4KYPA

Beta-scorpion toxin folded in the periplasm of e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
KKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Beta-insect excitatory toxin Bj-xtrIT
publication title Chaperone-mediated native folding of a beta-scorpion toxin in the periplasm of Escherichia coli.
pubmed doi rcsb
source organism Hottentotta judaicus
total genus 18
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4kypA00
1PE4A 1T1TA 1T7EA 1ZVEA 4HE7A 1OZZA 2KPYA 1B3CA 1T7BA 3PSMA 2N69A 2LY5A 1AYJA 1I2VA 1BMRA 1LQIA 1MR4A 1BRZA 2BRZA 4UJ0A 2KBKA 1NE5A 2M8BB 2E3GA 1ZFUA 4AEIA 1C55A 1T7AA 4AB0A 1C56A 1GPTA 1GPSA 1WT7A 2NY9X 2N2RA 1BCGA 4HHFA 1SN1A 2I61A 1FH3A 2E0HA 2SN3A 4CQKA 2GL1A 2LY6A 1PTXA 1ZUTA 2LT8A 3E7RL 1N4NA 1LQHA 1WMTA 1L4VA 2YEOA 1NPIA 1I2UA 2LI7A 1SEGA 1ICAA 1BK8A 4KYPA 1VNAA 3E7UX 1NRAA 1SNBA 2KGQA 2KYQA 1P0AA 2ASCA 1JZBA 1ZVGA 1SN4A 5CY0A 1DQ7A 2E3FA 1KV0A 2NY8X 1WWNA 1I6FA 1AHOA 4V1DC 1PX9A 2ATBA 2N66A 4AAZA 1CN2A 1ZU3A 1JKZA 1TI5A 2N2QA 1NRBA 2KBHA 2B68A 1JZAA 1I6GA 2LJMA 1CHZA 1P00A 2LJ7A 1LQQA 2A7TA 1VNBA 1T0ZA 2YBRC 5KK4A 1ZYWA 2LKBA 1MYNA 1JXCA 2KSKA 2LR3A 1ZYVA 2YC1C 2KJAA 2MZ0A 1NH5A 1DJTA 2KBJA 1B7DA 2B3CA 1OMYA
chains in the Genus database with same CATH superfamily
5EX5A 4UAFE 1PE4A 1T1TA 1BUPA 1T7EA 2QWQA 3KP1A 1ZVEA 2VY6A 4HE7A 1OZZA 3QFUA 2GMOA 2KPYA 1QQNA 4H5TA 3D2EA 3LDQA 5BN9A 1B3CA 1T7BA 3PSMA 2N69A 2YIPA 2LY5A 3C7NA 1AYJA 1BMRA 1I2VA 1NGGA 3FZLA 1LQIA 1MR4A 2G2KA 1NGJA 3HSCA 2BRZA 4UADE 5AQVA 4UJ0A 1BRZA 2KBKA 1NE5A 2M8BB 3LDLA 2E3GA 3M3ZA 1ZFUA 3LDPA 4AEIA 3GDQA 2E2FA 2E88A 1NGDA 1C55A 1BA0A 5AQRA 5BPLA 5F2RA 1T7AA 4AB0A 1C56A 1XRSB 5EY4A 1GPTA 1GPSA 1WT7A 3KOXA 2NY9X 3LDOA 2N2RA 1YUWA 1BCGA 3JXUA 4HHFA 1SN1A 2I61A 1FH3A 4UAEF 1DKGD 2E0HA 2V7ZA 2SN3A 5AQGA 4CQKA 2GL1A 2LY6A 3KOWA 3QMLA 5AR0A 1UGLA 1PTXA 1ZUTA 2LT8A 3E7RL 1N4NA 1QQOA 5FPMA 1LQHA 1WMTA 1L4VA 2YEOA 5AQNA 5BN8A 1NPIA 2YIOA 2K35A 3D2FB 2LI7A 1I2UA 1S3XA 1SEGA 2MBKA 1ICAA 5AQHA 3R2VA 1HX1A 1BK8A 2QWPA 2QWLA 2QXLA 4KYPA 5AQUA 5F1XA 3D2FA 1VNAA 3E7UX 1NRAA 1NGAA 1SNBA 1ATSA 2BUPA 2KGQA 3FZFA 3GL1A 4GNIA 4KBOA 1KAYA 2KYQA 3KC6A 1P0AA 5AQYA 1BA1A 1NGIA 2QWNA 1QQMA 2QW9A 2ASCA 1JZBA 2QWOA 4IO8A 5BPMA 1ZVGA 