4KYPA

Beta-scorpion toxin folded in the periplasm of e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
KKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-insect excitatory toxin Bj-xtrIT
publication title Chaperone-mediated native folding of a beta-scorpion toxin in the periplasm of Escherichia coli.
pubmed doi rcsb
source organism Hottentotta judaicus
molecule tags Toxin
total genus 18
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4kypA00
1T7BA 1LQQA 1SNBA 2LJMA 2YEOA 3E7UX 4CQKA 1BRZA 2NY9X 2BRZA 1T7AA 2NY8X 4AB0A 2KPYA 1I2VA 1NPIA 1WT7A 1FH3A 4AEIA 1B3CA 1NH5A 2KBHA 1SN1A 2KSKA 1GPSA 2YC1C 4AAZA 1PX9A 2ATBA 4V1DC 1SN4A 1ICAA 1L4VA 1OZZA 2LT8A 1TI5A 1C55A 1LQHA 2ASCA 2LJ7A 1JKZA 2KBKA 1SEGA 1DQ7A 1AYJA 2MZ0A 3E7RL 1PE4A 2I61A 1KV0A 2SN3A 1ZVGA 2KYQA 1JZBA 2B68A 1VNAA 1MYNA 1T0ZA 5CY0A 1GPTA 1AHOA 1BMRA 2LR3A 2M8BB 1JZAA 2LKBA 4HHFA 1WWNA 1T7EA 2YBRC 1CN2A 2E0HA 1ZFUA 2LI7A 4HE7A 1LQIA 2KJAA 4KYPA 1ZU3A 2E3GA 1P00A 2LY5A 2N2QA 5KK4A 2N2RA 1ZYVA 1P0AA 1OMYA 1T1TA 1ZYWA 1I2UA 1DJTA 2B3CA 2GL1A 2N66A 1ZVEA 1VNBA 1NRBA 1JXCA 1I6FA 2LY6A 1N4NA 4UJ0A 1CHZA 1B7DA 2KBJA 1WMTA 2A7TA 1PTXA 1NRAA 2E3FA 3PSMA 1BK8A 2N69A 1BCGA 1I6GA 1ZUTA 2KGQA 1NE5A 1C56A 1MR4A
chains in the Genus database with same CATH superfamily
1T7BA 3LDOA 1KAZA 1LQQA 1SNBA 2LJMA 2YEOA 3E7UX 4H5RA 4H5TA 1KAYA 2G2KA 5AQKA 3R2VA 4CQKA 1BRZA 2NY9X 2BRZA 5AQYA 1T7AA 5FPDA 2KHOA 2E8AA 2NY8X 3FZFA 2KPYA 3LDPA 4UAFE 1NGHA 4AB0A 3ATUA 5AQNA 1ATSA 3FZKA 1I2VA 5AQXA 1NPIA 5EY4A 1BA1A 5AQIA 1NGFA 1WT7A 1FH3A 4AEIA 1B3CA 1NH5A 1C56A 1BUPA 1SN1A 2KBHA 2KSKA 2YC1C 3KHWA 1GPSA 4AAZA 3KOZA 3LDNA 1PX9A 2ATBA 4UADE 1HPMA 4V1DC 1SN4A 5AQVA 1ICAA 5AQMA 1OZZA 1L4VA 5AQQA 1NGEA 2YILA 2LT8A 5FPNA 5BPMA 4GNIA 1NGBA 1TI5A 3L56A 1C55A 1QQNA 4H5NA 1LQHA 2ASCA 2LJ7A 1JKZA 3A8YA 1NGAA 1QQOA 5AR0A 5AQTA 2KBKA 4H5VA 2QWMA 1SEGA 3D2EB 1DQ7A 3KC6A 2GMOA 3KOYA 5EXWA 1AYJA 2MZ0A 3QFUA 3E7RL 1XRSB 2VY6A 3L6QA 1PE4A 2I61A 2SN3A 5F1XA 1ZVGA 2KYQA 3LDQA 3C7NA 1S3XA 1UGLA 2E88A 4HWIA 1NGIA 2QW9A 1JZBA 3QFPA 2E2FA 3KOXA 5EX5A 5EVZA 2JDQD 5AQJA 2YIPA 2B68A 2QWRA 1VNAA 2QWLA 1MYNA 1T0ZA 2LN8A 2QWQA 1KAXA 3JXUA 3KP1A 1QQMA 5AQSA 5CY0A 1GPTA 3GKUA 1AHOA 1BMRA 3FE1A 2LR3A 3L4IA 2M8BB 