2KJAA

Chemical shift assignments, constraints, and coordinates for cn5 scorpion toxin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
KEGYLVNKSTGCKYGCLLLGKNEGCDKECKAKNQGGSYGYCYAFGCWCEGLPESTPTYPLPNKSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-toxin Cn5
publication title Solution structure of Cn5, a crustacean toxin found in the venom of the scorpions Centruroides noxius and Centruroides suffusus suffusus.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kjaA00
1LQQA 1WMTA 1LQIA 2N66A 1SN4A 1I6FA 2KPYA 2YBRC 1BRZA 1B7DA 1CHZA 1VNAA 1I2VA 1AYJA 1NPIA 1I6GA 2LY6A 2B3CA 2KBHA 2LKBA 1NRBA 2N69A 2KYQA 1MYNA 1JXCA 1KV0A 2ASCA 2LJ7A 1JKZA 1T7AA 2E3GA 1NE5A 1JZBA 1SNBA 1ZYWA 1C56A 4UJ0A 2KGQA 2NY8X 3E7UX 1ICAA 2M8BB 1LQHA 1CN2A 2LJMA 5CY0A 2N2RA 1B3CA 1GPSA 1BK8A 1OZZA 2I61A 4AEIA 1FH3A 2N2QA 2KBKA 1T7BA 2YEOA 1T1TA 2E3FA 1P0AA 1ZYVA 2NY9X 4AB0A 2LR3A 1ZVEA 2LY5A 2SN3A 4HHFA 2LT8A 3PSMA 2KSKA 1ZUTA 1T0ZA 2A7TA 1I2UA 1SN1A 1ZVGA 1JZAA 1ZU3A 5KK4A 4AAZA 2KBJA 1DJTA 1PTXA 2E0HA 2YC1C 2KJAA 2LI7A 1WT7A 1BCGA 2BRZA 2MZ0A 1PE4A 4HE7A 1DQ7A 3E7RL 2ATBA 1OMYA 1N4NA 4KYPA 1NH5A 2GL1A 1WWNA 1PX9A 1SEGA 2B68A 4V1DC 4CQKA 1C55A 1MR4A 1BMRA 1AHOA 1P00A 1GPTA 1NRAA 1VNBA 1TI5A 1T7EA 1ZFUA 1L4VA
chains in the Genus database with same CATH superfamily
4UJ0A 1LQQA 1WMTA 2D56A 1LQIA 3JXUA 4IO8A 2N66A 3D2FB 1SN4A 1QQNA 3LDNA 3KOYA 1BK8A 1I6FA 5AQNA 2QWOA 1BA0A 2KPYA 2YBRC 1BRZA 1B7DA 1CHZA 1VNAA 4H5RA 1I2VA 1AYJA 5BN9A 1QQMA 3D2FA 3FZHA 5AQIA 3KOZA 5EXWA 1NPIA 5AQPA 1I6GA 2E8AA 3LDLA 2LY6A 2B3CA 2KBHA 2LKBA 5AQVA 1NRBA 5BN8A 4UADE 5AQWA 2GMOA 1UGLA 4H5NA 2N69A 2KYQA 1MYNA 2MN5A 3AY9A 3I33A 3KVGA 2QWQA 3C7NB 2KHOA 1NGCA 5FPDA 5AQMA 1JXCA 1KV0A 3CW4A 2ASCA 5EX5A 2LJ7A 5F2RA 1JKZA 1T7AA 1HJOA 3KP1A 3LDOA 1NGFA 2E3GA 1NE5A 5AR0A 1KAZA 1NGHA 5BPMA 1YUWA 1JZBA 3ATVA 3D2EB 3KOWA 1NGAA 1SNBA 1ZYWA 1C56A 4GNIA 3KHWA 1K8BA 3LDPA 2KGQA 2NY8X 3E7UX 3FZFA 3QMLA 2M8BB 2G2KA 2QWLA 5AQOA 1ICAA 1LQHA 5F0XA 1CN2A 1KAYA 1DKGD 2LJMA 5CY0A 2N2RA 1B3CA 1POIA 1S3XA 1GPSA 1XRSB 3QFPA 1OZZA 2E2FA 2I61A 3FE1A 4KBOA 5AQSA 4AEIA 1NGEA 1BUPA 1FH3A 1HX1A 2QWRA 2N2QA 1NGGA 2KBKA 3LDQA 1T7BA 2YEOA 5AQUA 3L56A 4FSVA 1T1TA 2E3FA 1P0AA 1ZYVA 2YIOA 5AQJA 2NY9X 3KP0A 