2M8BB

Solution structure of ahpdf1 from arabidopsis halleri
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
51
structure length
51
Chain Sequence
ERLCEKPSGTWSGVCGNNGACRNQCIRLEKARHGSCNYVFPAHKCICYFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords plant defensin PDF1.1
publication title The nuclear magnetic resonance solution structure of the synthetic AhPDF1.1b plant defensin evidences the structural feature within the gamma-motif.
pubmed doi rcsb
source organism Arabidopsis halleri
total genus 12
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 2013-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2m8bB00
1CHZA 5CY0A 1NPIA 1WMTA 2YBRC 1T7BA 2LI7A 1I2UA 4CQKA 1AHOA 2LR3A 4KYPA 1BRZA 4AB0A 2E0HA 1BK8A 1NRBA 1VNBA 1BCGA 1FH3A 3E7UX 1N4NA 1LQQA 1P00A 1CN2A 2B68A 3PSMA 1JZAA 2KJAA 1I2VA 2KYQA 2KSKA 1PE4A 1JKZA 2ATBA 1L4VA 1TI5A 1LQIA 2LJMA 1DJTA 1LQHA 1T0ZA 2LY6A 5KK4A 2NY9X 4AAZA 1PTXA 2N66A 2B3CA 1GPTA 2KBJA 2ASCA 1B3CA 2GL1A 4V1DC 2N2QA 1NE5A 2LJ7A 1T1TA 1OMYA 1T7EA 1I6FA 1BMRA 1ZYWA 1SEGA 1MR4A 1WT7A 1ICAA 1DQ7A 1T7AA 2M8BB 1P0AA 2NY8X 1ZYVA 1B7DA 2I61A 4HE7A 2LT8A 2MZ0A 4AEIA 1I6GA 1ZFUA 1OZZA 1ZU3A 2E3GA 2KBKA 1JZBA 1NRAA 2E3FA 2LKBA 2YEOA 1NH5A 2N69A 1AYJA 1GPSA 1C56A 4UJ0A 4HHFA 2BRZA 1JXCA 1KV0A 1SN1A 1VNAA 1C55A 2A7TA 2KPYA 2KGQA 2LY5A 1PX9A 1ZVEA 1SNBA 1ZUTA 1SN4A 2SN3A 2YC1C 3E7RL 1WWNA 2N2RA 1MYNA 2KBHA 1ZVGA
chains in the Genus database with same CATH superfamily
1CHZA 5CY0A 5EX5A 4IO8A 1NPIA 1WMTA 2YBRC 4KBOA 1K8BA 1HPMA 1T7BA 3QFUA 2LI7A 1I2UA 3QI7A 4CQKA 1AHOA 2LR3A 2QXLA 4KYPA 1NGBA 2BUPA 2D56A 5AQIA 4AB0A 1BRZA 2E0HA 5AQLA 1KAYA 2GMOA 4GNIA 1NRBA 1VNBA 4UADE 5F2RA 1BK8A 5EVZA 1BCGA 1NGGA 5AQUA 2VY6A 3L56A 1FH3A 3E7UX 1N4NA 1LQQA 1P00A 1CN2A 2B68A 3GDQA 3KVGA 5AQQA 1UGLA 5AQZA 1YUWA 5BPLA 3PSMA 1JZAA 2E2FA 2KJAA 1DKGD 1NGJA 1BA1A 2KYQA 1PE4A 2KSKA 1I2VA 2G2KA 1JKZA 2ATBA 3BK3C 1POIA 1S3XA 3FZMA 1L4VA 3LDOA 5F0XA 1TI5A 1HX1A 2YILA 1LQIA 2LJMA 2QWQA 3CQXA 1DJTA 3QMLA 5F1XA 1LQHA 5AQYA 1T0ZA 2LY6A 5AQSA 5KK4A 2NY9X 4FSVA 5AQJA 5AR0A 4AAZA 2QWOA 5FPDA 5BN8A 1PTXA 4UAEF 5BPNA 5AQHA 2QWPA 2N66A 2V7ZA 3GKUA 1NGAA 5AQKA 2B3CA 2KHOA 1GPTA 2KBJA 5FPNA 1QQOA 5BN9A 1ATRA 2ASCA 3D2FA 3FZFA 1B3CA 2GL1A 4V1DC 2LN8A 2N2QA 3JXUA 1NE5A 3KP0A 