1SN4A 5EVZA 4HWIA 3ATVA 2YILA 1DQ7A 5CY0A 3IUCA 1KAXA 3QFPA 1KV0A 2E3FA 2NY8X 1WWNA 5AQIA 5FPNA 3L6QA 1NGHA 1I6FA 1AHOA 3KHWA 4V1DC 2KHOA 1NGBA 3FZKA 4H5VA 4H5WA 5F0XA 2MN5A 1POIA 1PX9A 3KOZA 3FE1A 3L4IA 1HJOA 4FSVA 3KOYA 2ATBA 2N66A 3I33A 4AAZA 1CN2A 1ZU3A 2D56A 1JKZA 3LDNA 5AQQA 1TI5A 2QWMA 2N2QA 3D2EB 5AQJA 1NRBA 5AQKA 2KBHA 5AQTA 1K8BA 2B68A 5EXWA 1JZAA 2QWRA 3BK3C 3C7NB 3AY9A 3L56A 1I6GA 3GKUA 5AQPA 5FPEA 2LJMA 2LN8A 1CHZA 5AQFA 5AQSA 5AQWA 1P00A 2LJ7A 1HPMA 1LQQA 2A7TA 5AQZA 5FPDA 5AQOA 1ATRA 4H5NA 1VNBA 2E8AA 3QI7A 1T0ZA 1NGFA 2YBRC 5KK4A 5AQMA 1ZYWA 2LKBA 1MYNA 2JDQD 1JXCA 2KSKA 3ATUA 3CW4A 2LR3A 3FZHA 3SF4D 1KAZA 1ZYVA 3CQXA 3FZMA 1NGCA 3A8YA 4H5RA 5AQLA 4FL9A 2YC1C 3KP0A 2KJAA 3KVGA 2MZ0A 1NH5A 5AQXA 1B7DA 1DJTA 2KBJA 5BPNA 1NGEA 2B3CA 1OMYA
chains in the Genus database with same CATH topology
1PE4A 1T1TA 1T7EA 1ZVEA 4HE7A 1OZZA 2KPYA 1B3CA 1T7BA 3PSMA 2N69A 2LY5A 1AYJA 1I2VA 1BMRA 1LQIA 1MR4A 1BRZA 2BRZA 4UJ0A 2KBKA 1NE5A 2M8BB 2E3GA 1ZFUA 4AEIA 1C55A 1T7AA 4AB0A 1C56A 1GPTA 1GPSA 1WT7A 2NY9X 2N2RA 1BCGA 4HHFA 1SN1A 2I61A 1FH3A 2E0HA 2SN3A 4CQKA 2GL1A 2LY6A 1PTXA 1ZUTA 2LT8A 3E7RL 1N4NA 1LQHA 1WMTA 1L4VA 2YEOA 1NPIA 1I2UA 2LI7A 1SEGA 1ICAA 1BK8A 4KYPA 1VNAA 3E7UX 1NRAA 1SNBA 2KGQA 2KYQA 1P0AA 2ASCA 1JZBA 1ZVGA 1SN4A 5CY0A 1DQ7A 2E3FA 1KV0A 2NY8X 1WWNA 1I6FA 1AHOA 4V1DC 1PX9A 2ATBA 2N66A 4AAZA 1CN2A 1ZU3A 1JKZA 1TI5A 2N2QA 1NRBA 2KBHA 2B68A 1JZAA 1I6GA 2LJMA 1CHZA 1P00A 2LJ7A 1LQQA 2A7TA 1VNBA 1T0ZA 2YBRC 5KK4A 1ZYWA 2LKBA 1MYNA 1JXCA 2KSKA 2LR3A 1ZYVA 2YC1C 2KJAA 2MZ0A 1NH5A 1DJTA 2KBJA 1B7DA 2B3CA 1OMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE4 A;  1T1T A;  1T7E A;  1ZVE A;  4HE7 A;  1OZZ A;  2KPY A;  1B3C A;  1T7B A;  3PSM A;  2N69 A;  2LY5 A;  1AYJ A;  1I2V A;  1BMR A;  1LQI A;  1MR4 A;  1BRZ A;  2BRZ A;  4UJ0 A;  2KBK A;  1NE5 A;  2M8B B;  2E3G A;  1ZFU A;  4AEI A;  1C55 A;  1T7A A;  4AB0 A;  1C56 A;  1GPT A;  1GPS A;  1WT7 A;  2NY9 X;  2N2R A;  1BCG A;  4HHF A;  1SN1 A;  2I61 A;  1FH3 A;  2E0H A;  2SN3 A;  4CQK A;  2GL1 A;  2LY6 A;  1PTX A;  1ZUT A;  2LT8 A;  3E7R L;  1N4N A;  1LQH A;  1WMT A;  1L4V A;  2YEO A;  1NPI A;  1I2U A;  2LI7 A;  1SEG A;  1ICA A;  1BK8 A;  4KYP A;  1VNA A;  3E7U