4KYPA

Beta-scorpion toxin folded in the periplasm of e.coli
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
b'KKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-insect excitatory toxin Bj-xtrIT
publication title Chaperone-mediated native folding of a beta-scorpion toxin in the periplasm of Escherichia coli.
pubmed doi rcsb
source organism Hottentotta judaicus
molecule tags Toxin
total genus 18
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4kypA00
1GPTA 1T7BA 2LY6A 4KYPA 1I6FA 1VNAA 1I6GA 1T1TA 3E7RL 2B68A 3E7UX 1JKZA 4UJ0A 1P00A 1WWNA 4V1DC 1CN2A 1JZAA 2LKBA 2E0HA 2KGQA 4AB0A 1AHOA 1NRBA 1DJTA 2E3GA 1C55A 1SN1A 1ZU3A 1T0ZA 2N66A 4HHFA 1I2UA 1AYJA 1WT7A 2KPYA 1BK8A 2ATBA 2ASCA 1BRZA 1MR4A 1SEGA 2E3FA 1DQ7A 1FH3A 1ZVEA 2I61A 1LQQA 2KBJA 1GPSA 1ZFUA 4AAZA 1C56A 1PX9A 1B3CA 1WMTA 2GL1A 1PTXA 2M8BB 2KJAA 4AEIA 2MZ0A 1I2VA 5CY0A 2KSKA 1SNBA 1T7EA 2LI7A 5KK4A 1OZZA 2YEOA 1ZVGA 2SN3A 2LT8A 1MYNA 2NY8X 2B3CA 1NPIA 1NRAA 1L4VA 1SN4A 1LQHA 1ZUTA 2N69A 1PE4A 1VNBA 2N2QA 2LJ7A 1JZBA 2YBRC 1JXCA 3PSMA 1OMYA 2YC1C 4CQKA 4HE7A 2KBKA 2N2RA 1KV0A 1ZYVA 1NH5A 1CHZA 1NE5A 1ZYWA 1P0AA 1BCGA 1B7DA 1LQIA 1N4NA 1TI5A 2A7TA 2LR3A 2LY5A 2KYQA 2KBHA 2NY9X 2BRZA 1T7AA 2LJMA 1BMRA 1ICAA
chains in the Genus database with same CATH superfamily
5AQWA 5AQHA 1GPTA 4H5WA 3FZLA 5AQMA 5EY4A 2QWQA 1T7BA 2LY6A 1NGJA 4KYPA 2V7ZA 1I6FA 4FSVA 1NGAA 1VNAA 3KOZA 1T1TA 3QI7A 2QWOA 5AQJA 1I6GA 1NGIA 1BA1A 3E7RL 3CW4A 5F1XA 2B68A 3E7UX 3GKUA 1JKZA 1QQMA 5AQNA 3HSCA 3LDQA 3KC6A 3AY9A 1QQNA 2K35A 5AQYA 4UJ0A 1P00A 1WWNA 1S3XA 3LDPA 1XRSB 5FPDA 3FZFA 4V1DC 5F0XA 1JZAA 2LKBA 1CN2A 3LDLA 1NGFA 2E0HA 4H5RA 2KGQA 1QQOA 1AHOA 5AQPA 1NRBA 4AB0A 1HPMA 2QWMA 5EXWA 1DJTA 2E3GA 4HWIA 1C55A 1SN1A 4FL9A 1ZU3A 1T0ZA 4UAEF 1ATSA 2N66A 1BUPA 1KAXA 3LDNA 4HHFA 1I2UA 4UADE 1AYJA 1WT7A 2LN8A 2KPYA 3GL1A 3KOYA 5AR0A 1BK8A 2ATBA 2ASCA 2QWRA 3BK3C 4GNIA 1BRZA 3ATVA 1MR4A 1SEGA 4UAFE 2E3FA 2QWPA 1DQ7A 1DKGD 5BPMA 1FH3A 5AQQA 1ZVEA 2I61A 1LQQA 5AQSA 1K8BA 2KBJA 1GPSA 1ZFUA 3JXUA 4AAZA 1C56A 1PX9A 2KHOA 5BPLA 3KOXA 1B3CA 2BUPA 5BPNA 5FPEA 4IO8A 1UGLA 1WMTA 2GL1A 3FZMA 1PTXA 2M8BB 3I33A 2JDQD 2KJAA 3D2FB 5AQOA 5AQZA 1KAZA 3L4IA 4AEIA 1NGEA 2MZ0A 1I2VA 5CY0A 2KSKA 3D2FA 1SNBA 