1NRBA

Solution structure of an old world-like neurotoxin from the venom of the new world scorpion centruroides sculpturatus ewing
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
63
Chain Sequence
KKDGYPVDSGNCKYECLKDDYCNDLCLERKADKGYCYWGKVSCYCYGLPDNSPTKTSGKCNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN V, CSE-V
publication title Solution structure of an Old World-like neurotoxin from the venom of the New World scorpion Centruroides sculpturatus Ewing.
pubmed rcsb
source organism Centruroides sculpturatus
molecule tags Neurotoxin
total genus 12
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1995-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1nrbA00
2LT8A 4AEIA 1JZAA 1NRAA 1GPSA 2M8BB 2MZ0A 3PSMA 2KGQA 1PTXA 1LQIA 1SN1A 1BRZA 1T1TA 1ZFUA 2LJMA 2ASCA 2NY9X 2BRZA 2KBJA 2KYQA 5KK4A 1NPIA 1WMTA 1SEGA 3E7UX 1JKZA 4HE7A 1LQQA 1TI5A 1L4VA 1P0AA 1SN4A 2LY5A 2N69A 2YC1C 2N2RA 4AAZA 1JZBA 2A7TA 2E3FA 1BK8A 4V1DC 1FH3A 2B3CA 1P00A 1ZYVA 4KYPA 1CHZA 4AB0A 2N2QA 1AHOA 2E0HA 1WWNA 1C55A 2KPYA 1MR4A 1BMRA 1CN2A 1ZVEA 1ZU3A 1I6FA 2SN3A 1B7DA 2YEOA 1ZUTA 1BCGA 1KV0A 1I6GA 1AYJA 2KJAA 2LR3A 2LJ7A 2GL1A 2LI7A 1NH5A 2NY8X 1LQHA 1B3CA 1OZZA 3E7RL 1GPTA 1C56A 1T7AA 2N66A 2LKBA 1NE5A 1T7EA 1T7BA 2KBKA 2B68A 1SNBA 1ZVGA 2E3GA 2I61A 1JXCA 2KSKA 1I2UA 1ZYWA 1NRBA 2LY6A 1PX9A 1WT7A 1DQ7A 2YBRC 4CQKA 1MYNA 1PE4A 1VNAA 2ATBA 2KBHA 1I2VA 1N4NA 5CY0A 1ICAA 1OMYA 4HHFA 4UJ0A 1DJTA 1T0ZA 1VNBA
chains in the Genus database with same CATH superfamily
5AQNA 2YIOA 2JDQD 5AQSA 2LT8A 4AEIA 2BUPA 1JZAA 1NRAA 2D56A 5FPMA 1GPSA 2M8BB 2MZ0A 1XRSB 3D2FA 3PSMA 4HWIA 2KHOA 1NGHA 4FSVA 3D2FB 1ATRA 2E8AA 1PTXA 1LQIA 1SN1A 2KGQA 3LDPA 1BRZA 1T1TA 5AR0A 3KOXA 1NGBA 1ZFUA 4GNIA 1UGLA 5EY4A 2LJMA 2ASCA 2LN8A 2NY9X 2BRZA 2KBJA 2KYQA 3L4IA 5AQLA 3FZMA 5KK4A 1NPIA 2YIPA 1WMTA 1SEGA 1HPMA 2YILA 1QQNA 3E7UX 3KVGA 1JKZA 4HE7A 1ATSA 2E2FA 1LQQA 1TI5A 1NGIA 5AQWA 1L4VA 3D2EA 3FE1A 1P0AA 1SN4A 3ATVA 5AQJA 2LY5A 2N69A 3A8YA 3I33A 3JXUA 2YC1C 2N2RA 4AAZA 1BA0A 1JZBA 2A7TA 2E3FA 3C7NB 1BK8A 3LDNA 4V1DC 5EXWA 1FH3A 2B3CA 1P00A 1KAZA 1S3XA 1ZYVA 3QFPA 4KYPA 1CHZA 1NGGA 4AB0A 1NGFA 3GDQA 5BN9A 5AQXA 3KOYA 1NGEA 1AHOA 2E0HA 1WWNA 2N2QA 1C55A 2K35A 2KPYA 1MR4A 3QFUA 3CQXA 5BN8A 1K8BA 5AQTA 3FZKA 1KAXA 1BMRA 1NGJA 