3KC6A

Crystal structure of the large c-terminal domain of polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
200
structure length
198
Chain Sequence
NGPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPKQSRMQFSSLTVNVRGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase PB2
publication title Biological and structural characterization of a host-adapting amino acid in influenza virus.
pubmed doi rcsb
source organism Influenza a virus (a/viet nam/1203/2004(h5n1))
molecule tags Viral protein
total genus 56
structure length 198
sequence length 200
ec nomenclature
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3kc6A02
2JDQD 3L56A 2GMOA 2VY6A 4UADE 3KHWA 3R2VA 3CW4A 4UAFE 4UAEF 3KC6A
chains in the Genus database with same CATH superfamily
3FZLA 5AQZA 2MZ0A 2A7TA 1PTXA 2LI7A 5AQLA 2D56A 2G2KA 1JKZA 2KHOA 5FPMA 3KHWA 4H5NA 2K35A 1BUPA 4HHFA 4AB0A 1GPSA 5AQXA 1ZVGA 1DKGD 4HE7A 4AEIA 2KBHA 1SNBA 3ATUA 1JZAA 5AQJA 5AQUA 1LQQA 3BK3C 2YEOA 1ATRA 5AQOA 3GKUA 2QWQA 3ATVA 1WMTA 2YBRC 1NGJA 5F1XA 3KP1A 2QWLA 3M3ZA 1NGCA 3C7NB 2E3FA 1MYNA 2MBKA 4FL9A 2QWRA 1I6GA 3GDQA 1VNAA 4KYPA 2E2FA 3C7NA 3LDQA 4AAZA 1KAYA 5AQHA 1L4VA 3LDPA 1ZYVA 4IO8A 1B3CA 1I6FA 5FPDA 2V7ZA 1YUWA 2YIPA 1HPMA 2E88A 1PE4A 1HJOA 4H5RA 1NH5A 3QFUA 2BUPA 5F0XA 5AQYA 1T7EA 5EXWA 2YIOA 3QI7A 1FH3A 1ZU3A 3KOZA 2GMOA 3D2EB 1GPTA 3KOYA 5F2RA 1SEGA 1ZFUA 4V1DC 1MR4A 5AQIA 2KBJA 3D2EA 1AYJA 5EY4A 2SN3A 1T1TA 4H5TA 5AQSA 3KVGA 1T0ZA 1JXCA 2GL1A 2KYQA 2KGQA 2KJAA 5FPEA 5AQRA 1KV0A 2B3CA 3AY9A 5BPMA 2N66A 2YC1C 2M8BB 3GL1A 3LDOA 3L56A 3LDLA 1BK8A 2QWOA 3PSMA 5AQQA 1BRZA 2LJ7A 3FZHA 5AQWA 1PX9A 1NGGA 2E0HA 2BRZA 1ZVEA 3E7UX 4UJ0A 1BMRA 1P0AA 2I61A 1BA0A 2VY6A 2E3GA 2JDQD 4FSVA 1QQOA 1AHOA 4UADE 1ICAA 1POIA 1QQMA 2LKBA 5FPNA 2LT8A 3FZFA 1NGDA 1NPIA 3QMLA 1DJTA 3KC6A 1NGEA 1SN1A 1LQIA 3LDNA 2QXLA 1DQ7A 1ZYWA 3SF4D 2MN5A 1NE5A 1WWNA 5AQKA 5AQMA 5BPLA 1P00A 4HWIA 5AQVA 3L4IA 3HSCA 5AQGA 1TI5A 1HX1A 1S3XA 3FZMA 1CHZA 2KPYA 3FZKA 2LY6A 1NGHA 3I33A 2NY8X 1ATSA 3FE1A 1T7AA 2B68A 1NGFA 2E8AA 5BN8A 1I2VA 2KBKA 3KP0A 2QWPA 3KOWA 3CQXA 2QWNA 1C56A 1LQHA 2YILA 4KBOA 2KSKA 3QFPA 1XRSB 1KAXA 2ASCA 1KAZA 1OZZA 3R2VA 4H5VA 4UAEF 5AQFA 1CN2A 1I2UA 5EX5A 1C55A 3KOXA 3IUCA 5EVZA 1N4NA 5CY0A 4GNIA 5KK4A 1QQNA 5AR0A 2QWMA 1NRAA 3A8YA 1WT7A 3D2FB 2LY5A 3CW4A 3JXUA 5AQPA 1B7DA 1SN4A 2N69A 4CQKA 5AQNA 3E7RL 1NRBA 1K8BA 3D2FA 1ZUTA 2LN8A 4H5WA 1NGAA 1JZBA 4UAFE 1BCGA 1NGBA 2QW9A 1NGIA 2LJMA 2N2QA 3L6QA 1T7BA 5AQTA 1OMYA 2N2RA 1BA1A 5BPNA 2ATBA 2NY9X 1UGLA 1VNBA 5BN9A 2LR3A
chains in the Genus database with same CATH topology