2D56A 2QXLA 5FPNA 1T7EA 3IUCA 2G2KA 3KHWA 1NGCA 4H5TA 5AQTA 5FPMA 5AQXA 3GDQA 2LI7A 5KK4A 3QMLA 1HX1A 1OZZA 2YEOA 1NGDA 3KOWA 3R2VA 1YUWA 1ZVGA 2E2FA 5BN8A 2YIOA 2QWLA 2SN3A 3FE1A 1HJOA 2E88A 2LT8A 4H5VA 1MYNA 5BN9A 2NY8X 5AQIA 2B3CA 1NGBA 1NPIA 1ATRA 5AQUA 1NRAA 1L4VA 1SN4A 1LQHA 1ZUTA 3L56A 5EX5A 5F2RA 2VY6A 3LDOA 3ATUA 2N69A 1BMRA 1PE4A 1VNBA 2N2QA 2LJ7A 3D2EB 4H5NA 3KP1A 5AQKA 1JZBA 2YBRC 1NGHA 3KVGA 1NGGA 3FZHA 1JXCA 2GMOA 5AQRA 5AQFA 3PSMA 2QWNA 1OMYA 2YC1C 4CQKA 3FZKA 3D2EA 4HE7A 4KBOA 2KBKA 2N2RA 1KV0A 3A8YA 2MBKA 3QFUA 3M3ZA 2E8AA 1ZYVA 1NH5A 1CHZA 1NE5A 5AQGA 3CQXA 1ZYWA 1BA0A 1P0AA 1BCGA 1B7DA 1LQIA 1N4NA 1TI5A 2A7TA 2LR3A 1POIA 2LY5A 2QW9A 2YILA 3C7NB 5EVZA 3QFPA 3SF4D 2KYQA 5AQVA 5AQLA 3KP0A 2YIPA 2MN5A 2KBHA 2NY9X 2BRZA 3C7NA 1T7AA 3L6QA 2LJMA 1KAYA 1ICAA
chains in the Genus database with same CATH topology
1GPTA 1T7BA 2LY6A 4KYPA 1I6FA 1VNAA 1I6GA 1T1TA 3E7RL 2B68A 3E7UX 1JKZA 4UJ0A 1P00A 1WWNA 4V1DC 1CN2A 1JZAA 2LKBA 2E0HA 2KGQA 4AB0A 1AHOA 1NRBA 1DJTA 2E3GA 1C55A 1SN1A 1ZU3A 1T0ZA 2N66A 4HHFA 1I2UA 1AYJA 1WT7A 2KPYA 1BK8A 2ATBA 2ASCA 1BRZA 1MR4A 1SEGA 2E3FA 1DQ7A 1FH3A 1ZVEA 2I61A 1LQQA 2KBJA 1GPSA 1ZFUA 4AAZA 1C56A 1PX9A 1B3CA 1WMTA 2GL1A 1PTXA 2M8BB 2KJAA 4AEIA 2MZ0A 1I2VA 5CY0A 2KSKA 1SNBA 1T7EA 2LI7A 5KK4A 1OZZA 2YEOA 1ZVGA 2SN3A 2LT8A 1MYNA 2NY8X 2B3CA 1NPIA 1NRAA 1L4VA 1SN4A 1LQHA 1ZUTA 2N69A 1PE4A 1VNBA 2N2QA 2LJ7A 1JZBA 2YBRC 1JXCA 3PSMA 1OMYA 2YC1C 4CQKA 4HE7A 2KBKA 2N2RA 1KV0A 1ZYVA 1NH5A 1CHZA 1NE5A 1ZYWA 1P0AA 1BCGA 1B7DA 1LQIA 1N4NA 1TI5A 2A7TA 2LR3A 2LY5A 2KYQA 2KBHA 2NY9X 2BRZA 1T7AA 2LJMA 1BMRA 1ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPT A;  1T7B A;  2LY6 A;  4KYP A;  1I6F A;  1VNA A;  1I6G A;  1T1T A;  3E7R L;  2B68 A;  3E7U X;  1JKZ A;  4UJ0 A;  1P00 A;  1WWN A;  4V1D C;  1CN2 A;  1JZA A;  2LKB A;  2E0H A;  2KGQ A;  4AB0 A;  1AHO A;  1NRB A;  1DJT A;  2E3G A;  1C55 A;  1SN1 A;  1ZU3 A;  1T0Z A;  2N66 A;  4HHF A;  1I2U A;  1AYJ A;  1WT7 A;  2KPY A;  1BK8 A;  2ATB A;  2ASC A;  1BRZ A;  1MR4 A;  1SEG A;  2E3F A;  1DQ7 A;  1FH3 A;  1ZVE A;  2I61 A;  1LQQ A;  2KBJ A;  1GPS A;  1ZFU A;  4AAZ A;  1C56 A;  1PX9 A;  1B3C A;  1WMT A;  2GL1 A;  1PTX A;  2M8B B;  2KJA A;  4AEI A;  