1CN2A 1ZVEA 1ZU3A 1I6FA 2SN3A 1B7DA 1NGAA 3ATUA 2QWMA 4FL9A 4H5VA 2YEOA 5F1XA 3AY9A 3LDOA 5FPNA 5FPEA 1ZUTA 4KBOA 5AQFA 1BCGA 3LDLA 4H5WA 1HX1A 2QWLA 3KHWA 5F2RA 3C7NA 5FPDA 3R2VA 2QWQA 3GL1A 5AQRA 3M3ZA 4UADE 5AQPA 5BPMA 5AQVA 1KV0A 3SF4D 1I6GA 2GMOA 2MN5A 1AYJA 2KJAA 3KP1A 5AQOA 3FZHA 3GKUA 1KAYA 2LR3A 4IO8A 2LJ7A 3KP0A 1BA1A 2E88A 1QQMA 2GL1A 1NH5A 2LI7A 1LQHA 2NY8X 2QW9A 2QXLA 3LDQA 4H5RA 5AQGA 1OZZA 5AQYA 1B3CA 3E7RL 5AQZA 2QWPA 1GPTA 1C56A 3QMLA 3KOWA 5AQIA 1T7AA 2N66A 2LKBA 4UAFE 3KC6A 1NE5A 1T7EA 3FZLA 1T7BA 2KBKA 1SNBA 1HJOA 1NGCA 1ZVGA 1POIA 2B68A 2E3GA 2I61A 5AQKA 1JXCA 2G2KA 2MBKA 2QWRA 4H5TA 4UAEF 3IUCA 1YUWA 5AQMA 2VY6A 2KSKA 3QI7A 3FZFA 5F0XA 5AQHA 5AQUA 1I2UA 1ZYWA 3CW4A 1NRBA 2LY6A 3BK3C 5AQQA 5EX5A 3L6QA 5BPLA 1PX9A 1WT7A 1DQ7A 1NGDA 2YBRC 4CQKA 1MYNA 1PE4A 1VNAA 2V7ZA 1DKGD 1BUPA 2ATBA 2KBHA 3L56A 1I2VA 1N4NA 5EVZA 2QWNA 5CY0A 1ICAA 1OMYA 2QWOA 3D2EB 3KOZA 4H5NA 1QQOA 4HHFA 3HSCA 5BPNA 4UJ0A 1DJTA 1T0ZA 1VNBA
chains in the Genus database with same CATH topology
2LT8A 4AEIA 1JZAA 1NRAA 1GPSA 2M8BB 2MZ0A 3PSMA 2KGQA 1PTXA 1LQIA 1SN1A 1BRZA 1T1TA 1ZFUA 2LJMA 2ASCA 2NY9X 2BRZA 2KBJA 2KYQA 5KK4A 1NPIA 1WMTA 1SEGA 3E7UX 1JKZA 4HE7A 1LQQA 1TI5A 1L4VA 1P0AA 1SN4A 2LY5A 2N69A 2YC1C 2N2RA 4AAZA 1JZBA 2A7TA 2E3FA 1BK8A 4V1DC 1FH3A 2B3CA 1P00A 1ZYVA 4KYPA 1CHZA 4AB0A 2N2QA 1AHOA 2E0HA 1WWNA 1C55A 2KPYA 1MR4A 1BMRA 1CN2A 1ZVEA 1ZU3A 1I6FA 2SN3A 1B7DA 2YEOA 1ZUTA 1BCGA 1KV0A 1I6GA 1AYJA 2KJAA 2LR3A 2LJ7A 2GL1A 2LI7A 1NH5A 2NY8X 1LQHA 1B3CA 1OZZA 3E7RL 1GPTA 1C56A 1T7AA 2N66A 2LKBA 1NE5A 1T7EA 1T7BA 2KBKA 2B68A 1SNBA 1ZVGA 2E3GA 2I61A 1JXCA 2KSKA 1I2UA 1ZYWA 1NRBA 2LY6A 1PX9A 1WT7A 1DQ7A 2YBRC 4CQKA 1MYNA 1PE4A 1VNAA 2ATBA 2KBHA 1I2VA 1N4NA 5CY0A 1ICAA 1OMYA 4HHFA 4UJ0A 1DJTA 1T0ZA 1VNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT8 A;  4AEI A;  1JZA A;  1NRA A;  1GPS A;  2M8B B;  2MZ0 A;  3PSM A;  2KGQ A;  1PTX A;  1LQI A;  1SN1 A;  1BRZ A;  1T1T A;  1ZFU A;  2LJM A;  2ASC A;  2NY9 X;  2BRZ A;  2KBJ A;  2KYQ A;  5KK4 A;  1NPI A;  1WMT A;  1SEG A;  3E7U X;  1JKZ A;  4HE7 A;  1LQQ A;  1TI5 A;  1L4V A;  1P0A A;  1SN4 A;  2LY5 A;  2N69 A;  2YC1 C;  2N2R A;  4AAZ A;  1JZB A;  2A7T A;  2E3F A;  1BK8 A;  4V1D C;  1FH3 A;  2B3C A;  1P00 A;  1ZYV A;  4KYP A;  1CHZ A;  4AB0 