X;  1NRA A;  1SNB A;  2KGQ A;  2KYQ A;  1P0A A;  2ASC A;  1JZB A;  1ZVG A;  1SN4 A;  5CY0 A;  1DQ7 A;  2E3F A;  1KV0 A;  2NY8 X;  1WWN A;  1I6F A;  1AHO A;  4V1D C;  1PX9 A;  2ATB A;  2N66 A;  4AAZ A;  1CN2 A;  1ZU3 A;  1JKZ A;  1TI5 A;  2N2Q A;  1NRB A;  2KBH A;  2B68 A;  1JZA A;  1I6G A;  2LJM A;  1CHZ A;  1P00 A;  2LJ7 A;  1LQQ A;  2A7T A;  1VNB A;  1T0Z A;  2YBR C;  5KK4 A;  1ZYW A;  2LKB A;  1MYN A;  1JXC A;  2KSK A;  2LR3 A;  1ZYV A;  2YC1 C;  2KJA A;  2MZ0 A;  1NH5 A;  1DJT A;  2KBJ A;  1B7D A;  2B3C A;  1OMY A; 
#chains in the Genus database with same CATH topology
 5EX5 A;  4UAF E;  1PE4 A;  1T1T A;  1BUP A;  1T7E A;  2QWQ A;  3KP1 A;  1ZVE A;  2VY6 A;  4HE7 A;  1OZZ A;  3QFU A;  2GMO A;  2KPY A;  1QQN A;  4H5T A;  3D2E A;  3LDQ A;  5BN9 A;  1B3C A;  1T7B A;  3PSM A;  2N69 A;  2YIP A;  2LY5 A;  3C7N A;  1AYJ A;  1BMR A;  1I2V A;  1NGG A;  3FZL A;  1LQI A;  1MR4 A;  2G2K A;  1NGJ A;  3HSC A;  2BRZ A;  4UAD E;  5AQV A;  4UJ0 A;  1BRZ A;  2KBK A;  1NE5 A;  2M8B B;  3LDL A;  2E3G A;  3M3Z A;  1ZFU A;  3LDP A;  4AEI A;  3GDQ A;  2E2F A;  2E88 A;  1NGD A;  1C55 A;  1BA0 A;  5AQR A;  5BPL A;  5F2R A;  1T7A A;  4AB0 A;  1C56 A;  1XRS B;  5EY4 A;  1GPT A;  1GPS A;  1WT7 A;  3KOX A;  2NY9 X;  3LDO A;  2N2R A;  1YUW A;  1BCG A;  3JXU A;  4HHF A;  1SN1 A;  2I61 A;  1FH3 A;  4UAE F;  1DKG D;  2E0H A;  2V7Z A;  2SN3 A;  5AQG A;  4CQK A;  2GL1 A;  2LY6 A;  3KOW A;  3QML A;  5AR0 A;  1UGL A;  1PTX A;  1ZUT A;  2LT8 A;  3E7R L;  1N4N A;  1QQO A;  5FPM A;  1LQH A;  1WMT A;  1L4V A;  2YEO A;  5AQN A;  5BN8 A;  1NPI A;  2YIO A;  2K35 A;  3D2F B;  2LI7 A;  1I2U A;  1S3X A;  1SEG A;  2MBK A;  1ICA A;  5AQH A;  3R2V A;  1HX1 A;  1BK8 A;  2QWP A;  2QWL A;  2QXL A;  4KYP A;  5AQU A;  5F1X A;  3D2F A;  1VNA A;  3E7U X;  1NRA A;  1NGA A;  1SNB A;  1ATS A;  2BUP A;  2KGQ A;  3FZF A;  3GL1 A;  4GNI A;  4KBO A;  1KAY A;  2KYQ A;  3KC6 A;  1P0A A;  5AQY A;  1BA1 A;  1NGI A;  2QWN A;  1QQM A;  2QW9 A;  2ASC A;  1JZB A;  2QWO A;  4IO8 A;  5BPM A;  1ZVG A;  1SN4 A;  5EVZ A;  4HWI A;  3ATV A;  2YIL A;  1DQ7 A;  5CY0 A;  3IUC A;  1KAX A;  3QFP A;  1KV0 A;  2E3F A;  2NY8 X;  1WWN A;  5AQI A;  5FPN A;  3L6Q A;  1NGH A;  1I6F A;  1AHO A;  3KHW