1JZAA 2LKBA 5BN8A 4HHFA 1WWNA 1HX1A 3AY9A 1T7EA 2YBRC 4IO8A 1CN2A 1NGJA 2E0HA 5F0XA 1ZFUA 2LI7A 3D2FA 3KVGA 4HE7A 5AQGA 1LQIA 2KJAA 2QWPA 2YIOA 4KYPA 1ZU3A 5BPLA 5BPNA 1BA0A 1P00A 2E3GA 3HSCA 2LY5A 1NGGA 2N2QA 3CW4A 5KK4A 2N2RA 1ZYVA 2QXLA 3GL1A 3FZLA 1ATRA 1YUWA 3IUCA 4KBOA 3SF4D 1P0AA 1POIA 2MBKA 1OMYA 3QI7A 4H5WA 5F2RA 3CQXA 1T1TA 1ZYWA 5FPMA 3KP0A 1I2UA 1DJTA 2B3CA 2D56A 2GL1A 2N66A 1NGCA 1ZVEA 2BUPA 3ATVA 1VNBA 3LDLA 3QMLA 3GDQA 1NRBA 5AQRA 1K8BA 1JXCA 1I6FA 2K35A 2LY6A 5AQPA 2QWOA 3I33A 5AQZA 5AQLA 5AQHA 1DKGD 3M3ZA 1N4NA 4UJ0A 1CHZA 2QWNA 1B7DA 4FSVA 2KBJA 1WMTA 2A7TA 4UAEF 1PTXA 3FZHA 5AQWA 1NRAA 1NGDA 5AQOA 1HJOA 3KOWA 2E3FA 2MN5A 3D2FB 3FZMA 3PSMA 5FPEA 1BK8A 3BK3C 2N69A 1BCGA 1I6GA 2V7ZA 5AQFA 5AQUA 5BN9A 1ZUTA 3C7NB 3D2EA 4FL9A 2KGQA 1NE5A 1KV0A 1MR4A
chains in the Genus database with same CATH topology
1T7BA 1LQQA 1SNBA 2LJMA 2YEOA 3E7UX 4CQKA 1BRZA 2NY9X 2BRZA 1T7AA 2NY8X 4AB0A 2KPYA 1I2VA 1NPIA 1WT7A 1FH3A 4AEIA 1B3CA 1NH5A 2KBHA 1SN1A 2KSKA 1GPSA 2YC1C 4AAZA 1PX9A 2ATBA 4V1DC 1SN4A 1ICAA 1L4VA 1OZZA 2LT8A 1TI5A 1C55A 1LQHA 2ASCA 2LJ7A 1JKZA 2KBKA 1SEGA 1DQ7A 1AYJA 2MZ0A 3E7RL 1PE4A 2I61A 1KV0A 2SN3A 1ZVGA 2KYQA 1JZBA 2B68A 1VNAA 1MYNA 1T0ZA 5CY0A 1GPTA 1AHOA 1BMRA 2LR3A 2M8BB 1JZAA 2LKBA 4HHFA 1WWNA 1T7EA 2YBRC 1CN2A 2E0HA 1ZFUA 2LI7A 4HE7A 1LQIA 2KJAA 4KYPA 1ZU3A 2E3GA 1P00A 2LY5A 2N2QA 5KK4A 2N2RA 1ZYVA 1P0AA 1OMYA 1T1TA 1ZYWA 1I2UA 1DJTA 2B3CA 2GL1A 2N66A 1ZVEA 1VNBA 1NRBA 1JXCA 1I6FA 2LY6A 1N4NA 4UJ0A 1CHZA 1B7DA 2KBJA 1WMTA 2A7TA 1PTXA 1NRAA 2E3FA 3PSMA 1BK8A 2N69A 1BCGA 1I6GA 1ZUTA 2KGQA 1NE5A 1C56A 1MR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7B A;  1LQQ A;  1SNB A;  2LJM A;  2YEO A;  3E7U X;  4CQK A;  1BRZ A;  2NY9 X;  2BRZ A;  1T7A A;  2NY8 X;  4AB0 A;  2KPY A;  1I2V A;  1NPI A;  1WT7 A;  1FH3 A;  4AEI A;  1B3C A;  1NH5 A;  2KBH A;  1SN1 A;  2KSK A;  1GPS A;  2YC1 C;  4AAZ A;  1PX9 A;  2ATB A;  4V1D C;  1SN4 A;  1ICA A;  1L4V A;  1OZZ A;  2LT8 A;  1TI5 A;  1C55 A;  1LQH A;  2ASC A;  2LJ7 A;  1JKZ A;  2KBK A;  1SEG A;  1DQ7 A;  1AYJ A;  2MZ0 A;  3E7R L;  1PE4 A;  2I61 A;  1KV0 A;  2SN3 A;  1ZVG A;  2KYQ A;  1JZB A;  2B68 A;  1VNA A;  1MYN A;  1T0Z A;  5CY0 A;  1GPT A;  1AHO A;  1BMR