2G2KA

Nmr structure of an n-terminal fragment of the eukaryotic initiation factor 5 (eif5)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
156
structure length
156
Chain Sequence
b'LSVNVNRSVMDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5
publication title Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 18
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2g2kA02
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 2g2kA01
2G2KA 1K8BA 2E9HA
chains in the Genus database with same CATH superfamily
1W2BZ 1JJ2Y 5F1XA 2QA4Z 3BG1B 1VQN1 5AQXA 4RVGA 1RO2A 3S14I 2V7ZA 4H5WA 1WIIA 3GTMS 3H0GI 1Q7Y2 3CCS1 4CQKA 4DGLA 1NP6A 3CPWZ 5EX5A 1YHQ1 3HOZI 3J81f 3SF4D 3QI7A 4NB9A 4NFRA 4E2WA 1NGBA 1VQM1 4E33A 2QWPA 4A3BI 2EGTA 2QRCB 4FSVA 2OTL1 1NGGA 3NH8A 3HOUI 4MXUA 1CN2A 3J81b 3CCSZ 1VQ81 2ATBA 4XX2A 5D1OA 2V8KA 4BBSI 2LFUA 3C7NA 3OW2Y 2JDQD 1VQ61 1QVFY 1AHOA 3JAMf 2OTLZ 3ATUA 1NGDA 3CCR1 3Q87A 4NBGA 3CC71 4A3DI 3KP1A 1TWFI 1VQ8Z 3I55Z 2KYQA 3JAMb 3GKUA 2GU2A 2MZ0A 1VQ9Z 1YJWZ 2JNYA 1RLYA 1QF8A 1YUWA 2QREB 3NH4A 2QLVB 3ESWA 4E31A 3S1MI 1WW9A 5AQKA 3K7AI 1JZAA 4QTTA 3CME1 2E8AA 1X3ZA 2KSKA 4IO8A 4KYPA 4AEIA 3S16I 3RZOI 2N2QA 3HOYI 1VQ5Z 5CY0A 1NGCA 2AKLA 1VQ71 1QQOA 5AQJA 4A3MI 2YC1C 1S3XA 1Q16A 3G71Z 1Q821 1Q7Y1 1KD11 3CCV1 1N8R2 2QWLA 4BBRI 2BRZA 5IP7I 1NJI1 3CMEZ 2RBLA 2R93I 2OTJ1 5EXWA 1VQ7Z 1POIA 5C4XI 2JMOA 3GKQA 3CMA1 1WCMI 1RO4A 2BJOA 2QR1B 3CCVZ 1PX9A 1LQLA 4A3EI 1Z02A 2OTJZ 1ZU3A 2LKBA 3H3VJ 1BA1A 2LEXA 2RPRA 2JS4A 2NVTI 1I6FA 1PFTA 3FQMA 1Y1VS 4RVDA 3CMAZ 2D56A 1VQL1 5FPEA 2JIPA 2P28A 1KQSY 2KGQA 3CC41 2M48A 4E32A 2IZ3A 1WZNA 1KRLA 1BK8A 3J80f 3FKII 2V45A 2N66A 4DK1A 3G6EZ 3EEDA 5AR0A 4AYBA 2KBKA 3ATVA 1VQLZ 3LDPA 1RNIA 3J80b 1K8BA 5AQUA 3CD61 3GTOI 1BUPA 3RZDI 4E2ZA 1T7BA 5AQOA 2N69A 5C3EI 2V8JA 4A3II 3CC21 4AB0A 3S2HI 3PSMA 3I4NI 4A3CI 2VUMI 5FPNA 5IT9b 2QA41 4TNUA 1Q862 2PMZA 1N2FA 1QVGZ 2W03A 1K9M2 3CC2Z 5KK4A 2DE7A 5AQVA 1TWCI 2LR3A 1ZVEA 4NBEA 3GTLI 3CXCZ 2RT9A 2V8IA 2VY6A 2JR6A 2E9HA 1QQNA 5EVZA 3CW4A 3QFUA 4E30A 3IFUA 5C4JI 2E0HA 2HU9A 2ASCA 2QWQA 3CCLZ 1KAZA 2JIOA 1K731 1BA0A 3S15I 1KC82 5AQNA 2NVXI 3GL1A 1LQQA 5BN8A 2O53A 4EWCA 4MH4A 2HF1A 2M6NA 2Q51A 1VQPZ 5D1PA 2B63I 5AQMA 3HKZA 1X3WA 5FPDA 2BUPA 1GPTA 2OOYB 3NFZA 2GTIA 5FLMI 3CCJZ 1YUKA 5D1OB 1P00A 4MRIA 1QYPA 3LDNA 1B3CA 2QWRA 3KHWA 1L4VA 3I551 3S1NI 3MZLB 3CCEZ 1W2BY 1NRBA 1VQ91 3CQZI 3HOXI 1YJW1 1K8A2 2LN8A 5AQHA 3D2LA 3U50C 1QXFA 