2MZ0 A;  1I2V A;  5CY0 A;  2KSK A;  1SNB A;  1T7E A;  2LI7 A;  5KK4 A;  1OZZ A;  2YEO A;  1ZVG A;  2SN3 A;  2LT8 A;  1MYN A;  2NY8 X;  2B3C A;  1NPI A;  1NRA A;  1L4V A;  1SN4 A;  1LQH A;  1ZUT A;  2N69 A;  1PE4 A;  1VNB A;  2N2Q A;  2LJ7 A;  1JZB A;  2YBR C;  1JXC A;  3PSM A;  1OMY A;  2YC1 C;  4CQK A;  4HE7 A;  2KBK A;  2N2R A;  1KV0 A;  1ZYV A;  1NH5 A;  1CHZ A;  1NE5 A;  1ZYW A;  1P0A A;  1BCG A;  1B7D A;  1LQI A;  1N4N A;  1TI5 A;  2A7T A;  2LR3 A;  2LY5 A;  2KYQ A;  2KBH A;  2NY9 X;  2BRZ A;  1T7A A;  2LJM A;  1BMR A;  1ICA A; 
#chains in the Genus database with same CATH topology
 5AQW A;  5AQH A;  1GPT A;  4H5W A;  3FZL A;  5AQM A;  5EY4 A;  2QWQ A;  1T7B A;  2LY6 A;  1NGJ A;  4KYP A;  2V7Z A;  1I6F A;  4FSV A;  1NGA A;  1VNA A;  3KOZ A;  1T1T A;  3QI7 A;  2QWO A;  5AQJ A;  1I6G A;  1NGI A;  1BA1 A;  3E7R L;  3CW4 A;  5F1X A;  2B68 A;  3E7U X;  3GKU A;  1JKZ A;  1QQM A;  5AQN A;  3HSC A;  3LDQ A;  3KC6 A;  3AY9 A;  1QQN A;  2K35 A;  5AQY A;  4UJ0 A;  1P00 A;  1WWN A;  1S3X A;  3LDP A;  1XRS B;  5FPD A;  3FZF A;  4V1D C;  5F0X A;  1JZA A;  2LKB A;  1CN2 A;  3LDL A;  1NGF A;  2E0H A;  4H5R A;  2KGQ A;  1QQO A;  1AHO A;  5AQP A;  1NRB A;  4AB0 A;  1HPM A;  2QWM A;  5EXW A;  1DJT A;  2E3G A;  4HWI A;  1C55 A;  1SN1 A;  4FL9 A;  1ZU3 A;  1T0Z A;  4UAE F;  1ATS A;  2N66 A;  1BUP A;  1KAX A;  3LDN A;  4HHF A;  1I2U A;  4UAD E;  1AYJ A;  1WT7 A;  2LN8 A;  2KPY A;  3GL1 A;  3KOY A;  5AR0 A;  1BK8 A;  2ATB A;  2ASC A;  2QWR A;  3BK3 C;  4GNI A;  1BRZ A;  3ATV A;  1MR4 A;  1SEG A;  4UAF E;  2E3F A;  2QWP A;  1DQ7 A;  1DKG D;  5BPM A;  1FH3 A;  5AQQ A;  1ZVE A;  2I61 A;  1LQQ A;  5AQS A;  1K8B A;  2KBJ A;  1GPS A;  1ZFU A;  3JXU A;  4AAZ A;  1C56 A;  1PX9 A;  2KHO A;  5BPL A;  3KOX A;  1B3C A;  2BUP A;  5BPN A;  5FPE A;  4IO8 A;  1UGL A;  1WMT A;  2GL1 A;  3FZM A;  1PTX A;  2M8B B;  3I33 A;  2JDQ D;  2KJA A;  3D2F B;  5AQO A;  5AQZ A;  1KAZ A;  3L4I A;  4AEI A;  1NGE A;  2MZ0 A;  1I2V A;  5CY0 A;  2KSK A;  3D2F A;  1SNB A;  2D56 A;  2QXL A;  5FPN A;  1T7E A;  3IUC A;  2G2K A;  3KHW A;  1NGC A;  4H5T A;  5AQT A;  5FPM A;  5AQX A;  3GDQ A;  2LI7 A;  5KK4 A;  3QML A;  1HX1 A;  1OZZ A;  2YEO A;  1NGD A;  3KOW A;  3R2V A;  1YUW