3FZLA 5AQZA 5AQLA 2D56A 2KHOA 5FPMA 3KHWA 4H5NA 2K35A 1BUPA 5AQXA 1DKGD 3ATUA 5AQJA 5AQUA 3BK3C 1ATRA 5AQOA 2QWQA 3ATVA 1NGJA 5F1XA 2QWLA 3M3ZA 1NGCA 3C7NB 4FL9A 2MBKA 2QWRA 3GDQA 2E2FA 3C7NA 3LDQA 1KAYA 5AQHA 3LDPA 4IO8A 5FPDA 2V7ZA 1YUWA 2YIPA 1HPMA 2E88A 1HJOA 4H5RA 3QFUA 2BUPA 5F0XA 5AQYA 5EXWA 2YIOA 3QI7A 2GMOA 3D2EB 5F2RA 5AQIA 3D2EA 5EY4A 4H5TA 5AQSA 3KVGA 5FPEA 5AQRA 3AY9A 5BPMA 3GL1A 3LDOA 3LDLA 3L56A 2QWOA 5AQQA 3FZHA 5AQWA 1NGGA 1BA0A 2VY6A 2JDQD 4FSVA 1QQOA 4UADE 1POIA 1QQMA 5FPNA 3FZFA 1NGDA 3QMLA 3KC6A 1NGEA 3LDNA 2QXLA 3SF4D 2MN5A 5AQKA 5AQMA 5BPLA 4HWIA 5AQVA 3L4IA 3HSCA 5AQGA 1HX1A 1S3XA 3FZMA 3FZKA 3I33A 1NGHA 1ATSA 3FE1A 2E8AA 5BN8A 1NGFA 2QWPA 3CQXA 2QWNA 2YILA 4KBOA 3QFPA 4H5VA 1KAXA 1KAZA 3R2VA 4UAEF 5AQFA 5EX5A 3IUCA 5EVZA 4GNIA 1QQNA 5AR0A 2QWMA 3A8YA 3JXUA 5AQPA 3D2FB 3CW4A 5AQNA 3D2FA 2LN8A 4H5WA 1NGAA 4UAFE 2QW9A 1NGBA 1NGIA 3L6QA 5AQTA 1BA1A 5BPNA 5BN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDQ D;  3L56 A;  2GMO A;  2VY6 A;  4UAD E;  3KHW A;  3R2V A;  3CW4 A;  4UAF E;  4UAE F;  3KC6 A; 
#chains in the Genus database with same CATH topology
 3FZL A;  5AQZ A;  2MZ0 A;  2A7T A;  1PTX A;  2LI7 A;  5AQL A;  2D56 A;  2G2K A;  1JKZ A;  2KHO A;  5FPM A;  3KHW A;  4H5N A;  2K35 A;  1BUP A;  4HHF A;  4AB0 A;  1GPS A;  5AQX A;  1ZVG A;  1DKG D;  4HE7 A;  4AEI A;  2KBH A;  1SNB A;  3ATU A;  1JZA A;  5AQJ A;  5AQU A;  1LQQ A;  3BK3 C;  2YEO A;  1ATR A;  5AQO A;  3GKU A;  2QWQ A;  3ATV A;  1WMT A;  2YBR C;  1NGJ A;  5F1X A;  3KP1 A;  2QWL A;  3M3Z A;  1NGC A;  3C7N B;  2E3F A;  1MYN A;  2MBK A;  4FL9 A;  2QWR A;  1I6G A;  3GDQ A;  1VNA A;  4KYP A;  2E2F A;  3C7N A;  3LDQ A;  4AAZ A;  1KAY A;  5AQH A;  1L4V A;  3LDP A;  1ZYV A;  4IO8 A;  1B3C A;  1I6F A;  5FPD A;  2V7Z A;  1YUW A;  2YIP A;  1HPM A;  2E88 A;  1PE4 A;  1HJO A;  4H5R A;  1NH5 A;  3QFU A;  2BUP A;  5F0X A;  5AQY A;  1T7E A;  5EXW A;  2YIO A;  3QI7 A;  1FH3 A;  1ZU3 A;  3KOZ A;  2GMO A;  3D2E B;  1GPT A;  3KOY A;  5F2R A;  1SEG A;  1ZFU A;  4V1D C;  1MR4 A;  5AQI A;  2KBJ A;  3D2E A;  1AYJ A;  5EY4 A;  2SN3 A;  1T1T A;  4H5T A;  5AQS A;  3KVG A;  1T0Z A;  1JXC A;  2GL1 A;  2KYQ A;  2KGQ A;  2KJA A;  5FPE A;  5AQR A;  1KV0 A;  2B3C A;  3AY9 A;  5BPM A;  2N66 A;  2YC1 C;  2M8B B;  3GL1 A;  3LDO A;  3L56 A;  3LDL A;  1BK8 A;  2QWO A;  3PSM A;  5AQQ A;  1BRZ A;  2LJ7 A;  3FZH A;  5AQW A;  1PX9 A;  1NGG A;  2E0H A;  2BRZ A;  1ZVE A;  3E7U X;  4UJ0 A;  1BMR A;  1P0A A;  2I61 A;  1BA0 A;  2VY6 A;  2E3G A;  2JDQ D;  4FSV A;  1QQO A;  1AHO A;  4UAD E;  1ICA A;  1POI A;  1QQM A;  2LKB A;  5FPN A;  2LT8 A;  3FZF A;  1NGD A;  