3 C;  2JDQ D;  3L6Q A;  3ATV A;  3CQX A;  5AQT A;  5BN8 A;  1BK8 A;  3KP1 A;  1OZZ A;  1T1T A;  4FL9 A;  5FPN A;  1PE4 A;  1L4V A;  3M3Z A;  5AQY A;  1N4N A;  1ZYW A;  1VNB A;  1K8B A;  5AQQ A;  3I33 A;  2KHO A;  1NGJ A;  4H5R A;  2QWL A;  1LQQ A;  4UAE F;  1NH5 A;  2LT8 A;  1T7A A;  4H5V A;  1LQI A;  3FZF A;  5F1X A;  4UJ0 A;  1SEG A;  3HSC A;  1HX1 A;  2LJ7 A;  5FPE A;  4KBO A;  1NGE A;  1NGF A;  1WWN A;  2YIP A;  1BMR A;  1NGB A;  1MR4 A;  1NGH A;  1POI A;  3L4I A;  4GNI A;  1ZVG A;  5AQW A;  1PX9 A;  1FH3 A;  5AQF A;  1QQM A;  2LY5 A;  4UAD E;  1XRS B;  1PTX A;  2KBH A;  5EVZ A;  5CY0 A;  1VNA A;  1ZUT A;  3GL1 A;  5AQN A;  3IUC A;  1DQ7 A;  2N2R A;  2G2K A;  2QWO A;  5AQU A;  5AQJ A;  2E0H A;  3FZL A;  5AQZ A;  1NGA A;  1NGG A;  2QWN A;  3E7R L;  1NRB A;  1HPM A;  3KC6 A;  4CQK A;  1B3C A;  1I6F A;  1ZVE A;  3CW4 A;  2E3F A;  1KAZ A;  2VY6 A;  5AQV A;  1I2U A;  2MBK A;  2E8A A;  1WMT A;  2LKB A;  1QQN A;  3FE1 A;  5AQP A;  5AQX A;  2A7T A;  2MZ0 A;  2E3G A;  1HJO A;  2N2Q A;  5EX5 A;  3KP0 A;  1ZFU A;  3KOZ A;  1TI5 A;  2KBJ A;  3QI7 A;  1C55 A;  2I61 A;  1C56 A;  5AQI A;  1ZU3 A;  1JZA A;  4V1D C;  4AAZ A;  5BPL A;  5KK4 A;  3JXU A;  4H5T A;  2QW9 A;  2KJA A;  3SF4 D;  1KAX A;  1WT7 A;  5BPM A;  1P0A A;  1NGD A;  3LDN A;  5AQK A;  1JKZ A;  2M8B B;  2QWR A;  3QFP A;  2YBR C;  1I2V A;  1QQO A;  2LY6 A;  2LJM A;  1MYN A;  5AQS A;  1CN2 A; 
#chains in the Genus database with same CATH homology
 2LI7 A;  1T0Z A;  2KBK A;  1NE5 A;  1ZYV A;  2ASC A;  1LQH A;  1GPT A;  1JXC A;  2YEO A;  1T7E A;  1ICA A;  1NPI A;  1KV0 A;  1JZB A;  2NY9 X;  4KYP A;  2N69 A;  4AEI A;  2LR3 A;  1T7B A;  2KYQ A;  2ATB A;  1DJT A;  2NY8 X;  1BCG A;  1NRA A;  1SN4 A;  1SN1 A;  2YC1 C;  4HHF A;  2B68 A;  2B3C A;  1AYJ A;  2GL1 A;  2BRZ A;  1P00 A;  1SNB A;  2KGQ A;  2SN3 A;  4AB0 A;  2KPY A;  2KSK A;  1AHO A;  1I6G A;  2N66 A;  1GPS A;  1BRZ A;  4HE7 A;  1B7D A;  3E7U X;  3PSM A;  1CHZ A;  1OMY A;  1BK8 A;  1OZZ A;  1T1T A;  1L4V A;  1PE4 A;  1ZYW A;  1N4N A;  1VNB A;  1LQQ A;  1NH5 A;  2LT8 A;  1T7A A;  1LQI A;  4UJ0 A;  1SEG A;  2LJ7 A;  1WWN A;  1BMR A;  1MR4 A;  1ZVG A;  1PX9 A;  1FH3 A;  2LY5 A;  1PTX A;  2KBH A;  5CY0 A;  1VNA A;  1ZUT A;  1DQ7 A;  2N2R A;  2E0H A;  3E7R L;  1NRB A;  4CQK A;  1B3C A;  1I6F A;  1ZVE A;  2E3F A;  1I2U A;  2LKB A;  1WMT A;  2A7T A;  2MZ0 A;  2E3G A;  2N2Q A;  1ZFU A;  1TI5 A;  2KBJ A;  1C55 A;  2I61 A;  1C56 A;  1ZU3 A;  1JZA A;  4V1D C;  4AAZ A;  5KK4 A;  2KJA A;  1WT7 A;  1P0A A;  1JKZ A;  2M8B B;  1I2V A;  2YBR C;  2LY6 A;  2LJM A;  1MYN A;  1CN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...