A;  2LR3 A;  2M8B B;  1JZA A;  2LKB A;  4HHF A;  1WWN A;  1T7E A;  2YBR C;  1CN2 A;  2E0H A;  1ZFU A;  2LI7 A;  4HE7 A;  1LQI A;  2KJA A;  4KYP A;  1ZU3 A;  2E3G A;  1P00 A;  2LY5 A;  2N2Q A;  5KK4 A;  2N2R A;  1ZYV A;  1P0A A;  1OMY A;  1T1T A;  1ZYW A;  1I2U A;  1DJT A;  2B3C A;  2GL1 A;  2N66 A;  1ZVE A;  1VNB A;  1NRB A;  1JXC A;  1I6F A;  2LY6 A;  1N4N A;  4UJ0 A;  1CHZ A;  1B7D A;  2KBJ A;  1WMT A;  2A7T A;  1PTX A;  1NRA A;  2E3F A;  3PSM A;  1BK8 A;  2N69 A;  1BCG A;  1I6G A;  1ZUT A;  2KGQ A;  1NE5 A;  1C56 A;  1MR4 A; 
#chains in the Genus database with same CATH topology
 1T7B A;  3LDO A;  1KAZ A;  1LQQ A;  1SNB A;  2LJM A;  2YEO A;  3E7U X;  4H5R A;  4H5T A;  1KAY A;  2G2K A;  5AQK A;  3R2V A;  4CQK A;  1BRZ A;  2NY9 X;  2BRZ A;  5AQY A;  1T7A A;  5FPD A;  2KHO A;  2E8A A;  2NY8 X;  3FZF A;  2KPY A;  3LDP A;  4UAF E;  1NGH A;  4AB0 A;  3ATU A;  5AQN A;  1ATS A;  3FZK A;  1I2V A;  5AQX A;  1NPI A;  5EY4 A;  1BA1 A;  5AQI A;  1NGF A;  1WT7 A;  1FH3 A;  4AEI A;  1B3C A;  1NH5 A;  1C56 A;  1BUP A;  1SN1 A;  2KBH A;  2KSK A;  2YC1 C;  3KHW A;  1GPS A;  4AAZ A;  3KOZ A;  3LDN A;  1PX9 A;  2ATB A;  4UAD E;  1HPM A;  4V1D C;  1SN4 A;  5AQV A;  1ICA A;  5AQM A;  1OZZ A;  1L4V A;  5AQQ A;  1NGE A;  2YIL A;  2LT8 A;  5FPN A;  5BPM A;  4GNI A;  1NGB A;  1TI5 A;  3L56 A;  1C55 A;  1QQN A;  4H5N A;  1LQH A;  2ASC A;  2LJ7 A;  1JKZ A;  3A8Y A;  1NGA A;  1QQO A;  5AR0 A;  5AQT A;  2KBK A;  4H5V A;  2QWM A;  1SEG A;  3D2E B;  1DQ7 A;  3KC6 A;  2GMO A;  3KOY A;  5EXW A;  1AYJ A;  2MZ0 A;  3QFU A;  3E7R L;  1XRS B;  2VY6 A;  3L6Q A;  1PE4 A;  2I61 A;  2SN3 A;  5F1X A;  1ZVG A;  2KYQ A;  3LDQ A;  3C7N A;  1S3X A;  1UGL A;  2E88 A;  4HWI A;  1NGI A;  2QW9 A;  1JZB A;  3QFP A;  2E2F A;  3KOX A;  5EX5 A;  5EVZ A;  2JDQ D;  5AQJ A;  2YIP A;  2B68 A;  2QWR A;  1VNA A;  2QWL A;  1MYN A;  1T0Z A;  2LN8 A;  2QWQ A;  1KAX A;  3JXU A;  3KP1 A;  1QQM A;  5AQS A;  5CY0 A;  1GPT A;  3GKU A;  1AHO A;  1BMR A;  3FE1 A;  2LR3 A;  3L4I A;  2M8B B;  1JZA A;  2LKB A;  5BN8 A;  4HHF A;  1WWN A;  1HX1 A;  3AY9 A;  1T7E A;  2YBR C;  4IO8 A;  1CN2 A;  1NGJ A;  2E0H A;  5F0X A;  1ZFU A;  2LI7 A;  3D2F A;  3KVG A;  4HE7 A;  5AQG A;  1LQI A;  2KJA A;  