A;  2N2Q A;  1AHO A;  2E0H A;  1WWN A;  1C55 A;  2KPY A;  1MR4 A;  1BMR A;  1CN2 A;  1ZVE A;  1ZU3 A;  1I6F A;  2SN3 A;  1B7D A;  2YEO A;  1ZUT A;  1BCG A;  1KV0 A;  1I6G A;  1AYJ A;  2KJA A;  2LR3 A;  2LJ7 A;  2GL1 A;  2LI7 A;  1NH5 A;  2NY8 X;  1LQH A;  1B3C A;  1OZZ A;  3E7R L;  1GPT A;  1C56 A;  1T7A A;  2N66 A;  2LKB A;  1NE5 A;  1T7E A;  1T7B A;  2KBK A;  2B68 A;  1SNB A;  1ZVG A;  2E3G A;  2I61 A;  1JXC A;  2KSK A;  1I2U A;  1ZYW A;  1NRB A;  2LY6 A;  1PX9 A;  1WT7 A;  1DQ7 A;  2YBR C;  4CQK A;  1MYN A;  1PE4 A;  1VNA A;  2ATB A;  2KBH A;  1I2V A;  1N4N A;  5CY0 A;  1ICA A;  1OMY A;  4HHF A;  4UJ0 A;  1DJT A;  1T0Z A;  1VNB A; 
#chains in the Genus database with same CATH topology
 5AQN A;  2YIO A;  2JDQ D;  5AQS A;  2LT8 A;  4AEI A;  2BUP A;  1JZA A;  1NRA A;  2D56 A;  5FPM A;  1GPS A;  2M8B B;  2MZ0 A;  1XRS B;  3D2F A;  3PSM A;  4HWI A;  2KHO A;  1NGH A;  4FSV A;  3D2F B;  1ATR A;  2E8A A;  1PTX A;  1LQI A;  1SN1 A;  2KGQ A;  3LDP A;  1BRZ A;  1T1T A;  5AR0 A;  3KOX A;  1NGB A;  1ZFU A;  4GNI A;  1UGL A;  5EY4 A;  2LJM A;  2ASC A;  2LN8 A;  2NY9 X;  2BRZ A;  2KBJ A;  2KYQ A;  3L4I A;  5AQL A;  3FZM A;  5KK4 A;  1NPI A;  2YIP A;  1WMT A;  1SEG A;  1HPM A;  2YIL A;  1QQN A;  3E7U X;  3KVG A;  1JKZ A;  4HE7 A;  1ATS A;  2E2F A;  1LQQ A;  1TI5 A;  1NGI A;  5AQW A;  1L4V A;  3D2E A;  3FE1 A;  1P0A A;  1SN4 A;  3ATV A;  5AQJ A;  2LY5 A;  2N69 A;  3A8Y A;  3I33 A;  3JXU A;  2YC1 C;  2N2R A;  4AAZ A;  1BA0 A;  1JZB A;  2A7T A;  2E3F A;  3C7N B;  1BK8 A;  3LDN A;  4V1D C;  5EXW A;  1FH3 A;  2B3C A;  1P00 A;  1KAZ A;  1S3X A;  1ZYV A;  3QFP A;  4KYP A;  1CHZ A;  1NGG A;  4AB0 A;  1NGF A;  3GDQ A;  5BN9 A;  5AQX A;  3KOY A;  1NGE A;  1AHO A;  2E0H A;  1WWN A;  2N2Q A;  1C55 A;  2K35 A;  2KPY A;  1MR4 A;  3QFU A;  3CQX A;  5BN8 A;  1K8B A;  5AQT A;  3FZK A;  1KAX A;  1BMR A;  1NGJ A;  1CN2 A;  1ZVE A;  1ZU3 A;  1I6F A;  2SN3 A;  1B7D A;  1NGA A;  3ATU A;  2QWM A;  4FL9 A;  4H5V A;  2YEO A;  5F1X A;  3AY9 A;  3LDO A;  5FPN A;  5FPE A;  1ZUT A;  4KBO A;  5AQF A;  1BCG A;  3LDL A;  4H5W A;  1HX1 A;  2QWL A;  3KHW A;  5F2R A;  3C7N A;  5FPD A;  3R2V A;  2QWQ A;  3GL1 A;  5AQR A;  3M3Z A;  4UAD E;  5AQP A;  5BPM A;  5AQV A;  1KV0 A;  3SF4 D;  1I6G A;  2GMO A;  2MN5 A;  1AYJ A;  