2KJAA

Chemical shift assignments, constraints, and coordinates for cn5 scorpion toxin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
KEGYLVNKSTGCKYGCLLLGKNEGCDKECKAKNQGGSYGYCYAFGCWCEGLPESTPTYPLPNKSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Beta-toxin Cn5
publication title Solution structure of Cn5, a crustacean toxin found in the venom of the scorpions Centruroides noxius and Centruroides suffusus suffusus.
pubmed doi rcsb
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2009-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kjaA00
1MR4A 2KSKA 1WMTA 1SN1A 4AEIA 2KBHA 4V1DC 1ZVEA 1JZBA 1T7BA 1I6GA 1SNBA 2LY5A 1PE4A 1OZZA 1P0AA 1ZFUA 3E7UX 3PSMA 1BMRA 2LJMA 1NE5A 1WT7A 1ZVGA 1AYJA 1VNAA 1I2VA 1JZAA 2KGQA 1DQ7A 2KJAA 1DJTA 1C56A 2LKBA 2YBRC 2N2QA 5KK4A 2KBKA 1JXCA 1BRZA 1VNBA 1ICAA 2I61A 4UJ0A 4KYPA 1SEGA 2N2RA 2B3CA 1GPSA 1LQQA 2M8BB 2BRZA 1LQHA 1BK8A 3E7RL 2NY8X 1TI5A 1B3CA 1LQIA 1AHOA 1ZYVA 2ASCA 1KV0A 4AAZA 1C55A 1PTXA 2NY9X 2E3FA 2LI7A 1T7AA 1N4NA 2YC1C 1MYNA 2ATBA 2KBJA 2GL1A 2E0HA 2B68A 4HHFA 2YEOA 1WWNA 1ZUTA 1PX9A 1CN2A 1NH5A 1T0ZA 1JKZA 1L4VA 1OMYA 1T1TA 1SN4A 1ZU3A 1T7EA 2LY6A 2LJ7A 1NRBA 1BCGA 2N66A 1GPTA 1I2UA 4HE7A 1CHZA 1NPIA 2SN3A 1NRAA 2KYQA 1P00A 2KPYA 1ZYWA 2LR3A 4CQKA 4AB0A 2A7TA 2E3GA 2MZ0A 1B7DA 1FH3A 2LT8A 2N69A 1I6FA 5CY0A
chains in the Genus database with same CATH superfamily
1HPMA 1MR4A 5AQQA 2KSKA 1NGHA 1WMTA 3ATVA 1S3XA 1NGFA 5BPMA 1SN1A 5AQRA 3GDQA 5AQHA 1KAYA 1POIA 4H5NA 5AQVA 4AEIA 2KBHA 3FZHA 4V1DC 1ZVEA 5AQYA 2K35A 1JZBA 1T7BA 3KHWA 4GNIA 1QQOA 3SF4D 1SNBA 2LY5A 5AQWA 5EX5A 1PE4A 1OZZA 1P0AA 1ZFUA 1XRSB 3E7UX 3PSMA 2LJMA 4H5RA 1BMRA 1NE5A 1WT7A 1ZVGA 4UADE 1AYJA 1VNAA 3I33A 1I2VA 5BPNA 5AQLA 1QQNA 5F2RA 3LDLA 1KAZA 2BUPA 1JZAA 2G2KA 2KGQA 2QWQA 5AQJA 3CQXA 1DQ7A 4FL9A 1ATRA 1I6GA 3D2FB 1K8BA 2KJAA 1C56A 1DJTA 2LKBA 2V7ZA 2YBRC 2N2QA 5KK4A 2KBKA 1JXCA 3D2FA 4UAFE 4UAEF 1VNBA 1BRZA 1ICAA 3KOZA 2I61A 5AQMA 4KYPA 4UJ0A 5AQGA 1SEGA 3LDOA 5BN9A 3LDPA 2QW9A 5FPEA 2N2RA 2B3CA 2YIOA 5FPMA 5F1XA 1GPSA 1LQQA 2M8BB 3LDNA 3A8YA 3L56A 5AQFA 2GMOA 2BRZA 1LQHA 1BA0A 3C7NB 3CW4A 4H5TA 5BPLA 1BK8A 2QWRA 3E7RL 5FPDA 2NY8X 1TI5A 1B3CA 1LQIA 1AHOA 3C7NA 5AQKA 1HJOA 1ZYVA 2E8AA 2ASCA 2D56A 1KV0A 5AR0A 4AAZA 