2G2KA

Nmr structure of an n-terminal fragment of the eukaryotic initiation factor 5 (eif5)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
156
structure length
156
Chain Sequence
LSVNVNRSVMDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5
publication title Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 18
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2g2kA02
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 2g2kA01
2E9HA 2G2KA 1K8BA
chains in the Genus database with same CATH superfamily
1VQ9Z 1ZUTA 2AYDA 3H0GI 3PO3I 1SFOI 4HGZA 3LDQA 4Y52I 3NDIA 1Q7Y1 1I50I 2OTL1 3P5JB 4NFRA 3IF8A 2E3FA 2V8KA 4NBCA 1FDOA 1WCMI 1VQ8Z 5CY0A 3HKZA 1QVGZ 1YIJ1 3GTGI 5FLXb 3CW4A 5AR0A 1K8BA 1QVFZ 1ZB8A 4FL9A 3L56A 1OMYA 5AQHA 1RO0A 3S1NI 3VB9A 1RQFA 4A3GI 2VUGA 5BPLA 2GTHA 1VQMZ 4FSVA 3D9XA 1PTXA 1I3QI 3A8YA 1VQ91 1K83I 3CXCY 2E3GA 3CCMZ 1NH5A 4CL1A 2NVTI 1WIIA 1PE4A 2LT8A 5AQKA 2KYQA 2D56A 2BJOA 3PSMA 1YITZ 3E7UX 1ZU3A 1QQMA 1N8R2 1XRSB 2PM9A 5AQWA 4KYPA 3VMIA 3PO2I 4NOZA 3GL1A 5AQMA 1SEGA 2LR3A 1I6HI 5AQUA 3TE5B 1S7MA 2DE5A 1KAYA 3CQXA 1NGDA 1S72Z 1USPA 3CCV1 5FPEA 4MONA 1NGCA 2MBKA 1VQ5Z 1ML8A 1KD12 1VQM1 4NH1C 3CXCZ 2LI7A 1KRLA 2NVQI 3M4OI 3CCM1 2R92I 3M3YI 3LDNA 3CCQ1 5AQIA 2KGQA 2N2QA 2PK7A 3KOYA 1YIT1 1Q822 4E32A 4UJ0A 3HOVI 2GTIA 5IP9I 1NRAA 1ATSA 3CMEZ 1GPTA 1K8A1 3S16I 2E2JI 1L4VA 4BBSI 3IFUA 3HOWI 1TWFI 1N4NA 2E2FA 1TWHI 3IX0A 1QQOA 3M3ZA 2ZAEB 1ZYWA 4CQKA 3CCL1 2LFUA 4A3CI 1LQQA 2I61A 5EY4A 1S721 1WW9A 2WB1A 1MYNA 1QF8A 4H5TA 2QWPA 1VQ51 1KQSZ 1T7EA 2VPYA 2K35A 3GKUA 2E88A 3KP0A 1VLAA 2YILA 2W03A 4E2YA 2QLVB 2QWLA 2JR6A 4X6AI 1CHZA 2V45A 3I55Z 5IT9f 2B3CA 2JIQA 3GTOI 2F4OA 1OZZA 1JKZA 3CME1 5AQTA 3D2EA 1VQK1 4E33A 1ZFUA 1HPMA 2RPRA 3G6EZ 1ATRA 3SF4D 4NBDA 5AQXA 2M48A 3BK3C 1Y1VS 2QEXZ 3CCSZ 4GNIA 4AAZA 3CCRZ 1VQ4Z 1B3CA 5C4XI 2N66A 2KJAA 1M1K1 5D1PA 1KC82 3FKII 3D2EB 1BA0A 3C7NB 5F0XA 5AQOA 1VQNZ 3I551 3QFPA 3KVGA 1QQNA 1C56A 1QVGY 1S3XA 2JIMA 1MR4A 3FZMA 2V3VA 5KK4A 5BN9A 2YADA 1QVFY 5C3EI 2V8IA 2PMZA 3BG0B 4HGYA 4RV9A 2QEX1 2VPXA 1K8A2 1LQHA 4RVDA 5F1XA 3CCS1 3L6QA 5AQJA 3NDJA 4E2XA 3BG1B 2YIPA 2RT9A 1VQ41 4AEIA 2NVXI 1NJI2 1Z03A 3NH4A 3IR7A 2ATBA 3G4SZ 1I6GA 1VQN1 4BY7I 2RBLA 2R6MA 3JAMb 3KC6A 3LUSA 1WMTA 3CMAZ 1VNBA 1T7BA 