4H5WA 2BUPA 3FZLA 2YILA 5AQLA 4AB0A 2LR3A 5F1XA 1ZVEA 2LY5A 3QFUA 2SN3A 4HHFA 2LT8A 2YIPA 5AQKA 3PSMA 2KSKA 1ZUTA 1T0ZA 4UAFE 5BPNA 5FPEA 3FZMA 2A7TA 1BA1A 3ATUA 3C7NA 3L4IA 1I2UA 1SN1A 3GKUA 5AQFA 3R2VA 1ZVGA 4FL9A 1HPMA 1JZAA 1ZU3A 5EY4A 5KK4A 1KAXA 1NGIA 4H5TA 5AQTA 4AAZA 2MBKA 2V7ZA 4HWIA 2KBJA 1DJTA 2QW9A 5AQXA 2QWPA 5FPMA 3D2EA 4H5VA 5AQHA 3SF4D 1PTXA 2E0HA 3M3ZA 2YC1C 3FZKA 2KJAA 2QWNA 3A8YA 5AQYA 2LI7A 1WT7A 5AQGA 3GDQA 1BCGA 2VY6A 3CQXA 1QQOA 2BRZA 5AQZA 2MZ0A 1PE4A 3KC6A 4HE7A 1DQ7A 3IUCA 3E7RL 2ATBA 1OMYA 5AQRA 1ATSA 1N4NA 1NGBA 2E88A 2LN8A 5AQQA 4KYPA 1NH5A 2GL1A 3GL1A 1WWNA 3L6QA 1NGJA 1PX9A 1SEGA 2B68A 4UAEF 4V1DC 4CQKA 1C55A 1MR4A 1NGDA 1AHOA 2JDQD 1BMRA 5EVZA 2QWMA 5FPNA 1P00A 2QXLA 1GPTA 1NRAA 1VNBA 1TI5A 3QI7A 1T7EA 2K35A 3HSCA 3KOXA 3BK3C 1ZFUA 5BPLA 1L4VA 1ATRA
chains in the Genus database with same CATH topology
1LQQA 1WMTA 1LQIA 2N66A 1SN4A 1I6FA 2KPYA 2YBRC 1BRZA 1B7DA 1CHZA 1VNAA 1I2VA 1AYJA 1NPIA 1I6GA 2LY6A 2B3CA 2KBHA 2LKBA 1NRBA 2N69A 2KYQA 1MYNA 1JXCA 1KV0A 2ASCA 2LJ7A 1JKZA 1T7AA 2E3GA 1NE5A 1JZBA 1SNBA 1ZYWA 1C56A 4UJ0A 2KGQA 2NY8X 3E7UX 1ICAA 2M8BB 1LQHA 1CN2A 2LJMA 5CY0A 2N2RA 1B3CA 1GPSA 1BK8A 1OZZA 2I61A 4AEIA 1FH3A 2N2QA 2KBKA 1T7BA 2YEOA 1T1TA 2E3FA 1P0AA 1ZYVA 2NY9X 4AB0A 2LR3A 1ZVEA 2LY5A 2SN3A 4HHFA 2LT8A 3PSMA 2KSKA 1ZUTA 1T0ZA 2A7TA 1I2UA 1SN1A 1ZVGA 1JZAA 1ZU3A 5KK4A 4AAZA 2KBJA 1DJTA 1PTXA 2E0HA 2YC1C 2KJAA 2LI7A 1WT7A 1BCGA 2BRZA 2MZ0A 1PE4A 4HE7A 1DQ7A 3E7RL 2ATBA 1OMYA 1N4NA 4KYPA 1NH5A 2GL1A 1WWNA 1PX9A 1SEGA 2B68A 4V1DC 4CQKA 1C55A 1MR4A 1BMRA 1AHOA 1P00A 1GPTA 1NRAA 1VNBA 1TI5A 1T7EA 1ZFUA 1L4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQQ A;  1WMT A;  1LQI A;  2N66 A;  1SN4 A;  1I6F A;  2KPY A;  2YBR C;  1BRZ A;  1B7D A;  1CHZ A;  1VNA A;  1I2V A;  1AYJ A;  1NPI A;  1I6G A;  2LY6 A;  2B3C A;  2KBH A;  2LKB A;  1NRB A;  2N69 A;  2KYQ A;  1MYN A;  1JXC A;  1KV0 A;  2ASC A;  2LJ7 A;  1JKZ A;  1T7A A;  2E3G A;  1NE5 A;  1JZB A;  1SNB A;  1ZYW A;  1C56 A;  4UJ0 A;  2KGQ A;  2NY8 X;  3E7U X;  1ICA A;  2M8B B;  1LQH A;  1CN2 A;  2LJM A;  5CY0 A;  2N2R A;  1B3C A;  1GPS A;  1BK8 A;  1OZZ A;  2I61 A;  4AEI A;  1FH3 A;  2N2Q A;  2KBK A;  1T7B A;  2YEO A;  1T1T A;  2E3F A;  1P0A