2M8BB

Solution structure of ahpdf1 from arabidopsis halleri
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
ERLCEKPSGTWSGVCGNNGACRNQCIRLEKARHGSCNYVFPAHKCICYFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plant defensin PDF1.1
publication title The nuclear magnetic resonance solution structure of the synthetic AhPDF1.1b plant defensin evidences the structural feature within the gamma-motif.
pubmed doi rcsb
source organism Arabidopsis halleri
molecule tags Plant protein
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2m8bB00
1BK8A 1WT7A 1BRZA 1AYJA 1I2VA 2N66A 2LY5A 1FH3A 1VNBA 1GPSA 1L4VA 1DQ7A 1PX9A 2I61A 1I6GA 2YC1C 1BCGA 1SN4A 4HHFA 2KBKA 3PSMA 1JZBA 1SN1A 1T7EA 4KYPA 5CY0A 1LQHA 1NH5A 1KV0A 1PE4A 1B3CA 2B3CA 2YEOA 1I2UA 2LI7A 2LKBA 1T7AA 1ZVGA 2KBHA 1C56A 1B7DA 2LT8A 2KGQA 2KJAA 5KK4A 2N2RA 1AHOA 1CHZA 1LQQA 2E3FA 2LR3A 2N2QA 2SN3A 3E7RL 1ZU3A 4V1DC 1ZYVA 1PTXA 2LY6A 2MZ0A 1N4NA 1CN2A 4UJ0A 1OMYA 1ZUTA 4AB0A 1NE5A 4AAZA 1ZVEA 2KYQA 1WMTA 1P0AA 1T7BA 1SNBA 2A7TA 1OZZA 1WWNA 2BRZA 1ZFUA 1NPIA 4HE7A 2NY9X 4AEIA 1I6FA 2B68A 4CQKA 3E7UX 1GPTA 2ASCA 1P00A 2KPYA 2ATBA 1LQIA 2E3GA 1T1TA 1DJTA 1NRAA 1TI5A 2NY8X 1JZAA 1ZYWA 1JXCA 2LJMA 2M8BB 2N69A 1SEGA 1BMRA 2E0HA 2KSKA 2KBJA 1MYNA 2LJ7A 1JKZA 1T0ZA 1MR4A 1ICAA 2YBRC 1C55A 1VNAA 1NRBA 2GL1A
chains in the Genus database with same CATH superfamily
5AQGA 1BK8A 1K8BA 1WT7A 5FPDA 1BRZA 3LDLA 1AYJA 3FE1A 1I2VA 2N66A 2LY5A 3KOXA 3QFPA 1NGAA 3M3ZA 1QQOA 1FH3A 1VNBA 1GPSA 3FZKA 1DQ7A 1L4VA 1UGLA 1PX9A 2I61A 1I6GA 2E88A 3GKUA 3KP0A 2YC1C 1BCGA 3D2FA 4H5VA 5BPMA 1SN4A 5AQOA 2QWPA 4HHFA 2KBKA 3PSMA 1JZBA 1SN1A 1T7EA 4H5WA 5AQZA 2JDQD 4GNIA 3GL1A 1LQHA 4KYPA 1NH5A 1KV0A 2GMOA 2QWLA 4UAEF 5CY0A 3KC6A 2YIOA 2YIPA 1PE4A 3LDQA 1KAXA 4H5NA 5AQTA 3IUCA 1B3CA 2B3CA 5FPMA 5EX5A 3SF4D 2YILA 3I33A 4KBOA 3QI7A 2YEOA 2QWOA 1I2UA 3C7NB 2G2KA 2LI7A 4UADE 2LKBA 1T7AA 1ZVGA 2KBHA 1C56A 1B7DA 2LT8A 5AQJA 2KGQA 4FL9A 2KJAA 5EY4A 2K35A 3KP1A 2N2RA 5KK4A 5AQFA 2QWNA 1AHOA 1CHZA 1LQQA 2E3FA 2LR3A 2N2QA 2SN3A 1NGCA 3E7RL 1DKGD 5AQHA 1ZU3A 4V1DC 1NGGA 1ZYVA 1PTXA 2LY6A 1KAYA 5BN8A 3CQXA 2MZ0A 5F0XA 1NGFA 1N4NA 1CN2A 1XRSB 1BUPA 4UJ0A 2D56A 5AQQA 1POIA 1NGHA 1OMYA 1ZUTA 4IO8A 1HJOA 5AQWA 3D2EB 4AB0A 1NE5A 4AAZA 