1YUWA 3HSCA 4FSVA 1C55A 2MBKA 5AQTA 1PTXA 2NY9X 3QFUA 5AQUA 2E3FA 2LI7A 1T7AA 2YIPA 3IUCA 4H5WA 3ATUA 3KOWA 1N4NA 2YC1C 4HWIA 1MYNA 2ATBA 2QWOA 5EXWA 2KBJA 3GKUA 2GL1A 2E0HA 2B68A 4HHFA 2LN8A 2QWNA 4KBOA 2JDQD 2YEOA 1WWNA 3BK3C 1ZUTA 3FZLA 1PX9A 4IO8A 5BN8A 1CN2A 3KOXA 1NH5A 1NGBA 1T0ZA 2QWLA 3KC6A 5EY4A 1NGCA 3FZFA 5F0XA 1OMYA 1JKZA 4H5VA 1L4VA 1T1TA 3M3ZA 2QWPA 3QMLA 1SN4A 1ZU3A 5AQXA 1T7EA 2LY6A 5AQPA 2KHOA 3AY9A 2LJ7A 3FZKA 1NGJA 1NRBA 5FPNA 1BCGA 1KAXA 2N66A 3KOYA 5AQSA 1GPTA 1I2UA 4HE7A 3R2VA 1CHZA 1BA1A 1NGIA 1NPIA 2SN3A 1NRAA 2KYQA 3LDQA 1UGLA 2YILA 3FE1A 3D2EB 3L6QA 5AQOA 1P00A 1BUPA 1ZYWA 1NGAA 2KPYA 1QQMA 2LR3A 3KP0A 5AQNA 4CQKA 3GL1A 4AB0A 2A7TA 2VY6A 2E88A 5AQZA 1HX1A 5AQIA 2E3GA 3D2EA 5EVZA 3FZMA 3QI7A 1ATSA 2MZ0A 1B7DA 2MN5A 2QXLA 1DKGD 1FH3A 3L4IA 2LT8A 2QWMA 3JXUA 2N69A 1NGEA 1I6FA 2E2FA 1NGGA 5CY0A 3QFPA 1NGDA 3KP1A 3KVGA
chains in the Genus database with same CATH topology
1MR4A 2KSKA 1WMTA 1SN1A 4AEIA 2KBHA 4V1DC 1ZVEA 1JZBA 1T7BA 1I6GA 1SNBA 2LY5A 1PE4A 1OZZA 1P0AA 1ZFUA 3E7UX 3PSMA 1BMRA 2LJMA 1NE5A 1WT7A 1ZVGA 1AYJA 1VNAA 1I2VA 1JZAA 2KGQA 1DQ7A 2KJAA 1DJTA 1C56A 2LKBA 2YBRC 2N2QA 5KK4A 2KBKA 1JXCA 1BRZA 1VNBA 1ICAA 2I61A 4UJ0A 4KYPA 1SEGA 2N2RA 2B3CA 1GPSA 1LQQA 2M8BB 2BRZA 1LQHA 1BK8A 3E7RL 2NY8X 1TI5A 1B3CA 1LQIA 1AHOA 1ZYVA 2ASCA 1KV0A 4AAZA 1C55A 1PTXA 2NY9X 2E3FA 2LI7A 1T7AA 1N4NA 2YC1C 1MYNA 2ATBA 2KBJA 2GL1A 2E0HA 2B68A 4HHFA 2YEOA 1WWNA 1ZUTA 1PX9A 1CN2A 1NH5A 1T0ZA 1JKZA 1L4VA 1OMYA 1T1TA 1SN4A 1ZU3A 1T7EA 2LY6A 2LJ7A 1NRBA 1BCGA 2N66A 1GPTA 1I2UA 4HE7A 1CHZA 1NPIA 2SN3A 1NRAA 2KYQA 1P00A 2KPYA 1ZYWA 2LR3A 4CQKA 4AB0A 2A7TA 2E3GA 2MZ0A 1B7DA 1FH3A 2LT8A 2N69A 1I6FA 5CY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR4 A;  2KSK A;  1WMT A;  1SN1 A;  4AEI A;  2KBH A;  4V1D C;  1ZVE A;  1JZB A;  1T7B A;  1I6G A;  1SNB A;  2LY5 A;  1PE4 A;  1OZZ A;  1P0A A;  1ZFU A;  3E7U X;  3PSM A;  1BMR A;  2LJM A;  1NE5 A;  1WT7 A;  1ZVG A;  1AYJ A;  1VNA A;  1I2V A;  1JZA A;  2KGQ A;  1DQ7 A;  2KJA A;  1DJT A;  1C56 A;  2LKB A;  2YBR C;  2N2Q A;  5KK4 A;  2KBK A;  1JXC A;  1BRZ A;  1VNB A;  1ICA A;  2I61 A;  4UJ0 A;  4KYP A;  1SEG A;  2N2R A;  2B3C A;  1GPS A;  1LQQ A;  2M8B B;  2BRZ A;  1LQH A;  1BK8 A;  3E7R L;  2NY8 X;  