A;  1ZYV A;  2NY9 X;  4AB0 A;  2LR3 A;  1ZVE A;  2LY5 A;  2SN3 A;  4HHF A;  2LT8 A;  3PSM A;  2KSK A;  1ZUT A;  1T0Z A;  2A7T A;  1I2U A;  1SN1 A;  1ZVG A;  1JZA A;  1ZU3 A;  5KK4 A;  4AAZ A;  2KBJ A;  1DJT A;  1PTX A;  2E0H A;  2YC1 C;  2KJA A;  2LI7 A;  1WT7 A;  1BCG A;  2BRZ A;  2MZ0 A;  1PE4 A;  4HE7 A;  1DQ7 A;  3E7R L;  2ATB A;  1OMY A;  1N4N A;  4KYP A;  1NH5 A;  2GL1 A;  1WWN A;  1PX9 A;  1SEG A;  2B68 A;  4V1D C;  4CQK A;  1C55 A;  1MR4 A;  1BMR A;  1AHO A;  1P00 A;  1GPT A;  1NRA A;  1VNB A;  1TI5 A;  1T7E A;  1ZFU A;  1L4V A; 
#chains in the Genus database with same CATH topology
 4UJ0 A;  1LQQ A;  1WMT A;  2D56 A;  1LQI A;  3JXU A;  4IO8 A;  2N66 A;  3D2F B;  1SN4 A;  1QQN A;  3LDN A;  3KOY A;  1BK8 A;  1I6F A;  5AQN A;  2QWO A;  1BA0 A;  2KPY A;  2YBR C;  1BRZ A;  1B7D A;  1CHZ A;  1VNA A;  4H5R A;  1I2V A;  1AYJ A;  5BN9 A;  1QQM A;  3D2F A;  3FZH A;  5AQI A;  3KOZ A;  5EXW A;  1NPI A;  5AQP A;  1I6G A;  2E8A A;  3LDL A;  2LY6 A;  2B3C A;  2KBH A;  2LKB A;  5AQV A;  1NRB A;  5BN8 A;  4UAD E;  5AQW A;  2GMO A;  1UGL A;  4H5N A;  2N69 A;  2KYQ A;  1MYN A;  2MN5 A;  3AY9 A;  3I33 A;  3KVG A;  2QWQ A;  3C7N B;  2KHO A;  1NGC A;  5FPD A;  5AQM A;  1JXC A;  1KV0 A;  3CW4 A;  2ASC A;  5EX5 A;  2LJ7 A;  5F2R A;  1JKZ A;  1T7A A;  1HJO A;  3KP1 A;  3LDO A;  1NGF A;  2E3G A;  1NE5 A;  5AR0 A;  1KAZ A;  1NGH A;  5BPM A;  1YUW A;  1JZB A;  3ATV A;  3D2E B;  3KOW A;  1NGA A;  1SNB A;  1ZYW A;  1C56 A;  4GNI A;  3KHW A;  1K8B A;  3LDP A;  2KGQ A;  2NY8 X;  3E7U X;  3FZF A;  3QML A;  2M8B B;  2G2K A;  2QWL A;  5AQO A;  1ICA A;  1LQH A;  5F0X A;  1CN2 A;  1KAY A;  1DKG D;  2LJM A;  5CY0 A;  2N2R A;  1B3C A;  1POI A;  1S3X A;  1GPS A;  1XRS B;  3QFP A;  1OZZ A;  2E2F A;  2I61 A;  3FE1 A;  4KBO A;  5AQS A;  4AEI A;  1NGE A;  1BUP A;  1FH3 A;  1HX1 A;  2QWR A;  2N2Q A;  1NGG A;  2KBK A;  3LDQ A;  1T7B A;  2YEO A;  5AQU A;  3L56 A;  4FSV A;  1T1T A;  2E3F A;  1P0A A;  1ZYV A;  2YIO A;  5AQJ A;  2NY9 X;  3KP0 A;  4H5W A;  2BUP A;  3FZL A;  2YIL A;  5AQL A;  4AB0 A;  2LR3 A;  5F1X A;  1ZVE A;  2LY5 A;  3QFU A;  2SN3 A;  4HHF A;  2LT8 A;  2YIP A;  5AQK A;  3PSM A;  2KSK A;  1ZUT A;  1T0Z A;  4UAF E;  5BPN A;  5FPE A;  3FZM A;  2A7T