2G2KA

Nmr structure of an n-terminal fragment of the eukaryotic initiation factor 5 (eif5)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
156
structure length
156
Chain Sequence
LSVNVNRSVMDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5
publication title Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2g2kA02
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 2g2kA01
2E9HA 2G2KA 1K8BA
chains in the Genus database with same CATH superfamily
5F0XA 2E3GA 1XRSB 3GTGI 1ZVGA 1JZBA 1KRLA 1VQOZ 1BRZA 1VQKZ 2YIOA 3VB9A 1FH3A 2YU9I 1BA1A 2LEXA 5AQLA 1WIIA 1NJI1 5BPMA 4BBRI 2LN8A 4MD7A 4HHFA 4FSVA 1P00A 3F3PC 2F4OA 5C4XI 1I2UA 4MD8A 4RS4A 2R93I 4CL1A 1WCMI 2QR1B 4V1DC 3KVGA 2VPYA 3I4MI 1RNIA 2B68A 2KBJA 1Y1VI 3GTQI 1Z03A 3MONA 2PM9A 1KD11 2MN5A 2G2KA 4E31A 5BPLA 3D6WA 3IF8A 5AR0A 3S1RI 1DJTA 1KQSY 3AY9A 4NBAA 1KAZA 2VPXA 3I551 1ZYWA 2E2HI 2E8AA 4A3KI 5AQIA 4MH4A 5T64A 4NBBA 1ATSA 1B7DA 1YIJZ 4AB0A 2QRDB 4HGZA 1VQ71 1QXFA 2YADA 3IFUA 4H5RA 1ZUTA 3F3FC 2K3RA 1JWHC 3I55Z 2NVTI 4A3EI 1Q821 1M902 1VNBA 1WJ2A 3LDNA 1TWHI 1VQ7Z 2GTHA 3NH8A 3E7RL 2JMOA 1X3ZA 4NBGA 3GKUA 2JIMA 1C56A 3HOUI 2LY6A 1QQMA 3CC4Z 4BXXI 2DE5A 5AQUA 1TFIA 4AEIA 2OZKA 2GU2A 3CC2Z 2JIPA 2K5RA 2BUPA 2KBHA 3S15I 2K35A 3FQMA 3G711 4BY7I 2I3CA 1W2BY 1QVFZ 3GTLI 2QWQA 3D9XA 3IUCA 3CXCZ 5AQJA 4QTTA 3FQQA 1JJ2Z 3R2VA 3S14I 1RO0A 2BRZA 1RQFA 2RHBA 1Z02A 4DQYB 2LR3A 5IT9b 5FPDA 1JZAA 3PO3I 4NBCA 3GTMI 1ZB9A 1KAXA 3G71Z 2LT8A 3CME1 4RVGA 4MXUA 2O4HA 2NY9X 3LDQA 2I61A 1P9NA 3T4NB 3LDOA 3VMIA 3J81f 1Q811 1Q812 5AQZA 1HX1A 1TI5A 3FKII 2YBRC 5AQVA 3H0GI 1NRAA 5IT9f 1QVGZ 2A7TA 4X6AI 3GTJI 2RPRA 2LKBA 1GPTA 2NVYI 1VQL1 3CD61 3FZLA 5D1OB 1Q861 1LQHA 1NGCA 1C55A 1R9TI 3CMEZ 1ZFUA 1DL6A 1KV0A 2IZ4A 3S2DI 1NUIA 1NRBA 3CCEZ 1T0ZA 2KSKA 4HE7A 1B3CA 5AQHA 2LI7A 2QKDA 2EGTA 1JKZA 3KIHA 4H5WA 4RVDA 4A3LI 3CCV1 5AQGA 3NDJA 1BCGA 1VQLZ 3CD6Z 2YIPA 3CPWZ 1KC81 4NFRA 2JNYA 1OMYA 1K9M2 4E33A 1K8A1 1K8A2 4A3MI 1TWGI 2KGQA 1LQLA 5T6BA 4E30A 4HH4A 3I07A 2QREB 1UGLA 1T7EA 5IP7I 1YIT1 4Y52I 1YJ91 2MZ0A 3CCVZ 3S2HI 4NOZA 2QWPA 2LFUA 2IZ3A 1NJI2 2QLVB 3S17I 3GTKI 3RZDI 5FLXb 3FZHA 3HOWI 1N8R1 2E9HA 1TWFI 4RVHA 2KPIA 1YITZ 5C3EI 2OTJ1 1YJ9Z 2SN3A 2IV2X 2WAQA 3FZKA 2LIYA 1Y8CA 3BG0B 1YIJ1 3ATUA 3D2LA 1KD12 1BUPA 4AYBA 3OW2Z 1VQ61 1SN1A 3L4IA 5FLXf 3M4OI 1WZNA 1AYJA 3CQZI 3QFPA 2JDQD 2OTJZ 3VMHA 1NGIA 4A3GI 2JIRA 1ZYVA 1NH5A 4E32A 3NFZA 3K7AI 1M1K1 2NVQI 5A2Qb 1M1K2 