2QWRA 1ZVEA 2KYQA 2QW9A 3QMLA 3KVGA 1WMTA 3KOYA 3LDPA 4FSVA 1P0AA 2V7ZA 1T7BA 1SNBA 3LDNA 2E8AA 3BK3C 2A7TA 1OZZA 1WWNA 2BRZA 2MBKA 3KOWA 5AQKA 3AY9A 2KHOA 3ATUA 4H5TA 1ZFUA 1NPIA 3L56A 2NY9X 4HE7A 4AEIA 1I6FA 3L6QA 1KAZA 2B68A 3A8YA 5AQPA 3QFUA 4UAFE 5AQXA 4CQKA 1YUWA 3E7UX 1GPTA 3ATVA 2ASCA 1P00A 3D2FB 1HX1A 2KPYA 5EVZA 3L4IA 2ATBA 1LQIA 1QQNA 2E3GA 5AQIA 2QXLA 2VY6A 1T1TA 1DJTA 3KOZA 1NRAA 1TI5A 2LN8A 2QWMA 2NY8X 1HPMA 3C7NA 1JZAA 1ZYWA 3FZFA 3HSCA 1NGIA 1JXCA 1ATRA 2LJMA 2M8BB 1NGEA 2N69A 1SEGA 1NGJA 1BMRA 2QWQA 5AQRA 3GDQA 5AQYA 5F1XA 5BPNA 2E0HA 3LDOA 5FPNA 2E2FA 3JXUA 2KSKA 3KHWA 5BPLA 2KBJA 4HWIA 1MYNA 3CW4A 1BA0A 1S3XA 2LJ7A 2MN5A 5AQLA 5AQUA 5AQSA 3R2VA 1QQMA 4H5RA 3FZMA 5F2RA 5AR0A 5FPEA 1JKZA 1T0ZA 1MR4A 3D2EA 2YBRC 5EXWA 1ATSA 1ICAA 5AQMA 1C55A 1BA1A 5BN9A 1VNAA 1NGBA 2BUPA 5AQNA 1NRBA 5AQVA 3FZLA 2GL1A 3FZHA 1NGDA
chains in the Genus database with same CATH topology
1BK8A 1WT7A 1BRZA 1AYJA 1I2VA 2N66A 2LY5A 1FH3A 1VNBA 1GPSA 1L4VA 1DQ7A 1PX9A 2I61A 1I6GA 2YC1C 1BCGA 1SN4A 4HHFA 2KBKA 3PSMA 1JZBA 1SN1A 1T7EA 4KYPA 5CY0A 1LQHA 1NH5A 1KV0A 1PE4A 1B3CA 2B3CA 2YEOA 1I2UA 2LI7A 2LKBA 1T7AA 1ZVGA 2KBHA 1C56A 1B7DA 2LT8A 2KGQA 2KJAA 5KK4A 2N2RA 1AHOA 1CHZA 1LQQA 2E3FA 2LR3A 2N2QA 2SN3A 3E7RL 1ZU3A 4V1DC 1ZYVA 1PTXA 2LY6A 2MZ0A 1N4NA 1CN2A 4UJ0A 1OMYA 1ZUTA 4AB0A 1NE5A 4AAZA 1ZVEA 2KYQA 1WMTA 1P0AA 1T7BA 1SNBA 2A7TA 1OZZA 1WWNA 2BRZA 1ZFUA 1NPIA 4HE7A 2NY9X 4AEIA 1I6FA 2B68A 4CQKA 3E7UX 1GPTA 2ASCA 1P00A 2KPYA 2ATBA 1LQIA 2E3GA 1T1TA 1DJTA 1NRAA 1TI5A 2NY8X 1JZAA 1ZYWA 1JXCA 2LJMA 2M8BB 2N69A 1SEGA 1BMRA 2E0HA 2KSKA 2KBJA 1MYNA 2LJ7A 1JKZA 1T0ZA 1MR4A 1ICAA 2YBRC 1C55A 1VNAA 1NRBA 2GL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BK8 A;  1WT7 A;  1BRZ A;  1AYJ A;  1I2V A;  2N66 A;  2LY5 A;  1FH3 A;  1VNB A;  1GPS A;  1L4V A;  1DQ7 A;  1PX9 A;  2I61 A;  1I6G A;  2YC1 C;  1BCG A;  1SN4 A;  4HHF A;  2KBK A;  3PSM A;  1JZB A;  1SN1 A;  1T7E A;  4KYP A;  5CY0 A;  1LQH A;  1NH5 A;  1KV0 A;  1PE4 A;  1B3C A;  2B3C A;  2YEO A;  1I2U A;  2LI7 A;  2LKB A;  1T7A A;  1ZVG A;  2KBH A;  1C56 A;  1B7D A;  2LT8 A;  2KGQ A;  2KJA A;  5KK4 A;  2N2R A;  1AHO A;  1CHZ A;  1LQQ A;  2E3F A;  2LR3 A;  2N2Q A;  2SN3 A;  3E7R L;  1ZU3 A;  4V1D C;  1ZYV A;  