A;  1BA1 A;  3ATU A;  3C7N A;  3L4I A;  1I2U A;  1SN1 A;  3GKU A;  5AQF A;  3R2V A;  1ZVG A;  4FL9 A;  1HPM A;  1JZA A;  1ZU3 A;  5EY4 A;  5KK4 A;  1KAX A;  1NGI A;  4H5T A;  5AQT A;  4AAZ A;  2MBK A;  2V7Z A;  4HWI A;  2KBJ A;  1DJT A;  2QW9 A;  5AQX A;  2QWP A;  5FPM A;  3D2E A;  4H5V A;  5AQH A;  3SF4 D;  1PTX A;  2E0H A;  3M3Z A;  2YC1 C;  3FZK A;  2KJA A;  2QWN A;  3A8Y A;  5AQY A;  2LI7 A;  1WT7 A;  5AQG A;  3GDQ A;  1BCG A;  2VY6 A;  3CQX A;  1QQO A;  2BRZ A;  5AQZ A;  2MZ0 A;  1PE4 A;  3KC6 A;  4HE7 A;  1DQ7 A;  3IUC A;  3E7R L;  2ATB A;  1OMY A;  5AQR A;  1ATS A;  1N4N A;  1NGB A;  2E88 A;  2LN8 A;  5AQQ A;  4KYP A;  1NH5 A;  2GL1 A;  3GL1 A;  1WWN A;  3L6Q A;  1NGJ A;  1PX9 A;  1SEG A;  2B68 A;  4UAE F;  4V1D C;  4CQK A;  1C55 A;  1MR4 A;  1NGD A;  1AHO A;  2JDQ D;  1BMR A;  5EVZ A;  2QWM A;  5FPN A;  1P00 A;  2QXL A;  1GPT A;  1NRA A;  1VNB A;  1TI5 A;  3QI7 A;  1T7E A;  2K35 A;  3HSC A;  3KOX A;  3BK3 C;  1ZFU A;  5BPL A;  1L4V A;  1ATR A; 
#chains in the Genus database with same CATH homology
 1LQQ A;  1WMT A;  1LQI A;  2N66 A;  1SN4 A;  1I6F A;  2KPY A;  2YBR C;  1BRZ A;  1B7D A;  1CHZ A;  1VNA A;  1I2V A;  1AYJ A;  1NPI A;  1I6G A;  2LY6 A;  2B3C A;  2KBH A;  2LKB A;  1NRB A;  2N69 A;  2KYQ A;  1MYN A;  1JXC A;  1KV0 A;  2ASC A;  2LJ7 A;  1JKZ A;  1T7A A;  2E3G A;  1NE5 A;  1JZB A;  1SNB A;  1ZYW A;  1C56 A;  4UJ0 A;  2KGQ A;  2NY8 X;  3E7U X;  1ICA A;  2M8B B;  1LQH A;  1CN2 A;  2LJM A;  5CY0 A;  2N2R A;  1B3C A;  1GPS A;  1BK8 A;  1OZZ A;  2I61 A;  4AEI A;  1FH3 A;  2N2Q A;  2KBK A;  1T7B A;  2YEO A;  1T1T A;  2E3F A;  1P0A A;  1ZYV A;  2NY9 X;  4AB0 A;  2LR3 A;  1ZVE A;  2LY5 A;  2SN3 A;  4HHF A;  2LT8 A;  3PSM A;  2KSK A;  1ZUT A;  1T0Z A;  2A7T A;  1I2U A;  1SN1 A;  1ZVG A;  1JZA A;  1ZU3 A;  5KK4 A;  4AAZ A;  2KBJ A;  1DJT A;  1PTX A;  2E0H A;  2YC1 C;  2KJA A;  2LI7 A;  1WT7 A;  1BCG A;  2BRZ A;  2MZ0 A;  1PE4 A;  4HE7 A;  1DQ7 A;  3E7R L;  2ATB A;  1OMY A;  1N4N A;  4KYP A;  1NH5 A;  2GL1 A;  1WWN A;  1PX9 A;  1SEG A;  2B68 A;  4V1D C;  4CQK A;  1C55 A;  1MR4 A;  1BMR A;  1AHO A;  1P00 A;  1GPT A;  1NRA A;  1VNB A;  1TI5 A;  1T7E A;  1ZFU A;  1L4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...