2LY5A 3SF4D 3KOZA 2V8IA 5KK4A 1I6GA 5CM2M 1SIWA 4UADE 1CN2A 1K8BA 4E2WA 1VQ6Z 1ZH1A 2ZAEB 3CCUZ 1HJOA 2KI7B 4DGLA 5FLMI 3LDPA 1USPB 4NBDA 3CC41 1SEGA 2V7ZA 3CCR1 1ZVEA 3M3ZA 2M6NA 3RZOI 1OZZA 5F1XA 3CC21 1Q822 3CW4A 3L56A 2YILA 4NBHA 3KC6A 3MZLB 3GTOI 5A2Qf 1SNBA 1KAYA 3PO3S 3G4S1 4A3BI 2KJAA 3GTMS 3KP1A 3HOZI 1WMTA 4S1TA 2B63I 3CCM1 3S1NI 4A93I 3CCRZ 2E2JI 5EX5A 4CQKA 2E7ZA 1YI2Z 1PX9A 3GCFA 1PTXA 5AQQA 2H85A 4BY1I 2OOYB 1RLYA 3QFUA 2Q4ZA 3G4SZ 1X3WA 5AQNA 3L6QA 2R92I 3MZKB 4EWCA 5CY0A 1VQM1 2GMOA 1NGFA 3CCMZ 2W04A 2N2QA 3ATVA 2V45A 1K731 4MONA 2KYQA 1DQ7A 5AQTA 1T7BA 1K83I 3FZFA 4A3DI 3CC7Z 1LQQA 5AQOA 2BJOA 4QTUA 3ESWA 2P28A 1NGDA 1VQMZ 3D2FB 2E0HA 3CCE1 2N2RA 1I3QI 1NGGA 1HPMA 2LJ7A 5AQYA 4A3CI 2YEOA 3S1MI 1P0AA 2R7ZI 1QVFY 3GL1A 1N2FA 2RBLA 3CXCY 4NH1C 1AHOA 4HGYA 2QWRA 1JJ2Y 1Q862 2QWLA 4KBOA 1NP6A 2QA41 1Q16A 1DKGD 1VQ41 4E2XA 3PO2I 1I6FA 2J6AA 2M48A 3S1QI 4H5VA 3GDQA 1T7AA 3QWUA 3HSCA 2B3CA 3VTNA 3HOXI 5AN9F 2RIQA 3M3YI 3KOYA 3JXUA 1KC82 3HOYI 2QA4Z 5FPMA 2M8BB 4GNIA 1BMRA 3EEDA 2JS4A 1VQ4Z 2Y0SA 2F4MA 3D2EB 2JR6A 3NH4A 1QVGY 1S3XA 1NGEA 2KPYA 1YUWA 4DK1A 1RO4A 3J7A4 5AQFA 5BPNA 1NPIA 5C44I 2E2FA 5AQMA 4H5TA 1MR4A 4A3JI 3C7NB 3QMLA 1L4VA 3U50C 5F2RA 5EXWA 1L1OC 2JA8I 1TWCI 1VQP1 2KBKA 1N8R2 3CPWY 4FL9A 4UJ0A 1NGHA 2HF1A 3IR7A 3CMA1 1BA0A 2JUBA 3D2FA 1WW9A 2E88A 1BK8A 1GPSA 2QWMA 2O53A 3TDHB 1VQ81 4UAFE 1KQSZ 1CHZA 1ML8A 2NY8X 4UAEF 5T67A 3CCU1 2LJMA 5D1OA 5AQKA 1VQPZ 2VPWA 2AYDA 2KHOA 4AAZA 1VLAA 3PSMA 3CMAZ 5BN9A 1ZB8A 2VF1A 4RV9A 1PFTA 2GTIA 2QEX1 1WT7A 4BBSI 5D1PA 1VQ91 1YJW1 1VQ8Z 5AQWA 3CCQ1 3EERA 2HU9A 5FPNA 1X0TA 5FPEA 2JIQA 3HKZA 5AQRA 2VY6A 4NBEA 2GL1A 3BG1B 4E2ZA 1YI21 3VMGA 1N4NA 2VUGA 3D2EA 4IO8A 2QEXZ 3NH5A 3OW2Y 2NAPA 1VQ9Z 1YJWZ 3CCQZ 4MRIA 2MBKA 1JXCA 2E2II 1Z01A 1ICAA 1SN4A 1T1TA 2PK7A 2V8JA 2WB1A 2VUMI 1MYNA 2D56A 3KP0A 3C7NA 4NBFA 1POIA 3I33A 2DE6A 1S7MA 1W2BZ 1PE4A 1QYPA 1NGBA 3JAMb 5IP9I 2YC1C 3CC71 4NB8A 2P3YA 2QWOA 5AQSA 1VQN1 1M901 2N69A 3J80b 2QWNA 3NDIA 3GKQA 4RVFA 1WWNA 1QQNA 1YJN1 4NB9A 1K732 1VNAA 5C4JI 3G6E1 1SFOI 2VPZA 3BK3C 1I6HI 2QRCB 1AA6A 1Y1WI 3JAMf 2AKLA 1VQNZ 3LDLA 1NGAA 3GTPI 5BN8A 3A8YA 3J80f 1S721 3I4NI 3J81b 3E7UX 1YJNZ 4H5NA 5EY4A 1I50I 1Q7Y1 1Q7Y2 3G6EZ 2ASCA 3IX0A 4HWIA 1RO2A 2JA5I 1YHQ1 4A3FI 3KHWA 4Y7NI 2QW9A 1USPA 3I561 2QXLA 5AQPA 2DE7A 2V3VA 1TWAI 1S72Z 1ATRA 2ATBA 3CCS1 1FDIA 2JIOA 2N66A 1VQ51 2OTL1 1NGJA 1YHQZ 2OOXB 3KOWA 1I2VA 4A3II 3I56Z 3H3VJ 1QF8A 3QI7A 3TE5B 2PMZA 2NVXI 5EVZA 1FDOA 3P5JB 3KOXA 5LL6f 3KIFA 3CCSZ 3CCL1 2RT9A 1YUKA 1VQ5Z 1QQOA 4KYPA 3HOVI 2OTLZ 2R6MA 3CCJ1 5AQXA 3FZMA 3S16I 4TNUA 1LQIA 2JA6I 2W03A 2V8KA 1YUAA 2E3FA 2Q51A 1VQO1 2JA7I 1VQK1 3FE1A 1NE5A 4MD9A 1K9M1 3LUSA 1ZU3A 1Y1VS 3CCLZ 4XX2A 3Q87A 3CQXA 4E2YA 3CCJZ