A;  1ZVG A;  2E2F A;  5BN8 A;  2YIO A;  2QWL A;  2SN3 A;  3FE1 A;  1HJO A;  2E88 A;  2LT8 A;  4H5V A;  1MYN A;  5BN9 A;  2NY8 X;  5AQI A;  2B3C A;  1NGB A;  1NPI A;  1ATR A;  5AQU A;  1NRA A;  1L4V A;  1SN4 A;  1LQH A;  1ZUT A;  3L56 A;  5EX5 A;  5F2R A;  2VY6 A;  3LDO A;  3ATU A;  2N69 A;  1BMR A;  1PE4 A;  1VNB A;  2N2Q A;  2LJ7 A;  3D2E B;  4H5N A;  3KP1 A;  5AQK A;  1JZB A;  2YBR C;  1NGH A;  3KVG A;  1NGG A;  3FZH A;  1JXC A;  2GMO A;  5AQR A;  5AQF A;  3PSM A;  2QWN A;  1OMY A;  2YC1 C;  4CQK A;  3FZK A;  3D2E A;  4HE7 A;  4KBO A;  2KBK A;  2N2R A;  1KV0 A;  3A8Y A;  2MBK A;  3QFU A;  3M3Z A;  2E8A A;  1ZYV A;  1NH5 A;  1CHZ A;  1NE5 A;  5AQG A;  3CQX A;  1ZYW A;  1BA0 A;  1P0A A;  1BCG A;  1B7D A;  1LQI A;  1N4N A;  1TI5 A;  2A7T A;  2LR3 A;  1POI A;  2LY5 A;  2QW9 A;  2YIL A;  3C7N B;  5EVZ A;  3QFP A;  3SF4 D;  2KYQ A;  5AQV A;  5AQL A;  3KP0 A;  2YIP A;  2MN5 A;  2KBH A;  2NY9 X;  2BRZ A;  3C7N A;  1T7A A;  3L6Q A;  2LJM A;  1KAY A;  1ICA A; 
#chains in the Genus database with same CATH homology
 1GPT A;  1T7B A;  2LY6 A;  4KYP A;  1I6F A;  1VNA A;  1I6G A;  1T1T A;  3E7R L;  2B68 A;  3E7U X;  1JKZ A;  4UJ0 A;  1P00 A;  1WWN A;  4V1D C;  1CN2 A;  1JZA A;  2LKB A;  2E0H A;  2KGQ A;  4AB0 A;  1AHO A;  1NRB A;  1DJT A;  2E3G A;  1C55 A;  1SN1 A;  1ZU3 A;  1T0Z A;  2N66 A;  4HHF A;  1I2U A;  1AYJ A;  1WT7 A;  2KPY A;  1BK8 A;  2ATB A;  2ASC A;  1BRZ A;  1MR4 A;  1SEG A;  2E3F A;  1DQ7 A;  1FH3 A;  1ZVE A;  2I61 A;  1LQQ A;  2KBJ A;  1GPS A;  1ZFU A;  4AAZ A;  1C56 A;  1PX9 A;  1B3C A;  1WMT A;  2GL1 A;  1PTX A;  2M8B B;  2KJA A;  4AEI A;  2MZ0 A;  1I2V A;  5CY0 A;  2KSK A;  1SNB A;  1T7E A;  2LI7 A;  5KK4 A;  1OZZ A;  2YEO A;  1ZVG A;  2SN3 A;  2LT8 A;  1MYN A;  2NY8 X;  2B3C A;  1NPI A;  1NRA A;  1L4V A;  1SN4 A;  1LQH A;  1ZUT A;  2N69 A;  1PE4 A;  1VNB A;  2N2Q A;  2LJ7 A;  1JZB A;  2YBR C;  1JXC A;  3PSM A;  1OMY A;  2YC1 C;  4CQK A;  4HE7 A;  2KBK A;  2N2R A;  1KV0 A;  1ZYV A;  1NH5 A;  1CHZ A;  1NE5 A;  1ZYW A;  1P0A A;  1BCG A;  1B7D A;  1LQI A;  1N4N A;  1TI5 A;  2A7T A;  2LR3 A;  2LY5 A;  2KYQ A;  2KBH A;  2NY9 X;  2BRZ A;  1T7A A;  2LJM A;  1BMR A;  1ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...