2ASCA 3CCJ1 1KV0A 1P9NA 5D1OA 2QW9A 1RLYA 4RS4A 5AQPA 1ZVEA 3MZKB 1VQ7Z 2K3RA 4NBEA 4HHFA 3IUCA 5AQQA 3GTPI 1X0TA 3J80f 5FLMI 3HOXI 2E8AA 1RO4A 4UAFE 2EGTA 2P28A 2WAQA 3VMHA 1YI2Z 5A2Qf 3D6WA 1HJOA 3PO3S 1HX1A 3RZDI 2G2KA 4MD9A 2LJMA 5T67A 2KPIA 1TI5A 4NBHA 3S2DI 5C44I 3J7A4 1T0ZA 3GTMS 3FZLA 1VQ81 2E2II 2LN8A 3RZOI 2DE7A 3CMA1 1K732 3U50C 2BUPA 2QA4Z 2O4HA 3I33A 3FE1A 2JA8I 3CCEZ 3NH5A 1ZB9A 1Q16A 1VQ71 3HOZI 1WJ2A 3H3VJ 2RHBA 4XX2A 1K9M1 2JS4A 1NP6A 1KQSY 1YI21 2R7ZI 2VY6A 1Q811 1NE5A 2JIPA 4A3EI 3QFUA 4MD7A 5AQYA 3S1RI 4H5VA 2KI7B 2MZ0A 4AYBA 1YUKA 1NPIA 3GKQA 1YJ9Z 3CC4Z 2JUBA 1USPB 2LY6A 2QRCB 1Q7Y2 3J81f 2KSKA 1BMRA 4MD8A 2QA41 1M901 3CCE1 2OOYB 1JZBA 1Y1WI 3T4NB 1PFTA 1NGFA 5AQNA 1Z02A 3HSCA 3F3PC 2P3YA 2OZKA 3KP1A 2E7ZA 3CCUZ 1T7AA 1JZAA 1PX9A 2QWOA 4A3JI 2O53A 1WWNA 3E7RL 1NGJA 1JJ2Z 2V7ZA 3GDQA 2J6AA 5FLXf 4A3DI 4HH4A 3OW2Y 1TWCI 2E0HA 2DE6A 5BN8A 1YJ91 3CC41 1VQPZ 3S14I 1B7DA 1Y1VI 3D2LA 2JMOA 2HF1A 4RVFA 3GTKI 3Q87A 4QTTA 2QKDA 1LQIA 5EXWA 1CN2A 3G71Z 1SIWA 5IP7I 2E2HI 5AQLA 2H85A 2K5RA 1DL6A 1NGAA 2JA7I 2JDQD 1RO2A 3LDOA 1K9M2 1AA6A 3S1MI 3S2HI 1LQLA 5AQVA 1NRBA 3OW2Z 3S17I 5C4JI 1QXFA 2IZ3A 2W04A 1Q812 1Q861 4V1DC 3I07A 1DKGD 5AQSA 1UGLA 3D2FA 3G6E1 2B68A 3GCFA 2YC1C 3CC7Z 2M6NA 3G711 1N8R1 4A3II 3F3FC 1SN4A 3QMLA 1NGHA 4A3KI 2R93I 3KIHA 4E30A 3CCR1 2QWRA 2F4MA 4E2WA 4BBRI 3L4IA 4NBGA 2NAPA 3QWUA 1BA1A 1ZH1A 1SN1A 1SNBA 3D2FB 1KAZA 4IO8A 1N2FA 3K7AI 3CPWY 3GTQI 1YJWZ 2QWNA 5FPNA 3NH8A 1QYPA 1NGBA 4NBAA 3CQZI 2A7TA 1VQ6Z 2YU9I 2JIOA 3EERA 2GMOA 1Q821 4A93I 3I4MI 4A3FI 3FZKA 3ATUA 1X3WA 2QWQA 4TNUA 2SN3A 2Y0SA 3FQQA 1DJTA 1JWHC 1WT7A 2QRDB 3GTMI 4UAEF 5EX5A 2JA5I 3KIFA 2JIRA 1I6FA 5D1OB 4E31A 3G4S1 3CC2Z 4DGLA 2JA6I 3HOYI 3I56Z 3CPWZ 5IT9b 2KBJA 1M1K2 1BCGA 1YJW1 4E2ZA 1FH3A 2V8JA 1T1TA 1RNIA 2QXLA 1VQOZ 3CCVZ 2KBHA 3FZHA 1DQ7A 1VQ61 1Q862 3MONA 4NB9A 2RIQA 2VUMI 1NGEA 1Y8CA 5AQFA 4A3MI 3CCQZ 2AKLA 2Q4ZA 1ICAA 5FPDA 2IV2X 3KOWA 2GL1A 4HWIA 4MXUA 3JXUA 3QI7A 4NB8A 1JJ2Y 3CC21 3I561 4AB0A 5F2RA 1WZNA 3CCLZ 4MH4A 4UADE 1VQO1 1KC81 2VPZA 4NBBA 1NGIA 3FQMA 1I2VA 5BPMA 1C55A 1JXCA 3KHWA 1GPSA 4H5RA 4MRIA 1AHOA 1VQLZ 2GU2A 3S1QI 5AN9F 2YEOA 4H5WA 3KOZA 3JAMf 2KBKA 1NGGA 1X3ZA 4QTUA 5T6BA 3TDHB 4EWCA 3LDPA 2LIYA 1YHQZ 2B63I 1NUIA 1ZVGA 2LY5A 