2QWP A;  2YIO A;  4KYP A;  1ZU3 A;  5BPL A;  5BPN A;  1BA0 A;  1P00 A;  2E3G A;  3HSC A;  2LY5 A;  1NGG A;  2N2Q A;  3CW4 A;  5KK4 A;  2N2R A;  1ZYV A;  2QXL A;  3GL1 A;  3FZL A;  1ATR A;  1YUW A;  3IUC A;  4KBO A;  3SF4 D;  1P0A A;  1POI A;  2MBK A;  1OMY A;  3QI7 A;  4H5W A;  5F2R A;  3CQX A;  1T1T A;  1ZYW A;  5FPM A;  3KP0 A;  1I2U A;  1DJT A;  2B3C A;  2D56 A;  2GL1 A;  2N66 A;  1NGC A;  1ZVE A;  2BUP A;  3ATV A;  1VNB A;  3LDL A;  3QML A;  3GDQ A;  1NRB A;  5AQR A;  1K8B A;  1JXC A;  1I6F A;  2K35 A;  2LY6 A;  5AQP A;  2QWO A;  3I33 A;  5AQZ A;  5AQL A;  5AQH A;  1DKG D;  3M3Z A;  1N4N A;  4UJ0 A;  1CHZ A;  2QWN A;  1B7D A;  4FSV A;  2KBJ A;  1WMT A;  2A7T A;  4UAE F;  1PTX A;  3FZH A;  5AQW A;  1NRA A;  1NGD A;  5AQO A;  1HJO A;  3KOW A;  2E3F A;  2MN5 A;  3D2F B;  3FZM A;  3PSM A;  5FPE A;  1BK8 A;  3BK3 C;  2N69 A;  1BCG A;  1I6G A;  2V7Z A;  5AQF A;  5AQU A;  5BN9 A;  1ZUT A;  3C7N B;  3D2E A;  4FL9 A;  2KGQ A;  1NE5 A;  1KV0 A;  1MR4 A; 
#chains in the Genus database with same CATH homology
 1T7B A;  1LQQ A;  1SNB A;  2LJM A;  2YEO A;  3E7U X;  4CQK A;  1BRZ A;  2NY9 X;  2BRZ A;  1T7A A;  2NY8 X;  4AB0 A;  2KPY A;  1I2V A;  1NPI A;  1WT7 A;  1FH3 A;  4AEI A;  1B3C A;  1NH5 A;  2KBH A;  1SN1 A;  2KSK A;  1GPS A;  2YC1 C;  4AAZ A;  1PX9 A;  2ATB A;  4V1D C;  1SN4 A;  1ICA A;  1L4V A;  1OZZ A;  2LT8 A;  1TI5 A;  1C55 A;  1LQH A;  2ASC A;  2LJ7 A;  1JKZ A;  2KBK A;  1SEG A;  1DQ7 A;  1AYJ A;  2MZ0 A;  3E7R L;  1PE4 A;  2I61 A;  1KV0 A;  2SN3 A;  1ZVG A;  2KYQ A;  1JZB A;  2B68 A;  1VNA A;  1MYN A;  1T0Z A;  5CY0 A;  1GPT A;  1AHO A;  1BMR A;  2LR3 A;  2M8B B;  1JZA A;  2LKB A;  4HHF A;  1WWN A;  1T7E A;  2YBR C;  1CN2 A;  2E0H A;  1ZFU A;  2LI7 A;  4HE7 A;  1LQI A;  2KJA A;  4KYP A;  1ZU3 A;  2E3G A;  1P00 A;  2LY5 A;  2N2Q A;  5KK4 A;  2N2R A;  1ZYV A;  1P0A A;  1OMY A;  1T1T A;  1ZYW A;  1I2U A;  1DJT A;  2B3C A;  2GL1 A;  2N66 A;  1ZVE A;  1VNB A;  1NRB A;  1JXC A;  1I6F A;  2LY6 A;  1N4N A;  4UJ0 A;  1CHZ A;  1B7D A;  2KBJ A;  1WMT A;  2A7T A;  1PTX A;  1NRA A;  2E3F A;  3PSM A;  1BK8 A;  2N69 A;  1BCG A;  1I6G A;  1ZUT A;  2KGQ A;  1NE5 A;  1C56 A;  1MR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...