1PTX A;  2LY6 A;  2MZ0 A;  1N4N A;  1CN2 A;  4UJ0 A;  1OMY A;  1ZUT A;  4AB0 A;  1NE5 A;  4AAZ A;  1ZVE A;  2KYQ A;  1WMT A;  1P0A A;  1T7B A;  1SNB A;  2A7T A;  1OZZ A;  1WWN A;  2BRZ A;  1ZFU A;  1NPI A;  4HE7 A;  2NY9 X;  4AEI A;  1I6F A;  2B68 A;  4CQK A;  3E7U X;  1GPT A;  2ASC A;  1P00 A;  2KPY A;  2ATB A;  1LQI A;  2E3G A;  1T1T A;  1DJT A;  1NRA A;  1TI5 A;  2NY8 X;  1JZA A;  1ZYW A;  1JXC A;  2LJM A;  2M8B B;  2N69 A;  1SEG A;  1BMR A;  2E0H A;  2KSK A;  2KBJ A;  1MYN A;  2LJ7 A;  1JKZ A;  1T0Z A;  1MR4 A;  1ICA A;  2YBR C;  1C55 A;  1VNA A;  1NRB A;  2GL1 A; 
#chains in the Genus database with same CATH topology
 5AQG A;  1BK8 A;  1K8B A;  1WT7 A;  5FPD A;  1BRZ A;  3LDL A;  1AYJ A;  3FE1 A;  1I2V A;  2N66 A;  2LY5 A;  3KOX A;  3QFP A;  1NGA A;  3M3Z A;  1QQO A;  1FH3 A;  1VNB A;  1GPS A;  3FZK A;  1DQ7 A;  1L4V A;  1UGL A;  1PX9 A;  2I61 A;  1I6G A;  2E88 A;  3GKU A;  3KP0 A;  2YC1 C;  1BCG A;  3D2F A;  4H5V A;  5BPM A;  1SN4 A;  5AQO A;  2QWP A;  4HHF A;  2KBK A;  3PSM A;  1JZB A;  1SN1 A;  1T7E A;  4H5W A;  5AQZ A;  2JDQ D;  4GNI A;  3GL1 A;  1LQH A;  4KYP A;  1NH5 A;  1KV0 A;  2GMO A;  2QWL A;  4UAE F;  5CY0 A;  3KC6 A;  2YIO A;  2YIP A;  1PE4 A;  3LDQ A;  1KAX A;  4H5N A;  5AQT A;  3IUC A;  1B3C A;  2B3C A;  5FPM A;  5EX5 A;  3SF4 D;  2YIL A;  3I33 A;  4KBO A;  3QI7 A;  2YEO A;  2QWO A;  1I2U A;  3C7N B;  2G2K A;  2LI7 A;  4UAD E;  2LKB A;  1T7A A;  1ZVG A;  2KBH A;  1C56 A;  1B7D A;  2LT8 A;  5AQJ A;  2KGQ A;  4FL9 A;  2KJA A;  5EY4 A;  2K35 A;  3KP1 A;  2N2R A;  5KK4 A;  5AQF A;  2QWN A;  1AHO A;  1CHZ A;  1LQQ A;  2E3F A;  2LR3 A;  2N2Q A;  2SN3 A;  1NGC A;  3E7R L;  1DKG D;  5AQH A;  1ZU3 A;  4V1D C;  1NGG A;  1ZYV A;  1PTX A;  2LY6 A;  1KAY A;  5BN8 A;  3CQX A;  2MZ0 A;  5F0X A;  1NGF A;  1N4N A;  1CN2 A;  1XRS B;  1BUP A;  4UJ0 A;  2D56 A;  5AQQ A;  1POI A;  1NGH A;  1OMY A;  1ZUT A;  4IO8 A;  1HJO A;  5AQW A;  3D2E B;  4AB0 A;  1NE5 A;  4AAZ A;  2QWR A;  1ZVE A;  2KYQ A;  2QW9 A;  3QML A;  3KVG A;  1WMT A;  3KOY A;  3LDP A;  4FSV A;  1P0A A;  2V7Z A;  1T7B A;  1SNB A;  3LDN A;  2E8A A;  3BK3 C;  2A7T A;  1OZZ A;  1WWN A;  2BRZ A;  2MBK A;  3KOW A;  5AQK A;  3AY9 A;  2KHO A;  3ATU A;  4H5T A;  1ZFU A;  1NPI A;  3L56 