1Z01A 5IP9I 2NY8X 1ATRA 3TE5B 5FPMA 1ZB9A 1AA6A 3CPWY 1FH3A 5T64A 1KAXA 3CCUZ 4NBDA 4Y7NI 2K3RA 3MZKB 1JWHC 3HOWI 1VQ51 2JIQA 3VB9A 3VMGA 5CM2M 4BXXI 1JXCA 1VNBA 1SNBA 1WJ2A 3BK3C 3G711 2K35A 4HH4A 2JA5I 2YIPA 1ZYWA 1B7DA 4NBCA 3D9XA 1TI5A 3I07A 1YJ9Z 1YI2Z 2K5RA 1HPMA 1ZYVA 5AQIA 4NH1C 3HSCA 3LDLA 1M1K2 1I6GA 1I2VA 2KPIA 4A93I 1NGFA 2DE5A 3CCM1 1NGJA 3BG0B 1C55A 3KOZA 2OZKA 4A3JI 1K83I 5AQWA 2R92I 1Z03A 3S2DI 1SN1A 3LDQA 2GL1A 4V1DC 1I50I 2WAQA 5AQLA 1NGEA 3M3YI 1UGLA 1S721 1ZUTA 2YADA 5T67A 3P5JB 5F2RA 1VQKZ 3CCMZ 3M4OI 1K8A1 3LDOA 4AAZA 4RVFA 3D2EA 3E7RL 3GTPI 1VQO1 2IV2X 3G6E1 3FQQA 2JA7I 2NVQI 2P3YA 1NGHA 3MONA 1ZVGA 3S1QI 1SFOI 2E2FA 4A3KI 1S72Z 4KBOA 2SN3A 4E2XA 4S1TA 2QEX1 2E88A 1ICAA 2E3GA 1VQOZ 1DKGD 2QWOA 4H5RA 4H5VA 2J6AA 3GDQA 3KOWA 3GTKI 5BN9A 2RHBA 1MR4A 1YITZ 4HHFA 3G4SZ 1P0AA 2PK7A 4A3LI 2KBHA 2YEOA 4RV9A 3NH5A 2QEXZ 2E3FA 3PO3I 1I2UA 1YUAA 4HGYA 4MONA 4NBHA 1N4NA 1N8R1 3I4MI 5LL6f 3IUCA 3KOXA 4NOZA 2LY6A 3R2VA 1MYNA 4H5NA 1T7AA 4NBFA 2A7TA 2LJMA 2LJ7A 1GPSA 3D2FA 3CCL1 3GCFA 1OZZA 4HWIA 1Q812 4NBBA 2KJAA 2E2II 1T0ZA 3QWUA 2AYDA 4NBAA 1FDOA 2YU9I 1VQ41 4A3GI 1JJ2Z 3NDJA 1VQP1 1TWAI 2WB1A 3CCQZ 4A3FI 5AQGA 4DQYB 3QFPA 2QKDA 3FZMA 1USPA 3CCJ1 2JA8I 3CQXA 2E2HI 3VMHA 1RQFA 3L4IA 4CL1A 1VQ4Z 3CCE1 2M8BB 1WT7A 2VPZA 5AQPA 1WWNA 1ZH1A 3KOYA 3L6QA 1QVGY 4H5TA 2F4OA 5F0XA 3GTMI 2VUGA 2F4MA 5AQFA 3TDHB 2PM9A 1XRSB 3C7NB 3FZHA 3CCU1 1LQIA 1YJNZ 1VNAA 3CXCY 3OW2Z 4BY7I 1QVFZ 2I61A 1Q822 1NRAA 2E7ZA 1YIJZ 1KD12 1BCGA 1FDIA 3KIHA 3AY9A 1T1TA 1NJI2 3S17I 2GTHA 1Y8CA 1SEGA 2LI7A 1R9TI 4X6AI 3GTGI 1VQNZ 3M3ZA 4RS4A 1Q861 2JUBA 1YJ91 1YI21 4QTUA 3E7UX 4GNIA 4BY1I 1K9M1 1Q811 5BPMA 1TWGI 2NVYI 1YHQZ 2VPXA 2QWMA 2R7ZI 2JIMA 3KP0A 1VQMZ 1BMRA 2I3CA 5C44I 1T7EA 1L1OC 1M902 3J7A4 1AYJA 2YIOA 2VPYA 2DE6A 5FLXf 4UAFE 2B3CA 3VTNA 1NGAA 1KC81 2R6MA 1VQ6Z 1HJOA 4UADE 3IF8A 1VLAA 5BPLA 1CHZA 1VQK1 3A8YA 1QQMA 2QXLA 5FLXb 2IZ4A 4MD9A 3CCRZ 2VF1A 2G2KA 4UAEF 2O4HA 3CC7Z 2E2JI 1C56A 3D2EB 2OOXB 3I561 1TFIA 4MD8A 5T6BA 2QWNA 3D6WA 3NDIA 1ZB8A 1ZFUA 1HX1A 3FZLA 1Y1WI 1SIWA 1DJTA 5AQTA 1JKZA 2LT8A 3GTJI 4E2YA 2LY5A 1BRZA 2MN5A 5EY4A 2JIRA 1KQSZ 3QMLA 4HGZA 3T4NB 1RO0A 1YIT1 1JZBA 3IR7A 3G4S1 3I56Z 1NH5A 1KV0A 3FZFA 2MBKA 1DL6A 2KBJA 3VMIA 2N2RA 2RIQA 1Y1VI 2ZAEB 3KIFA 1P9NA 2NY9X 3S1RI 3KVGA 3F3PC 3LUSA 4RVHA 1DQ7A 5BPNA 5AQYA 2QW9A 5AQRA 5AQZA 5A2Qf 1K732 1M901 2V3VA 1ML8A 1KAYA 1M1K1 5A2Qb 2KHOA 5AQQA 3HOVI 3I33A 2NAPA 2YILA 3D2FB 3PO3S 3IX0A 2W04A 3CCQ1 2JA6I 2GMOA 1PE4A 2KPYA 2Y0SA 1LQHA 1I3QI 3CC4Z 3KC6A 1OMYA 1ATSA 1PTXA 3L56A 1NUIA 1USPB 1I6HI 5IT9f 1S7MA 1NPIA 3PO2I 4FL9A 4MD7A 2H85A 2KI7B 1TWHI 3CD6Z 2VPWA 2YBRC 2Q4ZA 3EERA 1YJN1 4Y52I 1NE5A 1SN4A 3FZKA 4UJ0A 1NGIA 2LIYA 3FE1A 3F3FC 5AN9F 1X0TA 1YIJ1 5AQSA 4HE7A 4NB8A 2QRDB 3GTQI 2B68A 1WMTA 3JXUA