2KJA A;  3KP1 A;  5AQO A;  3FZH A;  3GKU A;  1KAY A;  2LR3 A;  4IO8 A;  2LJ7 A;  3KP0 A;  1BA1 A;  2E88 A;  1QQM A;  2GL1 A;  1NH5 A;  2LI7 A;  1LQH A;  2NY8 X;  2QW9 A;  2QXL A;  3LDQ A;  4H5R A;  5AQG A;  1OZZ A;  5AQY A;  1B3C A;  3E7R L;  5AQZ A;  2QWP A;  1GPT A;  1C56 A;  3QML A;  3KOW A;  5AQI A;  1T7A A;  2N66 A;  2LKB A;  4UAF E;  3KC6 A;  1NE5 A;  1T7E A;  3FZL A;  1T7B A;  2KBK A;  1SNB A;  1HJO A;  1NGC A;  1ZVG A;  1POI A;  2B68 A;  2E3G A;  2I61 A;  5AQK A;  1JXC A;  2G2K A;  2MBK A;  2QWR A;  4H5T A;  4UAE F;  3IUC A;  1YUW A;  5AQM A;  2VY6 A;  2KSK A;  3QI7 A;  3FZF A;  5F0X A;  5AQH A;  5AQU A;  1I2U A;  1ZYW A;  3CW4 A;  1NRB A;  2LY6 A;  3BK3 C;  5AQQ A;  5EX5 A;  3L6Q A;  5BPL A;  1PX9 A;  1WT7 A;  1DQ7 A;  1NGD A;  2YBR C;  4CQK A;  1MYN A;  1PE4 A;  1VNA A;  2V7Z A;  1DKG D;  1BUP A;  2ATB A;  2KBH A;  3L56 A;  1I2V A;  1N4N A;  5EVZ A;  2QWN A;  5CY0 A;  1ICA A;  1OMY A;  2QWO A;  3D2E B;  3KOZ A;  4H5N A;  1QQO A;  4HHF A;  3HSC A;  5BPN A;  4UJ0 A;  1DJT A;  1T0Z A;  1VNB A; 
#chains in the Genus database with same CATH homology
 2LT8 A;  4AEI A;  1JZA A;  1NRA A;  1GPS A;  2M8B B;  2MZ0 A;  3PSM A;  2KGQ A;  1PTX A;  1LQI A;  1SN1 A;  1BRZ A;  1T1T A;  1ZFU A;  2LJM A;  2ASC A;  2NY9 X;  2BRZ A;  2KBJ A;  2KYQ A;  5KK4 A;  1NPI A;  1WMT A;  1SEG A;  3E7U X;  1JKZ A;  4HE7 A;  1LQQ A;  1TI5 A;  1L4V A;  1P0A A;  1SN4 A;  2LY5 A;  2N69 A;  2YC1 C;  2N2R A;  4AAZ A;  1JZB A;  2A7T A;  2E3F A;  1BK8 A;  4V1D C;  1FH3 A;  2B3C A;  1P00 A;  1ZYV A;  4KYP A;  1CHZ A;  4AB0 A;  2N2Q A;  1AHO A;  2E0H A;  1WWN A;  1C55 A;  2KPY A;  1MR4 A;  1BMR A;  1CN2 A;  1ZVE A;  1ZU3 A;  1I6F A;  2SN3 A;  1B7D A;  2YEO A;  1ZUT A;  1BCG A;  1KV0 A;  1I6G A;  1AYJ A;  2KJA A;  2LR3 A;  2LJ7 A;  2GL1 A;  2LI7 A;  1NH5 A;  2NY8 X;  1LQH A;  1B3C A;  1OZZ A;  3E7R L;  1GPT A;  1C56 A;  1T7A A;  2N66 A;  2LKB A;  1NE5 A;  1T7E A;  1T7B A;  2KBK A;  2B68 A;  1SNB A;  1ZVG A;  2E3G A;  2I61 A;  1JXC A;  2KSK A;  1I2U A;  1ZYW A;  1NRB A;  2LY6 A;  1PX9 A;  1WT7 A;  1DQ7 A;  2YBR C;  4CQK A;  1MYN A;  1PE4 A;  1VNA A;  2ATB A;  2KBH A;  1I2V A;  1N4N A;  5CY0 A;  1ICA A;  1OMY A;  4HHF A;  4UJ0 A;  1DJT A;  1T0Z A;  1VNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...