1TI5 A;  1B3C A;  1LQI A;  1AHO A;  1ZYV A;  2ASC A;  1KV0 A;  4AAZ A;  1C55 A;  1PTX A;  2NY9 X;  2E3F A;  2LI7 A;  1T7A A;  1N4N A;  2YC1 C;  1MYN A;  2ATB A;  2KBJ A;  2GL1 A;  2E0H A;  2B68 A;  4HHF A;  2YEO A;  1WWN A;  1ZUT A;  1PX9 A;  1CN2 A;  1NH5 A;  1T0Z A;  1JKZ A;  1L4V A;  1OMY A;  1T1T A;  1SN4 A;  1ZU3 A;  1T7E A;  2LY6 A;  2LJ7 A;  1NRB A;  1BCG A;  2N66 A;  1GPT A;  1I2U A;  4HE7 A;  1CHZ A;  1NPI A;  2SN3 A;  1NRA A;  2KYQ A;  1P00 A;  2KPY A;  1ZYW A;  2LR3 A;  4CQK A;  4AB0 A;  2A7T A;  2E3G A;  2MZ0 A;  1B7D A;  1FH3 A;  2LT8 A;  2N69 A;  1I6F A;  5CY0 A; 
#chains in the Genus database with same CATH topology
 1HPM A;  1MR4 A;  5AQQ A;  2KSK A;  1NGH A;  1WMT A;  3ATV A;  1S3X A;  1NGF A;  5BPM A;  1SN1 A;  5AQR A;  3GDQ A;  5AQH A;  1KAY A;  1POI A;  4H5N A;  5AQV A;  4AEI A;  2KBH A;  3FZH A;  4V1D C;  1ZVE A;  5AQY A;  2K35 A;  1JZB A;  1T7B A;  3KHW A;  4GNI A;  1QQO A;  3SF4 D;  1SNB A;  2LY5 A;  5AQW A;  5EX5 A;  1PE4 A;  1OZZ A;  1P0A A;  1ZFU A;  1XRS B;  3E7U X;  3PSM A;  2LJM A;  4H5R A;  1BMR A;  1NE5 A;  1WT7 A;  1ZVG A;  4UAD E;  1AYJ A;  1VNA A;  3I33 A;  1I2V A;  5BPN A;  5AQL A;  1QQN A;  5F2R A;  3LDL A;  1KAZ A;  2BUP A;  1JZA A;  2G2K A;  2KGQ A;  2QWQ A;  5AQJ A;  3CQX A;  1DQ7 A;  4FL9 A;  1ATR A;  1I6G A;  3D2F B;  1K8B A;  2KJA A;  1C56 A;  1DJT A;  2LKB A;  2V7Z A;  2YBR C;  2N2Q A;  5KK4 A;  2KBK A;  1JXC A;  3D2F A;  4UAF E;  4UAE F;  1VNB A;  1BRZ A;  1ICA A;  3KOZ A;  2I61 A;  5AQM A;  4KYP A;  4UJ0 A;  5AQG A;  1SEG A;  3LDO A;  5BN9 A;  3LDP A;  2QW9 A;  5FPE A;  2N2R A;  2B3C A;  2YIO A;  5FPM A;  5F1X A;  1GPS A;  1LQQ A;  2M8B B;  3LDN A;  3A8Y A;  3L56 A;  5AQF A;  2GMO A;  2BRZ A;  1LQH A;  1BA0 A;  3C7N B;  3CW4 A;  4H5T A;  5BPL A;  1BK8 A;  2QWR A;  3E7R L;  5FPD A;  2NY8 X;  1TI5 A;  1B3C A;  1LQI A;  1AHO A;  3C7N A;  5AQK A;  1HJO A;  1ZYV A;  2E8A A;  2ASC A;  2D56 A;  1KV0 A;  5AR0 A;  4AAZ A;  1YUW A;  3HSC A;  4FSV A;  1C55 A;  2MBK A;  5AQT A;  1PTX A;  2NY9 X;  3QFU A;  5AQU A;  2E3F A;  2LI7 A;  1T7A A;  2YIP A;  3IUC A;  4H5W A;  3ATU A;  3KOW A;  1N4N A;  2YC1 C;  4HWI A;  1MYN A;  2ATB A;  2QWO A;  5EXW A;  2KBJ A;  3GKU A;  2GL1 A;  2E0H A;  2B68 A;  4HHF A;  2LN8 A;  2QWN