chains in the Genus database with same CATH topology
1W2BZ 1JJ2Y 2QA4Z 3BG1B 1VQN1 4RVGA 1RO2A 3S14I 1WIIA 3GTMS 3H0GI 1Q7Y2 3CCS1 4DGLA 1NP6A 3CPWZ 1YHQ1 3HOZI 3J81f 4NB9A 4NFRA 4E2WA 1VQM1 4E33A 4A3BI 2EGTA 2QRCB 2OTL1 3NH8A 3HOUI 4MXUA 3J81b 3CCSZ 1VQ81 4XX2A 5D1OA 2V8KA 4BBSI 2LFUA 3OW2Y 1VQ61 1QVFY 3JAMf 2OTLZ 3CCR1 3Q87A 4NBGA 3CC71 4A3DI 1TWFI 1VQ8Z 3I55Z 3JAMb 2GU2A 1VQ9Z 1YJWZ 2JNYA 1RLYA 1QF8A 2QREB 3NH4A 2QLVB 3ESWA 4E31A 3S1MI 1WW9A 3K7AI 4QTTA 3CME1 1X3ZA 3S16I 3RZOI 3HOYI 1VQ5Z 2AKLA 1VQ71 4A3MI 3G71Z 1Q821 1Q7Y1 1KD11 3CCV1 1N8R2 4BBRI 5IP7I 1NJI1 3CMEZ 2RBLA 2R93I 2OTJ1 1VQ7Z 5C4XI 2JMOA 3GKQA 3CMA1 1WCMI 1RO4A 2BJOA 2QR1B 3CCVZ 1LQLA 4A3EI 1Z02A 2OTJZ 3H3VJ 2RPRA 2JS4A 2NVTI 1PFTA 3FQMA 1Y1VS 4RVDA 3CMAZ 1VQL1 2P28A 1KQSY 3CC41 2M48A 4E32A 2IZ3A 1KRLA 3J80f 3FKII 4DK1A 3G6EZ 3EEDA 4AYBA 1VQLZ 1RNIA 3J80b 1K8BA 3CD61 3GTOI 3RZDI 4E2ZA 5C3EI 2V8JA 4A3II 3CC21 3S2HI 3I4NI 4A3CI 2VUMI 5IT9b 2QA41 4TNUA 1Q862 2PMZA 1N2FA 1QVGZ 2W03A 1K9M2 3CC2Z 2DE7A 1TWCI 4NBEA 3GTLI 3CXCZ 2RT9A 2V8IA 2JR6A 2E9HA 4E30A 3IFUA 5C4JI 2HU9A 3CCLZ 1K731 3S15I 1KC82 2NVXI 2O53A 4EWCA 4MH4A 2HF1A 2M6NA 2Q51A 1VQPZ 5D1PA 2B63I 3HKZA 1X3WA 2OOYB 3NFZA 2GTIA 5FLMI 3CCJZ 1YUKA 5D1OB 4MRIA 1QYPA 3I551 3S1NI 3MZLB 3CCEZ 1W2BY 1VQ91 3CQZI 3HOXI 1YJW1 1K8A2 3U50C 1Z01A 5IP9I 3TE5B 1ZB9A 3CPWY 5T64A 3CCUZ 4NBDA 4Y7NI 2K3RA 3MZKB 1JWHC 3HOWI 1VQ51 3VMGA 3VB9A 5CM2M 4BXXI 3G711 4HH4A 2JA5I 4NBCA 3D9XA 3I07A 1YJ9Z 1YI2Z 2K5RA 4NH1C 1M1K2 2KPIA 4A93I 2DE5A 3CCM1 3BG0B 2OZKA 4A3JI 1K83I 2R92I 1Z03A 3S2DI 1I50I 2WAQA 3M3YI 1S721 2YADA 5T67A 3P5JB 1VQKZ 3CCMZ 3M4OI 1K8A1 4RVFA 3GTPI 1VQO1 3G6E1 3FQQA 2JA7I 2NVQI 2P3YA 3MONA 3S1QI 1SFOI 4A3KI 1S72Z 4E2XA 4S1TA 2QEX1 1VQOZ 2J6AA 3GTKI 2RHBA 1YITZ 3G4SZ 2PK7A 4A3LI 4RV9A 3NH5A 2QEXZ 3PO3I 1YUAA 4HGYA 4MONA 4NBHA 1N8R1 3I4MI 5LL6f 4NOZA 4NBFA 3CCL1 3GCFA 1Q812 4NBBA 2E2II 3QWUA 4NBAA 2YU9I 1VQ41 4A3GI 1JJ2Z 3NDJA 1VQP1 1TWAI 2WB1A 3CCQZ 4A3FI 4DQYB 2QKDA 1USPA 3CCJ1 2JA8I 2E2HI 3VMHA 1RQFA 4CL1A 1VQ4Z 3CCE1 1ZH1A 1QVGY 2F4OA 3GTMI 2VUGA 2F4MA 3TDHB 2PM9A 3CCU1 