chains in the Genus database with same CATH topology
3GTGI 1KRLA 1VQOZ 1VQKZ 3VB9A 2YU9I 1WIIA 1NJI1 4BBRI 4MD7A 3F3PC 2F4OA 5C4XI 4MD8A 4RS4A 2R93I 4CL1A 1WCMI 2QR1B 3I4MI 1RNIA 1Y1VI 3GTQI 1Z03A 3MONA 2PM9A 1KD11 2G2KA 4E31A 3D6WA 3IF8A 3S1RI 1KQSY 4NBAA 3I551 2E2HI 4A3KI 4MH4A 5T64A 4NBBA 1YIJZ 2QRDB 4HGZA 1VQ71 2YADA 3IFUA 3F3FC 2K3RA 1JWHC 3I55Z 2NVTI 4A3EI 1Q821 1M902 1TWHI 1VQ7Z 2GTHA 3NH8A 2JMOA 1X3ZA 4NBGA 3HOUI 3CC4Z 4BXXI 2DE5A 1TFIA 2OZKA 2GU2A 3CC2Z 2K5RA 3S15I 3FQMA 3G711 4BY7I 2I3CA 1W2BY 1QVFZ 3GTLI 3D9XA 3CXCZ 4QTTA 3FQQA 1JJ2Z 3S14I 1RO0A 1RQFA 2RHBA 1Z02A 4DQYB 5IT9b 3PO3I 4NBCA 3GTMI 1ZB9A 3G71Z 3CME1 4RVGA 4MXUA 2O4HA 1P9NA 3T4NB 3VMIA 3J81f 1Q811 1Q812 3FKII 3H0GI 5IT9f 1QVGZ 4X6AI 3GTJI 2RPRA 2NVYI 1VQL1 3CD61 5D1OB 1Q861 1R9TI 3CMEZ 1DL6A 2IZ4A 3S2DI 1NUIA 3CCEZ 2QKDA 2EGTA 3KIHA 4RVDA 4A3LI 3CCV1 3NDJA 1VQLZ 3CD6Z 3CPWZ 1KC81 4NFRA 2JNYA 1K9M2 4E33A 1K8A1 1K8A2 4A3MI 1TWGI 1LQLA 5T6BA 4E30A 4HH4A 3I07A 2QREB 5IP7I 1YIT1 4Y52I 1YJ91 3CCVZ 3S2HI 4NOZA 2LFUA 2IZ3A 1NJI2 2QLVB 3S17I 3GTKI 3RZDI 5FLXb 3HOWI 1N8R1 2E9HA 1TWFI 4RVHA 2KPIA 1YITZ 5C3EI 2OTJ1 1YJ9Z 2WAQA 2LIYA 1YIJ1 3BG0B 1KD12 4AYBA 3OW2Z 1VQ61 5FLXf 3M4OI 3CQZI 2OTJZ 3VMHA 4A3GI 4E32A 3NFZA 3K7AI 1M1K1 2NVQI 5A2Qb 1M1K2 2V8IA 5CM2M 1K8BA 4E2WA 1VQ6Z 1ZH1A 2ZAEB 3CCUZ 2KI7B 4DGLA 5FLMI 1USPB 4NBDA 3CC41 3CCR1 2M6NA 3RZOI 3CC21 1Q822 4NBHA 3MZLB 3GTOI 5A2Qf 3PO3S 3G4S1 4A3BI 3GTMS 3HOZI 4S1TA 2B63I 3CCM1 3S1NI 4A93I 3CCRZ 2E2JI 1YI2Z 3GCFA 2H85A 4BY1I 2OOYB 1RLYA 2Q4ZA 3G4SZ 1X3WA 2R92I 3MZKB 4EWCA 1VQM1 3CCMZ 2W04A 1K731 4MONA 1K83I 4A3DI 3CC7Z 2BJOA 4QTUA 3ESWA 2P28A 1VQMZ 3CCE1 1I3QI 4A3CI 3S1MI 2R7ZI 1QVFY 1N2FA 2RBLA 3CXCY 4NH1C 4HGYA 1JJ2Y 1Q862 1NP6A 2QA41 1VQ41 4E2XA 3PO2I 2J6AA 2M48A 3S1QI 3QWUA 3VTNA 3HOXI 5AN9F 2RIQA 3M3YI 1KC82 3HOYI 2QA4Z 3EEDA 2JS4A 1VQ4Z 2Y0SA 2F4MA 2JR6A 3NH4A 1QVGY 4DK1A 1RO4A 3J7A4 5C44I 4A3JI 3U50C 1L1OC 2JA8I 1TWCI 1VQP1 1N8R2 3CPWY 2HF1A 3CMA1 2JUBA 1WW9A 2O53A 3TDHB 1VQ81 1KQSZ 1ML8A 5T67A 3CCU1 5D1OA 1VQPZ 1VLAA 3CMAZ 1ZB8A 2VF1A 4RV9A 1PFTA 2GTIA 2QEX1 4BBSI 5D1PA 1VQ91 1YJW1 1VQ8Z 3CCQ1 3EERA 