3LDLA 2LJ7A 3QFPA 3R2VA 1T1TA 3FZHA 3I33A 5AQXA 5EY4A 5AQWA 3L6QA 1OMYA 1T7EA 3FZLA 1I6FA 1BMRA 1NGIA 1KAXA 3A8YA 1ZYWA 4H5TA 3D2EA 5AQVA 1SEGA 1MR4A 3FZKA 2MBKA 1NGDA 1KAZA 1WT7A 4HWIA 3SF4D 1QQMA 1ICAA 1HJOA 4H5VA 3ATVA 1DQ7A 1T7AA 2M8BB 1P0AA 3HSCA 2NY8X 5AQPA 1NGFA 1ZYVA 1B7DA 2I61A 2E88A 5FPMA 3KOXA 4HE7A 2LT8A 2MZ0A 3GL1A 4AEIA 3KOZA 1I6GA 1BA0A 1ZFUA 3ATUA 4H5RA 5BPMA 1OZZA 1ZU3A 2K35A 2E3GA 2KBKA 3KC6A 1BUPA 4UAFE 5AQTA 1JZBA 1NRAA 2E3FA 2JDQD 2LKBA 2YEOA 3AY9A 4H5WA 3LDPA 1ATSA 1NH5A 4FL9A 2N69A 3C7NA 1AYJA 3M3ZA 1GPSA 2QW9A 1C56A 5FPEA 4UJ0A 2QWLA 4HHFA 5EXWA 5AQNA 2BRZA 1JXCA 1KV0A 2QWNA 2YIPA 1SN1A 5AQGA 1NGHA 2YIOA 1VNAA 3LDQA 1C55A 2A7TA 2KPYA 2KGQA 3D2FB 3L4IA 2E8AA 2QWRA 2LY5A 3KP1A 1PX9A 1ZVEA 5AQFA 1QQNA 1SNBA 1ZUTA 1SN4A 2SN3A 3KOWA 5AQOA 1XRSB 3KOYA 3IUCA 2YC1C 3C7NB 3E7RL 1NGEA 3CW4A 3FE1A 3LDNA 1WWNA 2MN5A 2N2RA 1MYNA 1NGCA 3KHWA 5AQMA 5AQRA 4H5NA 2QWMA 3D2EB 2KBHA 1ZVGA
chains in the Genus database with same CATH topology
1CHZA 5CY0A 1NPIA 1WMTA 2YBRC 1T7BA 2LI7A 1I2UA 4CQKA 1AHOA 2LR3A 4KYPA 1BRZA 4AB0A 2E0HA 1BK8A 1NRBA 1VNBA 1BCGA 1FH3A 3E7UX 1N4NA 1LQQA 1P00A 1CN2A 2B68A 3PSMA 1JZAA 2KJAA 1I2VA 2KYQA 2KSKA 1PE4A 1JKZA 2ATBA 1L4VA 1TI5A 1LQIA 2LJMA 1DJTA 1LQHA 1T0ZA 2LY6A 5KK4A 2NY9X 4AAZA 1PTXA 2N66A 2B3CA 1GPTA 2KBJA 2ASCA 1B3CA 2GL1A 4V1DC 2N2QA 1NE5A 2LJ7A 1T1TA 1OMYA 1T7EA 1I6FA 1BMRA 1ZYWA 1SEGA 1MR4A 1WT7A 1ICAA 1DQ7A 1T7AA 2M8BB 1P0AA 2NY8X 1ZYVA 1B7DA 2I61A 4HE7A 2LT8A 2MZ0A 4AEIA 1I6GA 1ZFUA 1OZZA 1ZU3A 2E3GA 2KBKA 1JZBA 1NRAA 2E3FA 2LKBA 2YEOA 1NH5A 2N69A 1AYJA 1GPSA 1C56A 4UJ0A 4HHFA 2BRZA 1JXCA 1KV0A 1SN1A 1VNAA 1C55A 2A7TA 2KPYA 2KGQA 2LY5A 1PX9A 1ZVEA 1SNBA 1ZUTA 1SN4A 2SN3A 2YC1C 3E7RL 1WWNA 2N2RA 1MYNA 2KBHA 1ZVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHZ A;  5CY0 A;  1NPI A;  1WMT A;  2YBR C;  1T7B A;  2LI7 A;  1I2U A;  4CQK A;  1AHO A;  2LR3 A;  4KYP A;  1BRZ A;  4AB0 A;  2E0H A;  1BK8 A;  1NRB A;  1VNB A;  1BCG A;  1FH3 A;  3E7U X;  1N4N A;  1LQQ A;  1P00 A;  1CN2 A;  2B68 A;  3PSM A;  1JZA A;  2KJA A;  1I2V A;  2KYQ A;  2KSK A;  1PE4 A;  1JKZ A;  2ATB A;  1L4V A;  1TI5 A;  1LQI A;  2LJM A;  1DJT A;  1LQH A;  1T0Z A;  2LY6 A;  5KK4 A;  2NY9 X;  4AAZ A;  1PTX A;  2N66 A;  2B3C A;  1GPT A;  2KBJ A;  2ASC A;  