2E9HA 3ATVA 1VQKZ 4DQYB 3VTNA 1BK8A 1YJNZ 3GTLI 1BRZA 5EVZA 2BRZA 3GTJI 3CD6Z 1NJI1 2I3CA 2LJ7A 3FZFA 5AQZA 2JNYA 1W2BY 3KOXA 2YBRC 4BY1I 2NY9X 3J80b 1VQL1 1KAXA 3R2VA 2HU9A 4HE7A 1AYJA 3CCU1 5FPMA 3EEDA 2IZ4A 4Y7NI 5A2Qb 3I4NI 2QR1B 1P00A 4A3BI 1FDIA 1YHQ1 2OTJZ 1BUPA 1ZYVA 4RVHA 4DK1A 3ESWA 3C7NA 2LEXA 5CM2M 1Z01A 1YUAA 1YJN1 1VQP1 4A3LI 1POIA 4KBOA 1TWGI 2M8BB 1L1OC 5T64A 4RVGA 3CD61 2LKBA 3HOUI 2N2RA 2KPYA 4S1TA 2VF1A 1W2BZ 1R9TI 2N69A 1I2UA 2OOXB 2NY8X 1TFIA 2NVYI 2Q51A 1M902 1K731 2OTLZ 3LDLA 1VNAA 4BXXI 2MN5A 3MZLB 3NFZA 5LL6f 3CCJZ 1YIJZ 2YIOA 2OTJ1 2QREB 5BPNA 1TWAI 1KD11 5AQGA 3S15I 4H5NA 2QWMA 3AY9A 4NBFA 5AQRA 3J81b 1P0AA 1YUWA 2KHOA 2VPWA 3CC71 3VMGA
chains in the Genus database with same CATH topology
1VQ9Z 3H0GI 3PO3I 1SFOI 4HGZA 4Y52I 3NDIA 1Q7Y1 1I50I 2OTL1 3P5JB 4NFRA 3IF8A 2V8KA 4NBCA 1WCMI 1VQ8Z 3HKZA 1QVGZ 1YIJ1 3GTGI 5FLXb 1K8BA 1QVFZ 1ZB8A 1RO0A 3S1NI 3VB9A 1RQFA 4A3GI 2VUGA 2GTHA 1VQMZ 3D9XA 1I3QI 1VQ91 1K83I 3CXCY 3CCMZ 4CL1A 2NVTI 1WIIA 2BJOA 1YITZ 1N8R2 2PM9A 3VMIA 3PO2I 4NOZA 1I6HI 3TE5B 1S7MA 2DE5A 1S72Z 1USPA 3CCV1 4MONA 1VQ5Z 1ML8A 1KD12 1VQM1 4NH1C 3CXCZ 1KRLA 2NVQI 3M4OI 3CCM1 2R92I 3M3YI 3CCQ1 2PK7A 1YIT1 1Q822 4E32A 3HOVI 2GTIA 5IP9I 3CMEZ 1K8A1 3S16I 2E2JI 4BBSI 3IFUA 3HOWI 1TWFI 1TWHI 3IX0A 2ZAEB 3CCL1 2LFUA 4A3CI 1S721 1WW9A 2WB1A 1QF8A 1VQ51 1KQSZ 1VLAA 2W03A 4E2YA 2QLVB 2JR6A 4X6AI 3I55Z 5IT9f 3GTOI 2F4OA 3CME1 1VQK1 4E33A 2RPRA 3G6EZ 4NBDA 2M48A 1Y1VS 2QEXZ 3CCSZ 3CCRZ 1VQ4Z 5C4XI 1M1K1 5D1PA 1KC82 3FKII 1VQNZ 3I551 1QVGY 2YADA 1QVFY 5C3EI 2V8IA 2PMZA 3BG0B 4HGYA 4RV9A 2QEX1 1K8A2 4RVDA 3CCS1 3NDJA 4E2XA 3BG1B 2RT9A 1VQ41 2NVXI 1NJI2 1Z03A 3NH4A 3G4SZ 1VQN1 4BY7I 2RBLA 2R6MA 3JAMb 3LUSA 3CMAZ 3CCJ1 1P9NA 5D1OA 1RLYA 4RS4A 3MZKB 1VQ7Z 2K3RA 4NBEA 3GTPI 1X0TA 3J80f 5FLMI 3HOXI 1RO4A 2EGTA 2P28A 2WAQA 3VMHA 1YI2Z 5A2Qf 3D6WA 3PO3S 3RZDI 2G2KA 4MD9A 5T67A 2KPIA 4NBHA 3S2DI 5C44I 3J7A4 3GTMS 1VQ81 2E2II 3RZOI 2DE7A 3CMA1 1K732 3U50C 2QA4Z 2O4HA 2JA8I 3CCEZ 3NH5A 1ZB9A 1VQ71 3HOZI 3H3VJ 2RHBA 4XX2A 1K9M1 2JS4A 1NP6A 1KQSY 1YI21 2R7ZI 1Q811 4A3EI 4MD7A 3S1RI 2KI7B 4AYBA 1YUKA 3GKQA 1YJ9Z 3CC4Z 2JUBA 1USPB 2QRCB 1Q7Y2 3J81f 4MD8A 2QA41 1M901 3CCE1 2OOYB 1Y1WI 3T4NB 1PFTA 1Z02A 3F3PC 2P3YA 2OZKA 3CCUZ 4A3JI 2O53A 