2HU9A 1X0TA 3HKZA 4NBEA 3BG1B 4E2ZA 1YI21 3VMGA 2VUGA 2QEXZ 3NH5A 3OW2Y 1VQ9Z 1YJWZ 3CCQZ 4MRIA 2E2II 1Z01A 2PK7A 2V8JA 2WB1A 2VUMI 4NBFA 2DE6A 1S7MA 1W2BZ 1QYPA 3JAMb 5IP9I 3CC71 4NB8A 2P3YA 1VQN1 1M901 3J80b 3NDIA 3GKQA 4RVFA 1YJN1 4NB9A 1K732 5C4JI 3G6E1 1SFOI 1I6HI 2QRCB 1Y1WI 3JAMf 2AKLA 1VQNZ 3GTPI 3J80f 1S721 3I4NI 3J81b 1YJNZ 1I50I 1Q7Y1 1Q7Y2 3G6EZ 3IX0A 1RO2A 2JA5I 1YHQ1 4A3FI 4Y7NI 1USPA 3I561 2DE7A 1TWAI 1S72Z 3CCS1 1VQ51 2OTL1 1YHQZ 2OOXB 4A3II 3I56Z 3H3VJ 1QF8A 3TE5B 2PMZA 2NVXI 3P5JB 5LL6f 3KIFA 3CCSZ 3CCL1 2RT9A 1YUKA 1VQ5Z 3HOVI 2OTLZ 2R6MA 3CCJ1 3S16I 4TNUA 2JA6I 2W03A 2V8KA 1YUAA 2Q51A 1VQO1 2JA7I 1VQK1 4MD9A 1K9M1 3LUSA 1Y1VS 3CCLZ 4XX2A 3Q87A 4E2YA 3CCJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9H A;  2G2K A;  1K8B A; 
#chains in the Genus database with same CATH topology
 5F0X A;  2E3G A;  1XRS B;  3GTG I;  1ZVG A;  1JZB A;  1KRL A;  1VQO Z;  1BRZ A;  1VQK Z;  2YIO A;  3VB9 A;  1FH3 A;  2YU9 I;  1BA1 A;  2LEX A;  5AQL A;  1WII A;  1NJI 1;  5BPM A;  4BBR I;  2LN8 A;  4MD7 A;  4HHF A;  4FSV A;  1P00 A;  3F3P C;  2F4O A;  5C4X I;  1I2U A;  4MD8 A;  4RS4 A;  2R93 I;  4CL1 A;  1WCM I;  2QR1 B;  4V1D C;  3KVG A;  2VPY A;  3I4M I;  1RNI A;  2B68 A;  2KBJ A;  1Y1V I;  3GTQ I;  1Z03 A;  3MON A;  2PM9 A;  1KD1 1;  2MN5 A;  2G2K A;  4E31 A;  5BPL A;  3D6W A;  3IF8 A;  5AR0 A;  3S1R I;  1DJT A;  1KQS Y;  3AY9 A;  4NBA A;  1KAZ A;  2VPX A;  3I55 1;  1ZYW A;  2E2H I;  2E8A A;  4A3K I;  5AQI A;  4MH4 A;  5T64 A;  4NBB A;  1ATS A;  1B7D A;  1YIJ Z;  4AB0 A;  2QRD B;  4HGZ A;  1VQ7 1;  1QXF A;  2YAD A;  3IFU A;  4H5R A;  1ZUT A;  3F3F C;  2K3R A;  1JWH C;  3I55 Z;  2NVT I;  4A3E I;  1Q82 1;  1M90 2;  1VNB A;  1WJ2 A;  3LDN A;  1TWH I;  1VQ7 Z;  2GTH A;  3NH8 A;  3E7R L;  2JMO A;  1X3Z A;  4NBG A;  3GKU A;  2JIM A;  1C56 A;  3HOU I;  2LY6 A;  1QQM A;  3CC4 Z;  4BXX I;  2DE5 A;  5AQU A;  1TFI A;  4AEI A;  2OZK A;  2GU2 A;  3CC2 Z;  2JIP A;  2K5R A;  2BUP A;  2KBH A;  3S15 I;  2K35 A;  3FQM A;  3G71 1;  4BY7 I;  2I3C A;  1W2B Y;  1QVF Z;  3GTL I;  2QWQ A;  3D9X A;  3IUC A;  3CXC Z;  5AQJ A;  4QTT A;  3FQQ A;  1JJ2 Z;  3R2V A;  3S14 I;  1RO0 A;  2BRZ A;  1RQF A;  2RHB A;  1Z02 A;  4DQY B;  2LR3 A;  5IT9 b;  5FPD A;  1JZA A;  3PO3 I;  4NBC A;  3GTM I;  1ZB9 A;  1KAX A;  3G71 Z;  2LT8 A;  3CME 1;  4RVG A;  4MXU A;  2O4H A;  2NY9 X;  3LDQ A;  2I61 A;  1P9N A;  3T4N B;  3LDO A;  3VMI A;  3J81 f;  