A;  4KBO A;  2JDQ D;  2YEO A;  1WWN A;  3BK3 C;  1ZUT A;  3FZL A;  1PX9 A;  4IO8 A;  5BN8 A;  1CN2 A;  3KOX A;  1NH5 A;  1NGB A;  1T0Z A;  2QWL A;  3KC6 A;  5EY4 A;  1NGC A;  3FZF A;  5F0X A;  1OMY A;  1JKZ A;  4H5V A;  1L4V A;  1T1T A;  3M3Z A;  2QWP A;  3QML A;  1SN4 A;  1ZU3 A;  5AQX A;  1T7E A;  2LY6 A;  5AQP A;  2KHO A;  3AY9 A;  2LJ7 A;  3FZK A;  1NGJ A;  1NRB A;  5FPN A;  1BCG A;  1KAX A;  2N66 A;  3KOY A;  5AQS A;  1GPT A;  1I2U A;  4HE7 A;  3R2V A;  1CHZ A;  1BA1 A;  1NGI A;  1NPI A;  2SN3 A;  1NRA A;  2KYQ A;  3LDQ A;  1UGL A;  2YIL A;  3FE1 A;  3D2E B;  3L6Q A;  5AQO A;  1P00 A;  1BUP A;  1ZYW A;  1NGA A;  2KPY A;  1QQM A;  2LR3 A;  3KP0 A;  5AQN A;  4CQK A;  3GL1 A;  4AB0 A;  2A7T A;  2VY6 A;  2E88 A;  5AQZ A;  1HX1 A;  5AQI A;  2E3G A;  3D2E A;  5EVZ A;  3FZM A;  3QI7 A;  1ATS A;  2MZ0 A;  1B7D A;  2MN5 A;  2QXL A;  1DKG D;  1FH3 A;  3L4I A;  2LT8 A;  2QWM A;  3JXU A;  2N69 A;  1NGE A;  1I6F A;  2E2F A;  1NGG A;  5CY0 A;  3QFP A;  1NGD A;  3KP1 A;  3KVG A; 
#chains in the Genus database with same CATH homology
 1MR4 A;  2KSK A;  1WMT A;  1SN1 A;  4AEI A;  2KBH A;  4V1D C;  1ZVE A;  1JZB A;  1T7B A;  1I6G A;  1SNB A;  2LY5 A;  1PE4 A;  1OZZ A;  1P0A A;  1ZFU A;  3E7U X;  3PSM A;  1BMR A;  2LJM A;  1NE5 A;  1WT7 A;  1ZVG A;  1AYJ A;  1VNA A;  1I2V A;  1JZA A;  2KGQ A;  1DQ7 A;  2KJA A;  1DJT A;  1C56 A;  2LKB A;  2YBR C;  2N2Q A;  5KK4 A;  2KBK A;  1JXC A;  1BRZ A;  1VNB A;  1ICA A;  2I61 A;  4UJ0 A;  4KYP A;  1SEG A;  2N2R A;  2B3C A;  1GPS A;  1LQQ A;  2M8B B;  2BRZ A;  1LQH A;  1BK8 A;  3E7R L;  2NY8 X;  1TI5 A;  1B3C A;  1LQI A;  1AHO A;  1ZYV A;  2ASC A;  1KV0 A;  4AAZ A;  1C55 A;  1PTX A;  2NY9 X;  2E3F A;  2LI7 A;  1T7A A;  1N4N A;  2YC1 C;  1MYN A;  2ATB A;  2KBJ A;  2GL1 A;  2E0H A;  2B68 A;  4HHF A;  2YEO A;  1WWN A;  1ZUT A;  1PX9 A;  1CN2 A;  1NH5 A;  1T0Z A;  1JKZ A;  1L4V A;  1OMY A;  1T1T A;  1SN4 A;  1ZU3 A;  1T7E A;  2LY6 A;  2LJ7 A;  1NRB A;  1BCG A;  2N66 A;  1GPT A;  1I2U A;  4HE7 A;  1CHZ A;  1NPI A;  2SN3 A;  1NRA A;  2KYQ A;  1P00 A;  2KPY A;  1ZYW A;  2LR3 A;  4CQK A;  4AB0 A;  2A7T A;  2E3G A;  2MZ0 A;  1B7D A;  1FH3 A;  2LT8 A;  2N69 A;  1I6F A;  5CY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...