1JJ2Z 2J6AA 5FLXf 4A3DI 4HH4A 3OW2Y 1TWCI 2DE6A 1YJ91 3CC41 1VQPZ 3S14I 1Y1VI 2JMOA 2HF1A 4RVFA 3GTKI 3Q87A 4QTTA 2QKDA 3G71Z 5IP7I 2E2HI 2H85A 2K5RA 1DL6A 2JA7I 1RO2A 1K9M2 3S1MI 3S2HI 1LQLA 3OW2Z 3S17I 5C4JI 2IZ3A 2W04A 1Q812 1Q861 3I07A 3G6E1 3GCFA 3CC7Z 2M6NA 3G711 1N8R1 4A3II 3F3FC 4A3KI 2R93I 3KIHA 4E30A 3CCR1 2F4MA 4E2WA 4BBRI 4NBGA 3QWUA 1ZH1A 1N2FA 3K7AI 3CPWY 3GTQI 1YJWZ 3NH8A 1QYPA 4NBAA 3CQZI 1VQ6Z 2YU9I 3EERA 1Q821 4A93I 3I4MI 4A3FI 1X3WA 4TNUA 2Y0SA 3FQQA 1JWHC 2QRDB 3GTMI 2JA5I 3KIFA 5D1OB 4E31A 3G4S1 3CC2Z 4DGLA 2JA6I 3HOYI 3I56Z 3CPWZ 5IT9b 1M1K2 1YJW1 4E2ZA 2V8JA 1RNIA 1VQOZ 3CCVZ 1VQ61 1Q862 3MONA 4NB9A 2RIQA 2VUMI 4A3MI 3CCQZ 2AKLA 2Q4ZA 4MXUA 4NB8A 1JJ2Y 3CC21 3I561 3CCLZ 4MH4A 1VQO1 1KC81 4NBBA 3FQMA 4MRIA 1VQLZ 2GU2A 3S1QI 5AN9F 3JAMf 1X3ZA 4QTUA 5T6BA 3TDHB 4EWCA 2LIYA 1YHQZ 2B63I 1NUIA 2E9HA 1VQKZ 4DQYB 3VTNA 1YJNZ 3GTLI 3GTJI 3CD6Z 1NJI1 2I3CA 2JNYA 1W2BY 4BY1I 3J80b 1VQL1 2HU9A 3CCU1 3EEDA 2IZ4A 4Y7NI 5A2Qb 3I4NI 2QR1B 4A3BI 1YHQ1 2OTJZ 4RVHA 4DK1A 3ESWA 5CM2M 1Z01A 1YUAA 1YJN1 1VQP1 4A3LI 1TWGI 1L1OC 5T64A 4RVGA 3CD61 3HOUI 4S1TA 2VF1A 1W2BZ 1R9TI 2OOXB 1TFIA 2NVYI 2Q51A 1M902 1K731 2OTLZ 4BXXI 3MZLB 3NFZA 5LL6f 3CCJZ 1YIJZ 2OTJ1 2QREB 1TWAI 1KD11 3S15I 4NBFA 3J81b 3CC71 3VMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9H A;  2G2K A;  1K8B A; 
#chains in the Genus database with same CATH topology
 1VQ9 Z;  1ZUT A;  2AYD A;  3H0G I;  3PO3 I;  1SFO I;  4HGZ A;  3LDQ A;  4Y52 I;  3NDI A;  1Q7Y 1;  1I50 I;  2OTL 1;  3P5J B;  4NFR A;  3IF8 A;  2E3F A;  2V8K A;  4NBC A;  1FDO A;  1WCM I;  1VQ8 Z;  5CY0 A;  3HKZ A;  1QVG Z;  1YIJ 1;  3GTG I;  5FLX b;  3CW4 A;  5AR0 A;  1K8B A;  1QVF Z;  1ZB8 A;  4FL9 A;  3L56 A;  1OMY A;  5AQH A;  1RO0 A;  3S1N I;  3VB9 A;  1RQF A;  4A3G I;  2VUG A;  5BPL A;  2GTH A;  1VQM Z;  4FSV A;  3D9X A;  1PTX A;  1I3Q I;  3A8Y A;  1VQ9 1;  1K83 I;  3CXC Y;  2E3G A;  3CCM Z;  1NH5 A;  4CL1 A;  2NVT I;  1WII A;  1PE4 A;  2LT8 A;  5AQK A;  2KYQ A;  2D56 A;  2BJO A;  3PSM A;  1YIT Z;  3E7U X;  1ZU3 A;  1QQM A;  1N8R 2;  1XRS B;  2PM9 A;  5AQW A;  4KYP A;  3VMI A;  3PO2 I;  4NOZ A;  3GL1 A;  5AQM A;  1SEG A;  2LR3 A;  1I6H I;  5AQU A;  3TE5 B;  1S7M A;  2DE5 A;  1KAY A;  3CQX A;  1NGD A;  1S72 Z;  1USP