1Q81 1;  1Q81 2;  5AQZ A;  1HX1 A;  1TI5 A;  3FKI I;  2YBR C;  5AQV A;  3H0G I;  1NRA A;  5IT9 f;  1QVG Z;  2A7T A;  4X6A I;  3GTJ I;  2RPR A;  2LKB A;  1GPT A;  2NVY I;  1VQL 1;  3CD6 1;  3FZL A;  5D1O B;  1Q86 1;  1LQH A;  1NGC A;  1C55 A;  1R9T I;  3CME Z;  1ZFU A;  1DL6 A;  1KV0 A;  2IZ4 A;  3S2D I;  1NUI A;  1NRB A;  3CCE Z;  1T0Z A;  2KSK A;  4HE7 A;  1B3C A;  5AQH A;  2LI7 A;  2QKD A;  2EGT A;  1JKZ A;  3KIH A;  4H5W A;  4RVD A;  4A3L I;  3CCV 1;  5AQG A;  3NDJ A;  1BCG A;  1VQL Z;  3CD6 Z;  2YIP A;  3CPW Z;  1KC8 1;  4NFR A;  2JNY A;  1OMY A;  1K9M 2;  4E33 A;  1K8A 1;  1K8A 2;  4A3M I;  1TWG I;  2KGQ A;  1LQL A;  5T6B A;  4E30 A;  4HH4 A;  3I07 A;  2QRE B;  1UGL A;  1T7E A;  5IP7 I;  1YIT 1;  4Y52 I;  1YJ9 1;  2MZ0 A;  3CCV Z;  3S2H I;  4NOZ A;  2QWP A;  2LFU A;  2IZ3 A;  1NJI 2;  2QLV B;  3S17 I;  3GTK I;  3RZD I;  5FLX b;  3FZH A;  3HOW I;  1N8R 1;  2E9H A;  1TWF I;  4RVH A;  2KPI A;  1YIT Z;  5C3E I;  2OTJ 1;  1YJ9 Z;  2SN3 A;  2IV2 X;  2WAQ A;  3FZK A;  2LIY A;  1Y8C A;  3BG0 B;  1YIJ 1;  3ATU A;  3D2L A;  1KD1 2;  1BUP A;  4AYB A;  3OW2 Z;  1VQ6 1;  1SN1 A;  3L4I A;  5FLX f;  3M4O I;  1WZN A;  1AYJ A;  3CQZ I;  3QFP A;  2JDQ D;  2OTJ Z;  3VMH A;  1NGI A;  4A3G I;  2JIR A;  1ZYV A;  1NH5 A;  4E32 A;  3NFZ A;  3K7A I;  1M1K 1;  2NVQ I;  5A2Q b;  1M1K 2;  2LY5 A;  3SF4 D;  3KOZ A;  2V8I A;  5KK4 A;  1I6G A;  5CM2 M;  1SIW A;  4UAD E;  1CN2 A;  1K8B A;  4E2W A;  1VQ6 Z;  1ZH1 A;  2ZAE B;  3CCU Z;  1HJO A;  2KI7 B;  4DGL A;  5FLM I;  3LDP A;  1USP B;  4NBD A;  3CC4 1;  1SEG A;  2V7Z A;  3CCR 1;  1ZVE A;  3M3Z A;  2M6N A;  3RZO I;  1OZZ A;  5F1X A;  3CC2 1;  1Q82 2;  3CW4 A;  3L56 A;  2YIL A;  4NBH A;  3KC6 A;  3MZL B;  3GTO I;  5A2Q f;  1SNB A;  1KAY A;  3PO3 S;  3G4S 1;  4A3B I;  2KJA A;  3GTM S;  3KP1 A;  3HOZ I;  1WMT A;  4S1T A;  2B63 I;  3CCM 1;  3S1N I;  4A93 I;  3CCR Z;  2E2J I;  5EX5 A;  4CQK A;  2E7Z A;  1YI2 Z;  1PX9 A;  3GCF A;  1PTX A;  5AQQ A;  2H85 A;  4BY1 I;  2OOY B;  1RLY A;  3QFU A;  2Q4Z A;  3G4S Z;  1X3W A;  5AQN A;  3L6Q A;  2R92 I;  3MZK B;  4EWC A;  5CY0 A;  1VQM 1;  2GMO A;  1NGF A;  3CCM Z;  2W04 A;  2N2Q A;  3ATV A;  2V45 A;  1K73 1;  4MON A;  2KYQ A;  1DQ7 A;  5AQT A;  1T7B A;  1K83 I;  3FZF A;  4A3D I;  3CC7 Z;  1LQQ A;  5AQO A;  2BJO A;  4QTU A;  3ESW A;  2P28 A;  1NGD A;  1VQM Z;  3D2F B;  2E0H A;  3CCE 1;  2N2R A;  1I3Q I;  1NGG A;  1HPM A;  2LJ7 A;  5AQY A;  4A3C