1YJNZ 3CXCY 3OW2Z 4BY7I 1QVFZ 1Q822 1YIJZ 1KD12 3KIHA 1NJI2 3S17I 2GTHA 1R9TI 4X6AI 3GTGI 1VQNZ 4RS4A 1Q861 2JUBA 1YJ91 1YI21 4QTUA 4BY1I 1K9M1 1Q811 1TWGI 2NVYI 1YHQZ 2R7ZI 1VQMZ 2I3CA 5C44I 1L1OC 1M902 3J7A4 2DE6A 5FLXf 3VTNA 1KC81 2R6MA 1VQ6Z 3IF8A 1VLAA 1VQK1 5FLXb 2IZ4A 4MD9A 3CCRZ 2VF1A 2G2KA 2O4HA 3CC7Z 2E2JI 2OOXB 3I561 1TFIA 4MD8A 5T6BA 3D6WA 3NDIA 1ZB8A 1Y1WI 3GTJI 4E2YA 1KQSZ 4HGZA 3T4NB 1RO0A 1YIT1 3G4S1 3I56Z 1DL6A 3VMIA 2RIQA 1Y1VI 2ZAEB 3KIFA 1P9NA 3S1RI 3F3PC 3LUSA 4RVHA 5A2Qf 1K732 1M901 1ML8A 1M1K1 5A2Qb 3HOVI 3PO3S 3IX0A 2W04A 3CCQ1 2JA6I 2Y0SA 1I3QI 3CC4Z 1NUIA 1USPB 1I6HI 5IT9f 1S7MA 3PO2I 4MD7A 2H85A 2KI7B 1TWHI 3CD6Z 2Q4ZA 3EERA 1YJN1 4Y52I 2LIYA 3F3FC 5AN9F 1X0TA 1YIJ1 4NB8A 2QRDB 3GTQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2K A;  1K8B A;  2E9H A; 
#chains in the Genus database with same CATH topology
 1W2B Z;  1JJ2 Y;  5F1X A;  2QA4 Z;  3BG1 B;  1VQN 1;  5AQX A;  4RVG A;  1RO2 A;  3S14 I;  2V7Z A;  4H5W A;  1WII A;  3GTM S;  3H0G I;  1Q7Y 2;  3CCS 1;  4CQK A;  4DGL A;  1NP6 A;  3CPW Z;  5EX5 A;  1YHQ 1;  3HOZ I;  3J81 f;  3SF4 D;  3QI7 A;  4NB9 A;  4NFR A;  4E2W A;  1NGB A;  1VQM 1;  4E33 A;  2QWP A;  4A3B I;  2EGT A;  2QRC B;  4FSV A;  2OTL 1;  1NGG A;  3NH8 A;  3HOU I;  4MXU A;  1CN2 A;  3J81 b;  3CCS Z;  1VQ8 1;  2ATB A;  4XX2 A;  5D1O A;  2V8K A;  4BBS I;  2LFU A;  3C7N A;  3OW2 Y;  2JDQ D;  1VQ6 1;  1QVF Y;  1AHO A;  3JAM f;  2OTL Z;  3ATU A;  1NGD A;  3CCR 1;  3Q87 A;  4NBG A;  3CC7 1;  4A3D I;  3KP1 A;  1TWF I;  1VQ8 Z;  3I55 Z;  2KYQ A;  3JAM b;  3GKU A;  2GU2 A;  2MZ0 A;  1VQ9 Z;  1YJW Z;  2JNY A;  1RLY A;  1QF8 A;  1YUW A;  2QRE B;  3NH4 A;  2QLV B;  3ESW A;  4E31 A;  3S1M I;  1WW9 A;  5AQK A;  3K7A I;  1JZA A;  4QTT A;  3CME 1;  2E8A A;  1X3Z A;  2KSK A;  4IO8 A;  4KYP A;  4AEI A;  3S16 I;  3RZO I;  2N2Q A;  3HOY I;  1VQ5 Z;  5CY0 A;  1NGC A;  2AKL A;  1VQ7 1;  1QQO A;  5AQJ A;  4A3M I;  2YC1 C;  1S3X A;  1Q16 A;  3G71 Z;  1Q82 1;  1Q7Y 1;  1KD1 1;  3CCV 1;  1N8R 2;  2QWL A;  4BBR I;  2BRZ A;  5IP7 I;  1NJI 1;  3CME Z;  2RBL A;  2R93 I;  2OTJ 1;  5EXW A;  1VQ7 Z;  1POI A;  5C4X I;  2JMO A;  3GKQ A;  3CMA 1;  1WCM I;  1RO4 A;  2BJO A;  2QR1 B;  3CCV Z;  1PX9 A;  1LQL A;  4A3E I;  1Z02 A;  2OTJ Z;  1ZU3 A;  2LKB A;  3H3V J;  1BA1 A;  2LEX A;  2RPR A;  2JS4 A;  2NVT I;  1I6F A;  1PFT A;  3FQM A;  1Y1V S;  4RVD A;  3CMA Z;  2D56 A;  1VQL 1;  5FPE A;  2JIP A;  2P28 