A;  2NY9 X;  4HE7 A;  4AEI A;  1I6F A;  3L6Q A;  1KAZ A;  2B68 A;  3A8Y A;  5AQP A;  3QFU A;  4UAF E;  5AQX A;  4CQK A;  1YUW A;  3E7U X;  1GPT A;  3ATV A;  2ASC A;  1P00 A;  3D2F B;  1HX1 A;  2KPY A;  5EVZ A;  3L4I A;  2ATB A;  1LQI A;  1QQN A;  2E3G A;  5AQI A;  2QXL A;  2VY6 A;  1T1T A;  1DJT A;  3KOZ A;  1NRA A;  1TI5 A;  2LN8 A;  2QWM A;  2NY8 X;  1HPM A;  3C7N A;  1JZA A;  1ZYW A;  3FZF A;  3HSC A;  1NGI A;  1JXC A;  1ATR A;  2LJM A;  2M8B B;  1NGE A;  2N69 A;  1SEG A;  1NGJ A;  1BMR A;  2QWQ A;  5AQR A;  3GDQ A;  5AQY A;  5F1X A;  5BPN A;  2E0H A;  3LDO A;  5FPN A;  2E2F A;  3JXU A;  2KSK A;  3KHW A;  5BPL A;  2KBJ A;  4HWI A;  1MYN A;  3CW4 A;  1BA0 A;  1S3X A;  2LJ7 A;  2MN5 A;  5AQL A;  5AQU A;  5AQS A;  3R2V A;  1QQM A;  4H5R A;  3FZM A;  5F2R A;  5AR0 A;  5FPE A;  1JKZ A;  1T0Z A;  1MR4 A;  3D2E A;  2YBR C;  5EXW A;  1ATS A;  1ICA A;  5AQM A;  1C55 A;  1BA1 A;  5BN9 A;  1VNA A;  1NGB A;  2BUP A;  5AQN A;  1NRB A;  5AQV A;  3FZL A;  2GL1 A;  3FZH A;  1NGD A; 
#chains in the Genus database with same CATH homology
 1BK8 A;  1WT7 A;  1BRZ A;  1AYJ A;  1I2V A;  2N66 A;  2LY5 A;  1FH3 A;  1VNB A;  1GPS A;  1L4V A;  1DQ7 A;  1PX9 A;  2I61 A;  1I6G A;  2YC1 C;  1BCG A;  1SN4 A;  4HHF A;  2KBK A;  3PSM A;  1JZB A;  1SN1 A;  1T7E A;  4KYP A;  5CY0 A;  1LQH A;  1NH5 A;  1KV0 A;  1PE4 A;  1B3C A;  2B3C A;  2YEO A;  1I2U A;  2LI7 A;  2LKB A;  1T7A A;  1ZVG A;  2KBH A;  1C56 A;  1B7D A;  2LT8 A;  2KGQ A;  2KJA A;  5KK4 A;  2N2R A;  1AHO A;  1CHZ A;  1LQQ A;  2E3F A;  2LR3 A;  2N2Q A;  2SN3 A;  3E7R L;  1ZU3 A;  4V1D C;  1ZYV A;  1PTX A;  2LY6 A;  2MZ0 A;  1N4N A;  1CN2 A;  4UJ0 A;  1OMY A;  1ZUT A;  4AB0 A;  1NE5 A;  4AAZ A;  1ZVE A;  2KYQ A;  1WMT A;  1P0A A;  1T7B A;  1SNB A;  2A7T A;  1OZZ A;  1WWN A;  2BRZ A;  1ZFU A;  1NPI A;  4HE7 A;  2NY9 X;  4AEI A;  1I6F A;  2B68 A;  4CQK A;  3E7U X;  1GPT A;  2ASC A;  1P00 A;  2KPY A;  2ATB A;  1LQI A;  2E3G A;  1T1T A;  1DJT A;  1NRA A;  1TI5 A;  2NY8 X;  1JZA A;  1ZYW A;  1JXC A;  2LJM A;  2M8B B;  2N69 A;  1SEG A;  1BMR A;  2E0H A;  2KSK A;  2KBJ A;  1MYN A;  2LJ7 A;  1JKZ A;  1T0Z A;  1MR4 A;  1ICA A;  2YBR C;  1C55 A;  1VNA A;  1NRB A;  2GL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...