I;  2YEO A;  3S1M I;  1P0A A;  2R7Z I;  1QVF Y;  3GL1 A;  1N2F A;  2RBL A;  3CXC Y;  4NH1 C;  1AHO A;  4HGY A;  2QWR A;  1JJ2 Y;  1Q86 2;  2QWL A;  4KBO A;  1NP6 A;  2QA4 1;  1Q16 A;  1DKG D;  1VQ4 1;  4E2X A;  3PO2 I;  1I6F A;  2J6A A;  2M48 A;  3S1Q I;  4H5V A;  3GDQ A;  1T7A A;  3QWU A;  3HSC A;  2B3C A;  3VTN A;  3HOX I;  5AN9 F;  2RIQ A;  3M3Y I;  3KOY A;  3JXU A;  1KC8 2;  3HOY I;  2QA4 Z;  5FPM A;  2M8B B;  4GNI A;  1BMR A;  3EED A;  2JS4 A;  1VQ4 Z;  2Y0S A;  2F4M A;  3D2E B;  2JR6 A;  3NH4 A;  1QVG Y;  1S3X A;  1NGE A;  2KPY A;  1YUW A;  4DK1 A;  1RO4 A;  3J7A 4;  5AQF A;  5BPN A;  1NPI A;  5C44 I;  2E2F A;  5AQM A;  4H5T A;  1MR4 A;  4A3J I;  3C7N B;  3QML A;  1L4V A;  3U50 C;  5F2R A;  5EXW A;  1L1O C;  2JA8 I;  1TWC I;  1VQP 1;  2KBK A;  1N8R 2;  3CPW Y;  4FL9 A;  4UJ0 A;  1NGH A;  2HF1 A;  3IR7 A;  3CMA 1;  1BA0 A;  2JUB A;  3D2F A;  1WW9 A;  2E88 A;  1BK8 A;  1GPS A;  2QWM A;  2O53 A;  3TDH B;  1VQ8 1;  4UAF E;  1KQS Z;  1CHZ A;  1ML8 A;  2NY8 X;  4UAE F;  5T67 A;  3CCU 1;  2LJM A;  5D1O A;  5AQK A;  1VQP Z;  2VPW A;  2AYD A;  2KHO A;  4AAZ A;  1VLA A;  3PSM A;  3CMA Z;  5BN9 A;  1ZB8 A;  2VF1 A;  4RV9 A;  1PFT A;  2GTI A;  2QEX 1;  1WT7 A;  4BBS I;  5D1P A;  1VQ9 1;  1YJW 1;  1VQ8 Z;  5AQW A;  3CCQ 1;  3EER A;  2HU9 A;  5FPN A;  1X0T A;  5FPE A;  2JIQ A;  3HKZ A;  5AQR A;  2VY6 A;  4NBE A;  2GL1 A;  3BG1 B;  4E2Z A;  1YI2 1;  3VMG A;  1N4N A;  2VUG A;  3D2E A;  4IO8 A;  2QEX Z;  3NH5 A;  3OW2 Y;  2NAP A;  1VQ9 Z;  1YJW Z;  3CCQ Z;  4MRI A;  2MBK A;  1JXC A;  2E2I I;  1Z01 A;  1ICA A;  1SN4 A;  1T1T A;  2PK7 A;  2V8J A;  2WB1 A;  2VUM I;  1MYN A;  2D56 A;  3KP0 A;  3C7N A;  4NBF A;  1POI A;  3I33 A;  2DE6 A;  1S7M A;  1W2B Z;  1PE4 A;  1QYP A;  1NGB A;  3JAM b;  5IP9 I;  2YC1 C;  3CC7 1;  4NB8 A;  2P3Y A;  2QWO A;  5AQS A;  1VQN 1;  1M90 1;  2N69 A;  3J80 b;  2QWN A;  3NDI A;  3GKQ A;  4RVF A;  1WWN A;  1QQN A;  1YJN 1;  4NB9 A;  1K73 2;  1VNA A;  5C4J I;  3G6E 1;  1SFO I;  2VPZ A;  3BK3 C;  1I6H I;  2QRC B;  1AA6 A;  1Y1W I;  3JAM f;  2AKL A;  1VQN Z;  3LDL A;  1NGA A;  3GTP I;  5BN8 A;  3A8Y A;  3J80 f;  1S72 1;  3I4N I;  3J81 b;  3E7U X;  1YJN Z;  4H5N A;  5EY4 A;  1I50 I;  1Q7Y 1;  1Q7Y 2;  3G6E Z;  2ASC A;  3IX0 A;  4HWI A;  1RO2 A;  2JA5 I;  1YHQ 1;  4A3F I;  3KHW A;  4Y7N I;  2QW9 A;  1USP A;  3I56 1;  2QXL A;  5AQP A;  2DE7 A;  2V3V A;  1TWA I;  1S72 Z;  1ATR A;  2ATB A;  3CCS 1;  