A;  4V1D C;  2KHO A;  1NGB A;  3FZK A;  4H5V A;  4H5W A;  5F0X A;  2MN5 A;  1POI A;  1PX9 A;  3KOZ A;  3FE1 A;  3L4I A;  1HJO A;  4FSV A;  3KOY A;  2ATB A;  2N66 A;  3I33 A;  4AAZ A;  1CN2 A;  1ZU3 A;  2D56 A;  1JKZ A;  3LDN A;  5AQQ A;  1TI5 A;  2QWM A;  2N2Q A;  3D2E B;  5AQJ A;  1NRB A;  5AQK A;  2KBH A;  5AQT A;  1K8B A;  2B68 A;  5EXW A;  1JZA A;  2QWR A;  3BK3 C;  3C7N B;  3AY9 A;  3L56 A;  1I6G A;  3GKU A;  5AQP A;  5FPE A;  2LJM A;  2LN8 A;  1CHZ A;  5AQF A;  5AQS A;  5AQW A;  1P00 A;  2LJ7 A;  1HPM A;  1LQQ A;  2A7T A;  5AQZ A;  5FPD A;  5AQO A;  1ATR A;  4H5N A;  1VNB A;  2E8A A;  3QI7 A;  1T0Z A;  1NGF A;  2YBR C;  5KK4 A;  5AQM A;  1ZYW A;  2LKB A;  1MYN A;  2JDQ D;  1JXC A;  2KSK A;  3ATU A;  3CW4 A;  2LR3 A;  3FZH A;  3SF4 D;  1KAZ A;  1ZYV A;  3CQX A;  3FZM A;  1NGC A;  3A8Y A;  4H5R A;  5AQL A;  4FL9 A;  2YC1 C;  3KP0 A;  2KJA A;  3KVG A;  2MZ0 A;  1NH5 A;  5AQX A;  1B7D A;  1DJT A;  2KBJ A;  5BPN A;  1NGE A;  2B3C A;  1OMY A; 
#chains in the Genus database with same CATH homology
 1PE4 A;  1T1T A;  1T7E A;  1ZVE A;  4HE7 A;  1OZZ A;  2KPY A;  1B3C A;  1T7B A;  3PSM A;  2N69 A;  2LY5 A;  1AYJ A;  1I2V A;  1BMR A;  1LQI A;  1MR4 A;  1BRZ A;  2BRZ A;  4UJ0 A;  2KBK A;  1NE5 A;  2M8B B;  2E3G A;  1ZFU A;  4AEI A;  1C55 A;  1T7A A;  4AB0 A;  1C56 A;  1GPT A;  1GPS A;  1WT7 A;  2NY9 X;  2N2R A;  1BCG A;  4HHF A;  1SN1 A;  2I61 A;  1FH3 A;  2E0H A;  2SN3 A;  4CQK A;  2GL1 A;  2LY6 A;  1PTX A;  1ZUT A;  2LT8 A;  3E7R L;  1N4N A;  1LQH A;  1WMT A;  1L4V A;  2YEO A;  1NPI A;  1I2U A;  2LI7 A;  1SEG A;  1ICA A;  1BK8 A;  4KYP A;  1VNA A;  3E7U X;  1NRA A;  1SNB A;  2KGQ A;  2KYQ A;  1P0A A;  2ASC A;  1JZB A;  1ZVG A;  1SN4 A;  5CY0 A;  1DQ7 A;  2E3F A;  1KV0 A;  2NY8 X;  1WWN A;  1I6F A;  1AHO A;  4V1D C;  1PX9 A;  2ATB A;  2N66 A;  4AAZ A;  1CN2 A;  1ZU3 A;  1JKZ A;  1TI5 A;  2N2Q A;  1NRB A;  2KBH A;  2B68 A;  1JZA A;  1I6G A;  2LJM A;  1CHZ A;  1P00 A;  2LJ7 A;  1LQQ A;  2A7T A;  1VNB A;  1T0Z A;  2YBR C;  5KK4 A;  1ZYW A;  2LKB A;  1MYN A;  1JXC A;  2KSK A;  2LR3 A;  1ZYV A;  2YC1 C;  2KJA A;  2MZ0 A;  1NH5 A;  1DJT A;  2KBJ A;  1B7D A;  2B3C A;  1OMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...