A;  1KQS Y;  2KGQ A;  3CC4 1;  2M48 A;  4E32 A;  2IZ3 A;  1WZN A;  1KRL A;  1BK8 A;  3J80 f;  3FKI I;  2V45 A;  2N66 A;  4DK1 A;  3G6E Z;  3EED A;  5AR0 A;  4AYB A;  2KBK A;  3ATV A;  1VQL Z;  3LDP A;  1RNI A;  3J80 b;  1K8B A;  5AQU A;  3CD6 1;  3GTO I;  1BUP A;  3RZD I;  4E2Z A;  1T7B A;  5AQO A;  2N69 A;  5C3E I;  2V8J A;  4A3I I;  3CC2 1;  4AB0 A;  3S2H I;  3PSM A;  3I4N I;  4A3C I;  2VUM I;  5FPN A;  5IT9 b;  2QA4 1;  4TNU A;  1Q86 2;  2PMZ A;  1N2F A;  1QVG Z;  2W03 A;  1K9M 2;  3CC2 Z;  5KK4 A;  2DE7 A;  5AQV A;  1TWC I;  2LR3 A;  1ZVE A;  4NBE A;  3GTL I;  3CXC Z;  2RT9 A;  2V8I A;  2VY6 A;  2JR6 A;  2E9H A;  1QQN A;  5EVZ A;  3CW4 A;  3QFU A;  4E30 A;  3IFU A;  5C4J I;  2E0H A;  2HU9 A;  2ASC A;  2QWQ A;  3CCL Z;  1KAZ A;  2JIO A;  1K73 1;  1BA0 A;  3S15 I;  1KC8 2;  5AQN A;  2NVX I;  3GL1 A;  1LQQ A;  5BN8 A;  2O53 A;  4EWC A;  4MH4 A;  2HF1 A;  2M6N A;  2Q51 A;  1VQP Z;  5D1P A;  2B63 I;  5AQM A;  3HKZ A;  1X3W A;  5FPD A;  2BUP A;  1GPT A;  2OOY B;  3NFZ A;  2GTI A;  5FLM I;  3CCJ Z;  1YUK A;  5D1O B;  1P00 A;  4MRI A;  1QYP A;  3LDN A;  1B3C A;  2QWR A;  3KHW A;  1L4V A;  3I55 1;  3S1N I;  3MZL B;  3CCE Z;  1W2B Y;  1NRB A;  1VQ9 1;  3CQZ I;  3HOX I;  1YJW 1;  1K8A 2;  2LN8 A;  5AQH A;  3D2L A;  3U50 C;  1QXF A;  1Z01 A;  5IP9 I;  2NY8 X;  1ATR A;  3TE5 B;  5FPM A;  1ZB9 A;  1AA6 A;  3CPW Y;  1FH3 A;  5T64 A;  1KAX A;  3CCU Z;  4NBD A;  4Y7N I;  2K3R A;  3MZK B;  1JWH C;  3HOW I;  1VQ5 1;  2JIQ A;  3VB9 A;  3VMG A;  5CM2 M;  4BXX I;  1JXC A;  1VNB A;  1SNB A;  1WJ2 A;  3BK3 C;  3G71 1;  2K35 A;  4HH4 A;  2JA5 I;  2YIP A;  1ZYW A;  1B7D A;  4NBC A;  3D9X A;  1TI5 A;  3I07 A;  1YJ9 Z;  1YI2 Z;  2K5R A;  1HPM A;  1ZYV A;  5AQI A;  4NH1 C;  3HSC A;  3LDL A;  1M1K 2;  1I6G A;  1I2V A;  2KPI A;  4A93 I;  1NGF A;  2DE5 A;  3CCM 1;  1NGJ A;  3BG0 B;  1C55 A;  3KOZ A;  2OZK A;  4A3J I;  1K83 I;  5AQW A;  2R92 I;  1Z03 A;  3S2D I;  1SN1 A;  3LDQ A;  2GL1 A;  4V1D C;  1I50 I;  2WAQ A;  5AQL A;  1NGE A;  3M3Y I;  1UGL A;  1S72 1;  1ZUT A;  2YAD A;  5T67 A;  3P5J B;  5F2R A;  1VQK Z;  3CCM Z;  3M4O I;  1K8A 1;  3LDO A;  4AAZ A;  4RVF A;  3D2E A;  3E7R L;  3GTP I;  1VQO 1;  2IV2 X;  3G6E 1;  3FQQ A;  2JA7 I;  2NVQ I;  2P3Y A;  1NGH A;  3MON A;  1ZVG A;  3S1Q I;  1SFO I;  2E2F A;  4A3K I;  1S72 Z;  4KBO A;  2SN3 A;  4E2X A;  4S1T A;  2QEX 1;  2E88 A;  1ICA A;  2E3G A;  1VQO Z;  1DKG D;  2QWO A;  4H5R A;  4H5V A;  