A;  3CCV 1;  5FPE A;  4MON A;  1NGC A;  2MBK A;  1VQ5 Z;  1ML8 A;  1KD1 2;  1VQM 1;  4NH1 C;  3CXC Z;  2LI7 A;  1KRL A;  2NVQ I;  3M4O I;  3CCM 1;  2R92 I;  3M3Y I;  3LDN A;  3CCQ 1;  5AQI A;  2KGQ A;  2N2Q A;  2PK7 A;  3KOY A;  1YIT 1;  1Q82 2;  4E32 A;  4UJ0 A;  3HOV I;  2GTI A;  5IP9 I;  1NRA A;  1ATS A;  3CME Z;  1GPT A;  1K8A 1;  3S16 I;  2E2J I;  1L4V A;  4BBS I;  3IFU A;  3HOW I;  1TWF I;  1N4N A;  2E2F A;  1TWH I;  3IX0 A;  1QQO A;  3M3Z A;  2ZAE B;  1ZYW A;  4CQK A;  3CCL 1;  2LFU A;  4A3C I;  1LQQ A;  2I61 A;  5EY4 A;  1S72 1;  1WW9 A;  2WB1 A;  1MYN A;  1QF8 A;  4H5T A;  2QWP A;  1VQ5 1;  1KQS Z;  1T7E A;  2VPY A;  2K35 A;  3GKU A;  2E88 A;  3KP0 A;  1VLA A;  2YIL A;  2W03 A;  4E2Y A;  2QLV B;  2QWL A;  2JR6 A;  4X6A I;  1CHZ A;  2V45 A;  3I55 Z;  5IT9 f;  2B3C A;  2JIQ A;  3GTO I;  2F4O A;  1OZZ A;  1JKZ A;  3CME 1;  5AQT A;  3D2E A;  1VQK 1;  4E33 A;  1ZFU A;  1HPM A;  2RPR A;  3G6E Z;  1ATR A;  3SF4 D;  4NBD A;  5AQX A;  2M48 A;  3BK3 C;  1Y1V S;  2QEX Z;  3CCS Z;  4GNI A;  4AAZ A;  3CCR Z;  1VQ4 Z;  1B3C A;  5C4X I;  2N66 A;  2KJA A;  1M1K 1;  5D1P A;  1KC8 2;  3FKI I;  3D2E B;  1BA0 A;  3C7N B;  5F0X A;  5AQO A;  1VQN Z;  3I55 1;  3QFP A;  3KVG A;  1QQN A;  1C56 A;  1QVG Y;  1S3X A;  2JIM A;  1MR4 A;  3FZM A;  2V3V A;  5KK4 A;  5BN9 A;  2YAD A;  1QVF Y;  5C3E I;  2V8I A;  2PMZ A;  3BG0 B;  4HGY A;  4RV9 A;  2QEX 1;  2VPX A;  1K8A 2;  1LQH A;  4RVD A;  5F1X A;  3CCS 1;  3L6Q A;  5AQJ A;  3NDJ A;  4E2X A;  3BG1 B;  2YIP A;  2RT9 A;  1VQ4 1;  4AEI A;  2NVX I;  1NJI 2;  1Z03 A;  3NH4 A;  3IR7 A;  2ATB A;  3G4S Z;  1I6G A;  1VQN 1;  4BY7 I;  2RBL A;  2R6M A;  3JAM b;  3KC6 A;  3LUS A;  1WMT A;  3CMA Z;  1VNB A;  1T7B A;  2ASC A;  3CCJ 1;  1KV0 A;  1P9N A;  5D1O A;  2QW9 A;  1RLY A;  4RS4 A;  5AQP A;  1ZVE A;  3MZK B;  1VQ7 Z;  2K3R A;  4NBE A;  4HHF A;  3IUC A;  5AQQ A;  3GTP I;  1X0T A;  3J80 f;  5FLM I;  3HOX I;  2E8A A;  1RO4 A;  4UAF E;  2EGT A;  2P28 A;  2WAQ A;  3VMH A;  1YI2 Z;  5A2Q f;  3D6W A;  1HJO A;  3PO3 S;  1HX1 A;  3RZD I;  2G2K A;  4MD9 A;  2LJM A;  5T67 A;  2KPI A;  1TI5 A;  4NBH A;  3S2D I;  5C44 I;  3J7A 4;  1T0Z A;  3GTM S;  3FZL A;  1VQ8 1;  2E2I I;  2LN8 A;  3RZO I;  2DE7 A;  3CMA 1;  1K73 2;  3U50 C;  2BUP A;  2QA4 