1B3C A;  2GL1 A;  4V1D C;  2N2Q A;  1NE5 A;  2LJ7 A;  1T1T A;  1OMY A;  1T7E A;  1I6F A;  1BMR A;  1ZYW A;  1SEG A;  1MR4 A;  1WT7 A;  1ICA A;  1DQ7 A;  1T7A A;  2M8B B;  1P0A A;  2NY8 X;  1ZYV A;  1B7D A;  2I61 A;  4HE7 A;  2LT8 A;  2MZ0 A;  4AEI A;  1I6G A;  1ZFU A;  1OZZ A;  1ZU3 A;  2E3G A;  2KBK A;  1JZB A;  1NRA A;  2E3F A;  2LKB A;  2YEO A;  1NH5 A;  2N69 A;  1AYJ A;  1GPS A;  1C56 A;  4UJ0 A;  4HHF A;  2BRZ A;  1JXC A;  1KV0 A;  1SN1 A;  1VNA A;  1C55 A;  2A7T A;  2KPY A;  2KGQ A;  2LY5 A;  1PX9 A;  1ZVE A;  1SNB A;  1ZUT A;  1SN4 A;  2SN3 A;  2YC1 C;  3E7R L;  1WWN A;  2N2R A;  1MYN A;  2KBH A;  1ZVG A; 
#chains in the Genus database with same CATH topology
 1CHZ A;  5CY0 A;  5EX5 A;  4IO8 A;  1NPI A;  1WMT A;  2YBR C;  4KBO A;  1K8B A;  1HPM A;  1T7B A;  3QFU A;  2LI7 A;  1I2U A;  3QI7 A;  4CQK A;  1AHO A;  2LR3 A;  2QXL A;  4KYP A;  1NGB A;  2BUP A;  2D56 A;  5AQI A;  4AB0 A;  1BRZ A;  2E0H A;  5AQL A;  1KAY A;  2GMO A;  4GNI A;  1NRB A;  1VNB A;  4UAD E;  5F2R A;  1BK8 A;  5EVZ A;  1BCG A;  1NGG A;  5AQU A;  2VY6 A;  3L56 A;  1FH3 A;  3E7U X;  1N4N A;  1LQQ A;  1P00 A;  1CN2 A;  2B68 A;  3GDQ A;  3KVG A;  5AQQ A;  1UGL A;  5AQZ A;  1YUW A;  5BPL A;  3PSM A;  1JZA A;  2E2F A;  2KJA A;  1DKG D;  1NGJ A;  1BA1 A;  2KYQ A;  1PE4 A;  2KSK A;  1I2V A;  2G2K A;  1JKZ A;  2ATB A;  3BK3 C;  1POI A;  1S3X A;  3FZM A;  1L4V A;  3LDO A;  5F0X A;  1TI5 A;  1HX1 A;  2YIL A;  1LQI A;  2LJM A;  2QWQ A;  3CQX A;  1DJT A;  3QML A;  5F1X A;  1LQH A;  5AQY A;  1T0Z A;  2LY6 A;  5AQS A;  5KK4 A;  2NY9 X;  4FSV A;  5AQJ A;  5AR0 A;  4AAZ A;  2QWO A;  5FPD A;  5BN8 A;  1PTX A;  4UAE F;  5BPN A;  5AQH A;  2QWP A;  2N66 A;  2V7Z A;  3GKU A;  1NGA A;  5AQK A;  2B3C A;  2KHO A;  1GPT A;  2KBJ A;  5FPN A;  1QQO A;  5BN9 A;  1ATR A;  2ASC A;  3D2F A;  3FZF A;  1B3C A;  2GL1 A;  4V1D C;  2LN8 A;  2N2Q A;  3JXU A;  1NE5 A;  3KP0 A;  3LDL A;  2LJ7 A;  3QFP A;  3R2V A;  1T1T A;  3FZH A;  3I33 A;  5AQX A;  5EY4 A;  5AQW A;  3L6Q A;  1OMY A;  1T7E A;  3FZL A;  1I6F A;  1BMR A;  1NGI A;  1KAX A;  3A8Y A;  1ZYW A;  4H5T A;  3D2E A;  5AQV A;  1SEG A;  1MR4 A;  3FZK A;  2MBK A;  1NGD A;  1KAZ A;  1WT7 A;  4HWI A;  3SF4 D;  1QQM A;  1ICA A;  1HJO A;  4H5V A;  3ATV A;  1DQ7 A;  1T7A A;  