2J6A A;  3GDQ A;  3KOW A;  3GTK I;  5BN9 A;  2RHB A;  1MR4 A;  1YIT Z;  4HHF A;  3G4S Z;  1P0A A;  2PK7 A;  4A3L I;  2KBH A;  2YEO A;  4RV9 A;  3NH5 A;  2QEX Z;  2E3F A;  3PO3 I;  1I2U A;  1YUA A;  4HGY A;  4MON A;  4NBH A;  1N4N A;  1N8R 1;  3I4M I;  5LL6 f;  3IUC A;  3KOX A;  4NOZ A;  2LY6 A;  3R2V A;  1MYN A;  4H5N A;  1T7A A;  4NBF A;  2A7T A;  2LJM A;  2LJ7 A;  1GPS A;  3D2F A;  3CCL 1;  3GCF A;  1OZZ A;  4HWI A;  1Q81 2;  4NBB A;  2KJA A;  2E2I I;  1T0Z A;  3QWU A;  2AYD A;  4NBA A;  1FDO A;  2YU9 I;  1VQ4 1;  4A3G I;  1JJ2 Z;  3NDJ A;  1VQP 1;  1TWA I;  2WB1 A;  3CCQ Z;  4A3F I;  5AQG A;  4DQY B;  3QFP A;  2QKD A;  3FZM A;  1USP A;  3CCJ 1;  2JA8 I;  3CQX A;  2E2H I;  3VMH A;  1RQF A;  3L4I A;  4CL1 A;  1VQ4 Z;  3CCE 1;  2M8B B;  1WT7 A;  2VPZ A;  5AQP A;  1WWN A;  1ZH1 A;  3KOY A;  3L6Q A;  1QVG Y;  4H5T A;  2F4O A;  5F0X A;  3GTM I;  2VUG A;  2F4M A;  5AQF A;  3TDH B;  2PM9 A;  1XRS B;  3C7N B;  3FZH A;  3CCU 1;  1LQI A;  1YJN Z;  1VNA A;  3CXC Y;  3OW2 Z;  4BY7 I;  1QVF Z;  2I61 A;  1Q82 2;  1NRA A;  2E7Z A;  1YIJ Z;  1KD1 2;  1BCG A;  1FDI A;  3KIH A;  3AY9 A;  1T1T A;  1NJI 2;  3S17 I;  2GTH A;  1Y8C A;  1SEG A;  2LI7 A;  1R9T I;  4X6A I;  3GTG I;  1VQN Z;  3M3Z A;  4RS4 A;  1Q86 1;  2JUB A;  1YJ9 1;  1YI2 1;  4QTU A;  3E7U X;  4GNI A;  4BY1 I;  1K9M 1;  1Q81 1;  5BPM A;  1TWG I;  2NVY I;  1YHQ Z;  2VPX A;  2QWM A;  2R7Z I;  2JIM A;  3KP0 A;  1VQM Z;  1BMR A;  2I3C A;  5C44 I;  1T7E A;  1L1O C;  1M90 2;  3J7A 4;  1AYJ A;  2YIO A;  2VPY A;  2DE6 A;  5FLX f;  4UAF E;  2B3C A;  3VTN A;  1NGA A;  1KC8 1;  2R6M A;  1VQ6 Z;  1HJO A;  4UAD E;  3IF8 A;  1VLA A;  5BPL A;  1CHZ A;  1VQK 1;  3A8Y A;  1QQM A;  2QXL A;  5FLX b;  2IZ4 A;  4MD9 A;  3CCR Z;  2VF1 A;  2G2K A;  4UAE F;  2O4H A;  3CC7 Z;  2E2J I;  1C56 A;  3D2E B;  2OOX B;  3I56 1;  1TFI A;  4MD8 A;  5T6B A;  2QWN A;  3D6W A;  3NDI A;  1ZB8 A;  1ZFU A;  1HX1 A;  3FZL A;  1Y1W I;  1SIW A;  1DJT A;  5AQT A;  1JKZ A;  2LT8 A;  3GTJ I;  4E2Y A;  2LY5 A;  1BRZ A;  2MN5 A;  5EY4 A;  2JIR A;  1KQS Z;  3QML A;  4HGZ A;  3T4N B;  1RO0 A;  1YIT 1;  1JZB A;  3IR7 A;  3G4S 1;  3I56 Z;  1NH5 A;  1KV0 A;  3FZF A;  2MBK A;  1DL6 A;  2KBJ A;  3VMI A;  2N2R A;  2RIQ A;  1Y1V I;  2ZAE B;  3KIF A;  1P9N A;  2NY9 X;  3S1R I;  3KVG A;  3F3P C;  3LUS A;  4RVH A;  1DQ7 A;  5BPN A;  5AQY A;  2QW9 A;  5AQR A;  5AQZ A;  5A2Q f;  1K73 2;  1M90 1;  2V3V A;  1ML8 A;  1KAY A;  