Z;  2O4H A;  3I33 A;  3FE1 A;  2JA8 I;  3CCE Z;  3NH5 A;  1ZB9 A;  1Q16 A;  1VQ7 1;  3HOZ I;  1WJ2 A;  3H3V J;  2RHB A;  4XX2 A;  1K9M 1;  2JS4 A;  1NP6 A;  1KQS Y;  1YI2 1;  2R7Z I;  2VY6 A;  1Q81 1;  1NE5 A;  2JIP A;  4A3E I;  3QFU A;  4MD7 A;  5AQY A;  3S1R I;  4H5V A;  2KI7 B;  2MZ0 A;  4AYB A;  1YUK A;  1NPI A;  3GKQ A;  1YJ9 Z;  3CC4 Z;  2JUB A;  1USP B;  2LY6 A;  2QRC B;  1Q7Y 2;  3J81 f;  2KSK A;  1BMR A;  4MD8 A;  2QA4 1;  1M90 1;  3CCE 1;  2OOY B;  1JZB A;  1Y1W I;  3T4N B;  1PFT A;  1NGF A;  5AQN A;  1Z02 A;  3HSC A;  3F3P C;  2P3Y A;  2OZK A;  3KP1 A;  2E7Z A;  3CCU Z;  1T7A A;  1JZA A;  1PX9 A;  2QWO A;  4A3J I;  2O53 A;  1WWN A;  3E7R L;  1NGJ A;  1JJ2 Z;  2V7Z A;  3GDQ A;  2J6A A;  5FLX f;  4A3D I;  4HH4 A;  3OW2 Y;  1TWC I;  2E0H A;  2DE6 A;  5BN8 A;  1YJ9 1;  3CC4 1;  1VQP Z;  3S14 I;  1B7D A;  1Y1V I;  3D2L A;  2JMO A;  2HF1 A;  4RVF A;  3GTK I;  3Q87 A;  4QTT A;  2QKD A;  1LQI A;  5EXW A;  1CN2 A;  3G71 Z;  1SIW A;  5IP7 I;  2E2H I;  5AQL A;  2H85 A;  2K5R A;  1DL6 A;  1NGA A;  2JA7 I;  2JDQ D;  1RO2 A;  3LDO A;  1K9M 2;  1AA6 A;  3S1M I;  3S2H I;  1LQL A;  5AQV A;  1NRB A;  3OW2 Z;  3S17 I;  5C4J I;  1QXF A;  2IZ3 A;  2W04 A;  1Q81 2;  1Q86 1;  4V1D C;  3I07 A;  1DKG D;  5AQS A;  1UGL A;  3D2F A;  3G6E 1;  2B68 A;  3GCF A;  2YC1 C;  3CC7 Z;  2M6N A;  3G71 1;  1N8R 1;  4A3I I;  3F3F C;  1SN4 A;  3QML A;  1NGH A;  4A3K I;  2R93 I;  3KIH A;  4E30 A;  3CCR 1;  2QWR A;  2F4M A;  4E2W A;  4BBR I;  3L4I A;  4NBG A;  2NAP A;  3QWU A;  1BA1 A;  1ZH1 A;  1SN1 A;  1SNB A;  3D2F B;  1KAZ A;  4IO8 A;  1N2F A;  3K7A I;  3CPW Y;  3GTQ I;  1YJW Z;  2QWN A;  5FPN A;  3NH8 A;  1QYP A;  1NGB A;  4NBA A;  3CQZ I;  2A7T A;  1VQ6 Z;  2YU9 I;  2JIO A;  3EER A;  2GMO A;  1Q82 1;  4A93 I;  3I4M I;  4A3F I;  3FZK A;  3ATU A;  1X3W A;  2QWQ A;  4TNU A;  2SN3 A;  2Y0S A;  3FQQ A;  1DJT A;  1JWH C;  1WT7 A;  2QRD B;  3GTM I;  4UAE F;  5EX5 A;  2JA5 I;  3KIF A;  2JIR A;  1I6F A;  5D1O B;  4E31 A;  3G4S 1;  3CC2 Z;  4DGL A;  2JA6 I;  3HOY I;  3I56 Z;  3CPW Z;  5IT9 b;  2KBJ A;  1M1K 2;  1BCG A;  1YJW 1;  4E2Z A;  1FH3 A;  2V8J A;  1T1T A;  1RNI A;  2QXL A;  1VQO Z;  3CCV Z;  2KBH A;  3FZH A;  1DQ7 A;  1VQ6 1;  1Q86 2;  3MON A;  4NB9 A;  2RIQ A;  2VUM I;  