1FDI A;  2JIO A;  2N66 A;  1VQ5 1;  2OTL 1;  1NGJ A;  1YHQ Z;  2OOX B;  3KOW A;  1I2V A;  4A3I I;  3I56 Z;  3H3V J;  1QF8 A;  3QI7 A;  3TE5 B;  2PMZ A;  2NVX I;  5EVZ A;  1FDO A;  3P5J B;  3KOX A;  5LL6 f;  3KIF A;  3CCS Z;  3CCL 1;  2RT9 A;  1YUK A;  1VQ5 Z;  1QQO A;  4KYP A;  3HOV I;  2OTL Z;  2R6M A;  3CCJ 1;  5AQX A;  3FZM A;  3S16 I;  4TNU A;  1LQI A;  2JA6 I;  2W03 A;  2V8K A;  1YUA A;  2E3F A;  2Q51 A;  1VQO 1;  2JA7 I;  1VQK 1;  3FE1 A;  1NE5 A;  4MD9 A;  1K9M 1;  3LUS A;  1ZU3 A;  1Y1V S;  3CCL Z;  4XX2 A;  3Q87 A;  3CQX A;  4E2Y A;  3CCJ Z; 
#chains in the Genus database with same CATH homology
 3GTG I;  1KRL A;  1VQO Z;  1VQK Z;  3VB9 A;  2YU9 I;  1WII A;  1NJI 1;  4BBR I;  4MD7 A;  3F3P C;  2F4O A;  5C4X I;  4MD8 A;  4RS4 A;  2R93 I;  4CL1 A;  1WCM I;  2QR1 B;  3I4M I;  1RNI A;  1Y1V I;  3GTQ I;  1Z03 A;  3MON A;  2PM9 A;  1KD1 1;  2G2K A;  4E31 A;  3D6W A;  3IF8 A;  3S1R I;  1KQS Y;  4NBA A;  3I55 1;  2E2H I;  4A3K I;  4MH4 A;  5T64 A;  4NBB A;  1YIJ Z;  2QRD B;  4HGZ A;  1VQ7 1;  2YAD A;  3IFU A;  3F3F C;  2K3R A;  1JWH C;  3I55 Z;  2NVT I;  4A3E I;  1Q82 1;  1M90 2;  1TWH I;  1VQ7 Z;  2GTH A;  3NH8 A;  2JMO A;  1X3Z A;  4NBG A;  3HOU I;  3CC4 Z;  4BXX I;  2DE5 A;  1TFI A;  2OZK A;  2GU2 A;  3CC2 Z;  2K5R A;  3S15 I;  3FQM A;  3G71 1;  4BY7 I;  2I3C A;  1W2B Y;  1QVF Z;  3GTL I;  3D9X A;  3CXC Z;  4QTT A;  3FQQ A;  1JJ2 Z;  3S14 I;  1RO0 A;  1RQF A;  2RHB A;  1Z02 A;  4DQY B;  5IT9 b;  3PO3 I;  4NBC A;  3GTM I;  1ZB9 A;  3G71 Z;  3CME 1;  4RVG A;  4MXU A;  2O4H A;  1P9N A;  3T4N B;  3VMI A;  3J81 f;  1Q81 1;  1Q81 2;  3FKI I;  3H0G I;  5IT9 f;  1QVG Z;  4X6A I;  3GTJ I;  2RPR A;  2NVY I;  1VQL 1;  3CD6 1;  5D1O B;  1Q86 1;  1R9T I;  3CME Z;  1DL6 A;  2IZ4 A;  3S2D I;  1NUI A;  3CCE Z;  2QKD A;  2EGT A;  3KIH A;  4RVD A;  4A3L I;  3CCV 1;  3NDJ A;  1VQL Z;  3CD6 Z;  3CPW Z;  1KC8 1;  4NFR A;  2JNY A;  1K9M 2;  4E33 A;  1K8A 1;  1K8A 2;  4A3M I;  1TWG I;  1LQL A;  5T6B A;  4E30 A;  4HH4 A;  3I07 A;  2QRE B;  5IP7 I;  1YIT 1;  4Y52 I;  1YJ9 1;  3CCV Z;  3S2H I;  4NOZ A;  2LFU A;  2IZ3 A;  1NJI 2;  2QLV B;  3S17 I;  3GTK I;  3RZD I;  5FLX b;  3HOW I;  1N8R 1;  2E9H A;  1TWF I;  4RVH A;  2KPI A;  1YIT Z;  5C3E I;  2OTJ 1;  1YJ9 Z;  2WAQ A;  2LIY A;  1YIJ 1;  3BG0 B;  1KD1 2;  4AYB A;  3OW2 Z;  1VQ6 1;  5FLX f;  3M4O I;  3CQZ I;  2OTJ Z;  3VMH A;  4A3G I;  4E32 A;  3NFZ A;  3K7A I;  1M1K 1;  