1M1K 1;  5A2Q b;  2KHO A;  5AQQ A;  3HOV I;  3I33 A;  2NAP A;  2YIL A;  3D2F B;  3PO3 S;  3IX0 A;  2W04 A;  3CCQ 1;  2JA6 I;  2GMO A;  1PE4 A;  2KPY A;  2Y0S A;  1LQH A;  1I3Q I;  3CC4 Z;  3KC6 A;  1OMY A;  1ATS A;  1PTX A;  3L56 A;  1NUI A;  1USP B;  1I6H I;  5IT9 f;  1S7M A;  1NPI A;  3PO2 I;  4FL9 A;  4MD7 A;  2H85 A;  2KI7 B;  1TWH I;  3CD6 Z;  2VPW A;  2YBR C;  2Q4Z A;  3EER A;  1YJN 1;  4Y52 I;  1NE5 A;  1SN4 A;  3FZK A;  4UJ0 A;  1NGI A;  2LIY A;  3FE1 A;  3F3F C;  5AN9 F;  1X0T A;  1YIJ 1;  5AQS A;  4HE7 A;  4NB8 A;  2QRD B;  3GTQ I;  2B68 A;  1WMT A;  3JXU A; 
#chains in the Genus database with same CATH homology
 1W2B Z;  1JJ2 Y;  2QA4 Z;  3BG1 B;  1VQN 1;  4RVG A;  1RO2 A;  3S14 I;  1WII A;  3GTM S;  3H0G I;  1Q7Y 2;  3CCS 1;  4DGL A;  1NP6 A;  3CPW Z;  1YHQ 1;  3HOZ I;  3J81 f;  4NB9 A;  4NFR A;  4E2W A;  1VQM 1;  4E33 A;  4A3B I;  2EGT A;  2QRC B;  2OTL 1;  3NH8 A;  3HOU I;  4MXU A;  3J81 b;  3CCS Z;  1VQ8 1;  4XX2 A;  5D1O A;  2V8K A;  4BBS I;  2LFU A;  3OW2 Y;  1VQ6 1;  1QVF Y;  3JAM f;  2OTL Z;  3CCR 1;  3Q87 A;  4NBG A;  3CC7 1;  4A3D I;  1TWF I;  1VQ8 Z;  3I55 Z;  3JAM b;  2GU2 A;  1VQ9 Z;  1YJW Z;  2JNY A;  1RLY A;  1QF8 A;  2QRE B;  3NH4 A;  2QLV B;  3ESW A;  4E31 A;  3S1M I;  1WW9 A;  3K7A I;  4QTT A;  3CME 1;  1X3Z A;  3S16 I;  3RZO I;  3HOY I;  1VQ5 Z;  2AKL A;  1VQ7 1;  4A3M I;  3G71 Z;  1Q82 1;  1Q7Y 1;  1KD1 1;  3CCV 1;  1N8R 2;  4BBR I;  5IP7 I;  1NJI 1;  3CME Z;  2RBL A;  2R93 I;  2OTJ 1;  1VQ7 Z;  5C4X I;  2JMO A;  3GKQ A;  3CMA 1;  1WCM I;  1RO4 A;  2BJO A;  2QR1 B;  3CCV Z;  1LQL A;  4A3E I;  1Z02 A;  2OTJ Z;  3H3V J;  2RPR A;  2JS4 A;  2NVT I;  1PFT A;  3FQM A;  1Y1V S;  4RVD A;  3CMA Z;  1VQL 1;  2P28 A;  1KQS Y;  3CC4 1;  2M48 A;  4E32 A;  2IZ3 A;  1KRL A;  3J80 f;  3FKI I;  4DK1 A;  3G6E Z;  3EED A;  4AYB A;  1VQL Z;  1RNI A;  3J80 b;  1K8B A;  3CD6 1;  3GTO I;  3RZD I;  4E2Z A;  5C3E I;  2V8J A;  4A3I I;  3CC2 1;  3S2H I;  3I4N I;  4A3C I;  2VUM I;  5IT9 b;  2QA4 1;  4TNU A;  1Q86 2;  2PMZ A;  1N2F A;  1QVG Z;  2W03 A;  1K9M 2;  3CC2 Z;  2DE7 A;  1TWC I;  4NBE A;  3GTL I;  3CXC Z;  2RT9 A;  2V8I A;  2JR6 A;  2E9H A;  4E30 A;  3IFU A;  5C4J I;  2HU9 A;  3CCL Z;  1K73 1;  3S15 I;  1KC8 2;  2NVX I;  2O53 A;  4EWC A;  4MH4 A;  2HF1 A;  2M6N A;  2Q51 A;  1VQP Z;  5D1P A;  2B63 I;  3HKZ A;  1X3W A;  2OOY B;  3NFZ A;  2GTI A;  5FLM I;  3CCJ Z;  1YUK A;  5D1O B;  4MRI A;  1QYP A;  3I55 