1NGE A;  1Y8C A;  5AQF A;  4A3M I;  3CCQ Z;  2AKL A;  2Q4Z A;  1ICA A;  5FPD A;  2IV2 X;  3KOW A;  2GL1 A;  4HWI A;  4MXU A;  3JXU A;  3QI7 A;  4NB8 A;  1JJ2 Y;  3CC2 1;  3I56 1;  4AB0 A;  5F2R A;  1WZN A;  3CCL Z;  4MH4 A;  4UAD E;  1VQO 1;  1KC8 1;  2VPZ A;  4NBB A;  1NGI A;  3FQM A;  1I2V A;  5BPM A;  1C55 A;  1JXC A;  3KHW A;  1GPS A;  4H5R A;  4MRI A;  1AHO A;  1VQL Z;  2GU2 A;  3S1Q I;  5AN9 F;  2YEO A;  4H5W A;  3KOZ A;  3JAM f;  2KBK A;  1NGG A;  1X3Z A;  4QTU A;  5T6B A;  3TDH B;  4EWC A;  3LDP A;  2LIY A;  1YHQ Z;  2B63 I;  1NUI A;  1ZVG A;  2LY5 A;  2E9H A;  3ATV A;  1VQK Z;  4DQY B;  3VTN A;  1BK8 A;  1YJN Z;  3GTL I;  1BRZ A;  5EVZ A;  2BRZ A;  3GTJ I;  3CD6 Z;  1NJI 1;  2I3C A;  2LJ7 A;  3FZF A;  5AQZ A;  2JNY A;  1W2B Y;  3KOX A;  2YBR C;  4BY1 I;  2NY9 X;  3J80 b;  1VQL 1;  1KAX A;  3R2V A;  2HU9 A;  4HE7 A;  1AYJ A;  3CCU 1;  5FPM A;  3EED A;  2IZ4 A;  4Y7N I;  5A2Q b;  3I4N I;  2QR1 B;  1P00 A;  4A3B I;  1FDI A;  1YHQ 1;  2OTJ Z;  1BUP A;  1ZYV A;  4RVH A;  4DK1 A;  3ESW A;  3C7N A;  2LEX A;  5CM2 M;  1Z01 A;  1YUA A;  1YJN 1;  1VQP 1;  4A3L I;  1POI A;  4KBO A;  1TWG I;  2M8B B;  1L1O C;  5T64 A;  4RVG A;  3CD6 1;  2LKB A;  3HOU I;  2N2R A;  2KPY A;  4S1T A;  2VF1 A;  1W2B Z;  1R9T I;  2N69 A;  1I2U A;  2OOX B;  2NY8 X;  1TFI A;  2NVY I;  2Q51 A;  1M90 2;  1K73 1;  2OTL Z;  3LDL A;  1VNA A;  4BXX I;  2MN5 A;  3MZL B;  3NFZ A;  5LL6 f;  3CCJ Z;  1YIJ Z;  2YIO A;  2OTJ 1;  2QRE B;  5BPN A;  1TWA I;  1KD1 1;  5AQG A;  3S15 I;  4H5N A;  2QWM A;  3AY9 A;  4NBF A;  5AQR A;  3J81 b;  1P0A A;  1YUW A;  2KHO A;  2VPW A;  3CC7 1;  3VMG A; 
#chains in the Genus database with same CATH homology
 1VQ9 Z;  3H0G I;  3PO3 I;  1SFO I;  4HGZ A;  4Y52 I;  3NDI A;  1Q7Y 1;  1I50 I;  2OTL 1;  3P5J B;  4NFR A;  3IF8 A;  2V8K A;  4NBC A;  1WCM I;  1VQ8 Z;  3HKZ A;  1QVG Z;  1YIJ 1;  3GTG I;  5FLX b;  1K8B A;  1QVF Z;  1ZB8 A;  1RO0 A;  3S1N I;  3VB9 A;  1RQF A;  4A3G I;  2VUG A;  2GTH A;  1VQM Z;  3D9X A;  1I3Q I;  1VQ9 1;  1K83 I;  3CXC Y;  3CCM Z;  4CL1 A;  2NVT I;  1WII A;  2BJO A;  1YIT Z;  1N8R 2;  2PM9 A;  3VMI A;  3PO2 I;  4NOZ A;  1I6H I;  3TE5 B;  1S7M A;  2DE5 A;  1S72 Z;  1USP A;  3CCV 1;  4MON A;  1VQ5 Z;  1ML8 A;  1KD1 2;  1VQM 1;  4NH1 