2NVQ I;  5A2Q b;  1M1K 2;  2V8I A;  5CM2 M;  1K8B A;  4E2W A;  1VQ6 Z;  1ZH1 A;  2ZAE B;  3CCU Z;  2KI7 B;  4DGL A;  5FLM I;  1USP B;  4NBD A;  3CC4 1;  3CCR 1;  2M6N A;  3RZO I;  3CC2 1;  1Q82 2;  4NBH A;  3MZL B;  3GTO I;  5A2Q f;  3PO3 S;  3G4S 1;  4A3B I;  3GTM S;  3HOZ I;  4S1T A;  2B63 I;  3CCM 1;  3S1N I;  4A93 I;  3CCR Z;  2E2J I;  1YI2 Z;  3GCF A;  2H85 A;  4BY1 I;  2OOY B;  1RLY A;  2Q4Z A;  3G4S Z;  1X3W A;  2R92 I;  3MZK B;  4EWC A;  1VQM 1;  3CCM Z;  2W04 A;  1K73 1;  4MON A;  1K83 I;  4A3D I;  3CC7 Z;  2BJO A;  4QTU A;  3ESW A;  2P28 A;  1VQM Z;  3CCE 1;  1I3Q I;  4A3C I;  3S1M I;  2R7Z I;  1QVF Y;  1N2F A;  2RBL A;  3CXC Y;  4NH1 C;  4HGY A;  1JJ2 Y;  1Q86 2;  1NP6 A;  2QA4 1;  1VQ4 1;  4E2X A;  3PO2 I;  2J6A A;  2M48 A;  3S1Q I;  3QWU A;  3VTN A;  3HOX I;  5AN9 F;  2RIQ A;  3M3Y I;  1KC8 2;  3HOY I;  2QA4 Z;  3EED A;  2JS4 A;  1VQ4 Z;  2Y0S A;  2F4M A;  2JR6 A;  3NH4 A;  1QVG Y;  4DK1 A;  1RO4 A;  3J7A 4;  5C44 I;  4A3J I;  3U50 C;  1L1O C;  2JA8 I;  1TWC I;  1VQP 1;  1N8R 2;  3CPW Y;  2HF1 A;  3CMA 1;  2JUB A;  1WW9 A;  2O53 A;  3TDH B;  1VQ8 1;  1KQS Z;  1ML8 A;  5T67 A;  3CCU 1;  5D1O A;  1VQP Z;  1VLA A;  3CMA Z;  1ZB8 A;  2VF1 A;  4RV9 A;  1PFT A;  2GTI A;  2QEX 1;  4BBS I;  5D1P A;  1VQ9 1;  1YJW 1;  1VQ8 Z;  3CCQ 1;  3EER A;  2HU9 A;  1X0T A;  3HKZ A;  4NBE A;  3BG1 B;  4E2Z A;  1YI2 1;  3VMG A;  2VUG A;  2QEX Z;  3NH5 A;  3OW2 Y;  1VQ9 Z;  1YJW Z;  3CCQ Z;  4MRI A;  2E2I I;  1Z01 A;  2PK7 A;  2V8J A;  2WB1 A;  2VUM I;  4NBF A;  2DE6 A;  1S7M A;  1W2B Z;  1QYP A;  3JAM b;  5IP9 I;  3CC7 1;  4NB8 A;  2P3Y A;  1VQN 1;  1M90 1;  3J80 b;  3NDI A;  3GKQ A;  4RVF A;  1YJN 1;  4NB9 A;  1K73 2;  5C4J I;  3G6E 1;  1SFO I;  1I6H I;  2QRC B;  1Y1W I;  3JAM f;  2AKL A;  1VQN Z;  3GTP I;  3J80 f;  1S72 1;  3I4N I;  3J81 b;  1YJN Z;  1I50 I;  1Q7Y 1;  1Q7Y 2;  3G6E Z;  3IX0 A;  1RO2 A;  2JA5 I;  1YHQ 1;  4A3F I;  4Y7N I;  1USP A;  3I56 1;  2DE7 A;  1TWA I;  1S72 Z;  3CCS 1;  1VQ5 1;  2OTL 1;  1YHQ Z;  2OOX B;  4A3I I;  3I56 Z;  3H3V J;  1QF8 A;  3TE5 B;  2PMZ A;  2NVX I;  3P5J B;  5LL6 f;  3KIF A;  3CCS Z;  3CCL 1;  2RT9 A;  1YUK A;  1VQ5 Z;  3HOV I;  2OTL Z;  2R6M A;  3CCJ 1;  3S16 I;  4TNU A;  2JA6 I;  2W03 A;  2V8K A;  1YUA A;  2Q51 A;  1VQO 1;  2JA7 I;  1VQK 1;  4MD9 A;  1K9M 1;  3LUS A;  1Y1V S;  3CCL Z;  4XX2 A;  3Q87 A;  4E2Y A;  3CCJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...