1;  3S1N I;  3MZL B;  3CCE Z;  1W2B Y;  1VQ9 1;  3CQZ I;  3HOX I;  1YJW 1;  1K8A 2;  3U50 C;  1Z01 A;  5IP9 I;  3TE5 B;  1ZB9 A;  3CPW Y;  5T64 A;  3CCU Z;  4NBD A;  4Y7N I;  2K3R A;  3MZK B;  1JWH C;  3HOW I;  1VQ5 1;  3VMG A;  3VB9 A;  5CM2 M;  4BXX I;  3G71 1;  4HH4 A;  2JA5 I;  4NBC A;  3D9X A;  3I07 A;  1YJ9 Z;  1YI2 Z;  2K5R A;  4NH1 C;  1M1K 2;  2KPI A;  4A93 I;  2DE5 A;  3CCM 1;  3BG0 B;  2OZK A;  4A3J I;  1K83 I;  2R92 I;  1Z03 A;  3S2D I;  1I50 I;  2WAQ A;  3M3Y I;  1S72 1;  2YAD A;  5T67 A;  3P5J B;  1VQK Z;  3CCM Z;  3M4O I;  1K8A 1;  4RVF A;  3GTP I;  1VQO 1;  3G6E 1;  3FQQ A;  2JA7 I;  2NVQ I;  2P3Y A;  3MON A;  3S1Q I;  1SFO I;  4A3K I;  1S72 Z;  4E2X A;  4S1T A;  2QEX 1;  1VQO Z;  2J6A A;  3GTK I;  2RHB A;  1YIT Z;  3G4S Z;  2PK7 A;  4A3L I;  4RV9 A;  3NH5 A;  2QEX Z;  3PO3 I;  1YUA A;  4HGY A;  4MON A;  4NBH A;  1N8R 1;  3I4M I;  5LL6 f;  4NOZ A;  4NBF A;  3CCL 1;  3GCF A;  1Q81 2;  4NBB A;  2E2I I;  3QWU A;  4NBA A;  2YU9 I;  1VQ4 1;  4A3G I;  1JJ2 Z;  3NDJ A;  1VQP 1;  1TWA I;  2WB1 A;  3CCQ Z;  4A3F I;  4DQY B;  2QKD A;  1USP A;  3CCJ 1;  2JA8 I;  2E2H I;  3VMH A;  1RQF A;  4CL1 A;  1VQ4 Z;  3CCE 1;  1ZH1 A;  1QVG Y;  2F4O A;  3GTM I;  2VUG A;  2F4M A;  3TDH B;  2PM9 A;  3CCU 1;  1YJN Z;  3CXC Y;  3OW2 Z;  4BY7 I;  1QVF Z;  1Q82 2;  1YIJ Z;  1KD1 2;  3KIH A;  1NJI 2;  3S17 I;  2GTH A;  1R9T I;  4X6A I;  3GTG I;  1VQN Z;  4RS4 A;  1Q86 1;  2JUB A;  1YJ9 1;  1YI2 1;  4QTU A;  4BY1 I;  1K9M 1;  1Q81 1;  1TWG I;  2NVY I;  1YHQ Z;  2R7Z I;  1VQM Z;  2I3C A;  5C44 I;  1L1O C;  1M90 2;  3J7A 4;  2DE6 A;  5FLX f;  3VTN A;  1KC8 1;  2R6M A;  1VQ6 Z;  3IF8 A;  1VLA A;  1VQK 1;  5FLX b;  2IZ4 A;  4MD9 A;  3CCR Z;  2VF1 A;  2G2K A;  2O4H A;  3CC7 Z;  2E2J I;  2OOX B;  3I56 1;  1TFI A;  4MD8 A;  5T6B A;  3D6W A;  3NDI A;  1ZB8 A;  1Y1W I;  3GTJ I;  4E2Y A;  1KQS Z;  4HGZ A;  3T4N B;  1RO0 A;  1YIT 1;  3G4S 1;  3I56 Z;  1DL6 A;  3VMI A;  2RIQ A;  1Y1V I;  2ZAE B;  3KIF A;  1P9N A;  3S1R I;  3F3P C;  3LUS A;  4RVH A;  5A2Q f;  1K73 2;  1M90 1;  1ML8 A;  1M1K 1;  5A2Q b;  3HOV I;  3PO3 S;  3IX0 A;  2W04 A;  3CCQ 1;  2JA6 I;  2Y0S A;  1I3Q I;  3CC4 Z;  1NUI A;  1USP B;  1I6H I;  5IT9 f;  1S7M A;  3PO2 I;  4MD7 A;  2H85 A;  2KI7 B;  1TWH I;  3CD6 Z;  2Q4Z A;  3EER A;  1YJN 1;  4Y52 I;  2LIY A;  3F3F C;  5AN9 F;  1X0T A;  1YIJ 1;  4NB8 A;  2QRD B;  3GTQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...