1NPI A;  3QML A;  1DJT A;  3KC6 A;  1NGE A;  1SN1 A;  1LQI A;  3LDN A;  2QXL A;  1DQ7 A;  1ZYW A;  3SF4 D;  2MN5 A;  1NE5 A;  1WWN A;  5AQK A;  5AQM A;  5BPL A;  1P00 A;  4HWI A;  5AQV A;  3L4I A;  3HSC A;  5AQG A;  1TI5 A;  1HX1 A;  1S3X A;  3FZM A;  1CHZ A;  2KPY A;  3FZK A;  2LY6 A;  1NGH A;  3I33 A;  2NY8 X;  1ATS A;  3FE1 A;  1T7A A;  2B68 A;  1NGF A;  2E8A A;  5BN8 A;  1I2V A;  2KBK A;  3KP0 A;  2QWP A;  3KOW A;  3CQX A;  2QWN A;  1C56 A;  1LQH A;  2YIL A;  4KBO A;  2KSK A;  3QFP A;  1XRS B;  1KAX A;  2ASC A;  1KAZ A;  1OZZ A;  3R2V A;  4H5V A;  4UAE F;  5AQF A;  1CN2 A;  1I2U A;  5EX5 A;  1C55 A;  3KOX A;  3IUC A;  5EVZ A;  1N4N A;  5CY0 A;  4GNI A;  5KK4 A;  1QQN A;  5AR0 A;  2QWM A;  1NRA A;  3A8Y A;  1WT7 A;  3D2F B;  2LY5 A;  3CW4 A;  3JXU A;  5AQP A;  1B7D A;  1SN4 A;  2N69 A;  4CQK A;  5AQN A;  3E7R L;  1NRB A;  1K8B A;  3D2F A;  1ZUT A;  2LN8 A;  4H5W A;  1NGA A;  1JZB A;  4UAF E;  1BCG A;  1NGB A;  2QW9 A;  1NGI A;  2LJM A;  2N2Q A;  3L6Q A;  1T7B A;  5AQT A;  1OMY A;  2N2R A;  1BA1 A;  5BPN A;  2ATB A;  2NY9 X;  1UGL A;  1VNB A;  5BN9 A;  2LR3 A; 
#chains in the Genus database with same CATH homology
 3FZL A;  5AQZ A;  5AQL A;  2D56 A;  2KHO A;  5FPM A;  3KHW A;  4H5N A;  2K35 A;  1BUP A;  5AQX A;  1DKG D;  3ATU A;  5AQJ A;  5AQU A;  3BK3 C;  1ATR A;  5AQO A;  2QWQ A;  3ATV A;  1NGJ A;  5F1X A;  2QWL A;  3M3Z A;  1NGC A;  3C7N B;  4FL9 A;  2MBK A;  2QWR A;  3GDQ A;  2E2F A;  3C7N A;  3LDQ A;  1KAY A;  5AQH A;  3LDP A;  4IO8 A;  5FPD A;  2V7Z A;  1YUW A;  2YIP A;  1HPM A;  2E88 A;  1HJO A;  4H5R A;  3QFU A;  2BUP A;  5F0X A;  5AQY A;  5EXW A;  2YIO A;  3QI7 A;  2GMO A;  3D2E B;  5F2R A;  5AQI A;  3D2E A;  5EY4 A;  4H5T A;  5AQS A;  3KVG A;  5FPE A;  5AQR A;  3AY9 A;  5BPM A;  3GL1 A;  3LDO A;  3LDL A;  3L56 A;  2QWO A;  5AQQ A;  3FZH A;  5AQW A;  1NGG A;  1BA0 A;  2VY6 A;  2JDQ D;  4FSV A;  1QQO A;  4UAD E;  1POI A;  1QQM A;  5FPN A;  3FZF A;  1NGD A;  3QML A;  3KC6 A;  1NGE A;  3LDN A;  2QXL A;  3SF4 D;  2MN5 A;  5AQK A;  5AQM A;  5BPL A;  4HWI A;  5AQV A;  3L4I A;  3HSC A;  5AQG A;  1HX1 A;  1S3X A;  3FZM A;  3FZK A;  3I33 A;  1NGH A;  1ATS A;  3FE1 A;  2E8A A;  5BN8 A;  1NGF A;  2QWP A;  3CQX A;  2QWN A;  2YIL A;  4KBO A;  3QFP A;  4H5V A;  1KAX A;  1KAZ A;  3R2V A;  4UAE F;  5AQF A;  5EX5 A;  3IUC A;  5EVZ A;  4GNI A;  1QQN A;  5AR0 A;  2QWM A;  3A8Y A;  3JXU A;  5AQP A;  3D2F B;  3CW4 A;  5AQN A;  3D2F A;  2LN8 A;  4H5W A;  1NGA A;  4UAF E;  2QW9 A;  1NGB A;  1NGI A;  3L6Q A;  5AQT A;  1BA1 A;  5BPN A;  5BN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...