2M8B B;  1P0A A;  3HSC A;  2NY8 X;  5AQP A;  1NGF A;  1ZYV A;  1B7D A;  2I61 A;  2E88 A;  5FPM A;  3KOX A;  4HE7 A;  2LT8 A;  2MZ0 A;  3GL1 A;  4AEI A;  3KOZ A;  1I6G A;  1BA0 A;  1ZFU A;  3ATU A;  4H5R A;  5BPM A;  1OZZ A;  1ZU3 A;  2K35 A;  2E3G A;  2KBK A;  3KC6 A;  1BUP A;  4UAF E;  5AQT A;  1JZB A;  1NRA A;  2E3F A;  2JDQ D;  2LKB A;  2YEO A;  3AY9 A;  4H5W A;  3LDP A;  1ATS A;  1NH5 A;  4FL9 A;  2N69 A;  3C7N A;  1AYJ A;  3M3Z A;  1GPS A;  2QW9 A;  1C56 A;  5FPE A;  4UJ0 A;  2QWL A;  4HHF A;  5EXW A;  5AQN A;  2BRZ A;  1JXC A;  1KV0 A;  2QWN A;  2YIP A;  1SN1 A;  5AQG A;  1NGH A;  2YIO A;  1VNA A;  3LDQ A;  1C55 A;  2A7T A;  2KPY A;  2KGQ A;  3D2F B;  3L4I A;  2E8A A;  2QWR A;  2LY5 A;  3KP1 A;  1PX9 A;  1ZVE A;  5AQF A;  1QQN A;  1SNB A;  1ZUT A;  1SN4 A;  2SN3 A;  3KOW A;  5AQO A;  1XRS B;  3KOY A;  3IUC A;  2YC1 C;  3C7N B;  3E7R L;  1NGE A;  3CW4 A;  3FE1 A;  3LDN A;  1WWN A;  2MN5 A;  2N2R A;  1MYN A;  1NGC A;  3KHW A;  5AQM A;  5AQR A;  4H5N A;  2QWM A;  3D2E B;  2KBH A;  1ZVG A; 
#chains in the Genus database with same CATH homology
 1CHZ A;  5CY0 A;  1NPI A;  1WMT A;  2YBR C;  1T7B A;  2LI7 A;  1I2U A;  4CQK A;  1AHO A;  2LR3 A;  4KYP A;  1BRZ A;  4AB0 A;  2E0H A;  1BK8 A;  1NRB A;  1VNB A;  1BCG A;  1FH3 A;  3E7U X;  1N4N A;  1LQQ A;  1P00 A;  1CN2 A;  2B68 A;  3PSM A;  1JZA A;  2KJA A;  1I2V A;  2KYQ A;  2KSK A;  1PE4 A;  1JKZ A;  2ATB A;  1L4V A;  1TI5 A;  1LQI A;  2LJM A;  1DJT A;  1LQH A;  1T0Z A;  2LY6 A;  5KK4 A;  2NY9 X;  4AAZ A;  1PTX A;  2N66 A;  2B3C A;  1GPT A;  2KBJ A;  2ASC A;  1B3C A;  2GL1 A;  4V1D C;  2N2Q A;  1NE5 A;  2LJ7 A;  1T1T A;  1OMY A;  1T7E A;  1I6F A;  1BMR A;  1ZYW A;  1SEG A;  1MR4 A;  1WT7 A;  1ICA A;  1DQ7 A;  1T7A A;  2M8B B;  1P0A A;  2NY8 X;  1ZYV A;  1B7D A;  2I61 A;  4HE7 A;  2LT8 A;  2MZ0 A;  4AEI A;  1I6G A;  1ZFU A;  1OZZ A;  1ZU3 A;  2E3G A;  2KBK A;  1JZB A;  1NRA A;  2E3F A;  2LKB A;  2YEO A;  1NH5 A;  2N69 A;  1AYJ A;  1GPS A;  1C56 A;  4UJ0 A;  4HHF A;  2BRZ A;  1JXC A;  1KV0 A;  1SN1 A;  1VNA A;  1C55 A;  2A7T A;  2KPY A;  2KGQ A;  2LY5 A;  1PX9 A;  1ZVE A;  1SNB A;  1ZUT A;  1SN4 A;  2SN3 A;  2YC1 C;  3E7R L;  1WWN A;  2N2R A;  1MYN A;  2KBH A;  1ZVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...