C;  3CXC Z;  1KRL A;  2NVQ I;  3M4O I;  3CCM 1;  2R92 I;  3M3Y I;  3CCQ 1;  2PK7 A;  1YIT 1;  1Q82 2;  4E32 A;  3HOV I;  2GTI A;  5IP9 I;  3CME Z;  1K8A 1;  3S16 I;  2E2J I;  4BBS I;  3IFU A;  3HOW I;  1TWF I;  1TWH I;  3IX0 A;  2ZAE B;  3CCL 1;  2LFU A;  4A3C I;  1S72 1;  1WW9 A;  2WB1 A;  1QF8 A;  1VQ5 1;  1KQS Z;  1VLA A;  2W03 A;  4E2Y A;  2QLV B;  2JR6 A;  4X6A I;  3I55 Z;  5IT9 f;  3GTO I;  2F4O A;  3CME 1;  1VQK 1;  4E33 A;  2RPR A;  3G6E Z;  4NBD A;  2M48 A;  1Y1V S;  2QEX Z;  3CCS Z;  3CCR Z;  1VQ4 Z;  5C4X I;  1M1K 1;  5D1P A;  1KC8 2;  3FKI I;  1VQN Z;  3I55 1;  1QVG Y;  2YAD A;  1QVF Y;  5C3E I;  2V8I A;  2PMZ A;  3BG0 B;  4HGY A;  4RV9 A;  2QEX 1;  1K8A 2;  4RVD A;  3CCS 1;  3NDJ A;  4E2X A;  3BG1 B;  2RT9 A;  1VQ4 1;  2NVX I;  1NJI 2;  1Z03 A;  3NH4 A;  3G4S Z;  1VQN 1;  4BY7 I;  2RBL A;  2R6M A;  3JAM b;  3LUS A;  3CMA Z;  3CCJ 1;  1P9N A;  5D1O A;  1RLY A;  4RS4 A;  3MZK B;  1VQ7 Z;  2K3R A;  4NBE A;  3GTP I;  1X0T A;  3J80 f;  5FLM I;  3HOX I;  1RO4 A;  2EGT A;  2P28 A;  2WAQ A;  3VMH A;  1YI2 Z;  5A2Q f;  3D6W A;  3PO3 S;  3RZD I;  2G2K A;  4MD9 A;  5T67 A;  2KPI A;  4NBH A;  3S2D I;  5C44 I;  3J7A 4;  3GTM S;  1VQ8 1;  2E2I I;  3RZO I;  2DE7 A;  3CMA 1;  1K73 2;  3U50 C;  2QA4 Z;  2O4H A;  2JA8 I;  3CCE Z;  3NH5 A;  1ZB9 A;  1VQ7 1;  3HOZ I;  3H3V J;  2RHB A;  4XX2 A;  1K9M 1;  2JS4 A;  1NP6 A;  1KQS Y;  1YI2 1;  2R7Z I;  1Q81 1;  4A3E I;  4MD7 A;  3S1R I;  2KI7 B;  4AYB A;  1YUK A;  3GKQ A;  1YJ9 Z;  3CC4 Z;  2JUB A;  1USP B;  2QRC B;  1Q7Y 2;  3J81 f;  4MD8 A;  2QA4 1;  1M90 1;  3CCE 1;  2OOY B;  1Y1W I;  3T4N B;  1PFT A;  1Z02 A;  3F3P C;  2P3Y A;  2OZK A;  3CCU Z;  4A3J I;  2O53 A;  1JJ2 Z;  2J6A A;  5FLX f;  4A3D I;  4HH4 A;  3OW2 Y;  1TWC I;  2DE6 A;  1YJ9 1;  3CC4 1;  1VQP Z;  3S14 I;  1Y1V I;  2JMO A;  2HF1 A;  4RVF A;  3GTK I;  3Q87 A;  4QTT A;  2QKD A;  3G71 Z;  5IP7 I;  2E2H I;  2H85 A;  2K5R A;  1DL6 A;  2JA7 I;  1RO2 A;  1K9M 2;  3S1M I;  3S2H I;  1LQL A;  3OW2 Z;  3S17 I;  5C4J I;  2IZ3 A;  2W04 A;  1Q81 2;  1Q86 1;  3I07 A;  3G6E 1;  3GCF A;  3CC7 Z;  2M6N A;  3G71 1;  1N8R 1;  4A3I I;  3F3F C;  4A3K I;  2R93 I;  3KIH A;  4E30 A;  3CCR 1;  2F4M A;  4E2W A;  4BBR I;  4NBG A;  3QWU A;  1ZH1 A;  1N2F A;  3K7A I;  3CPW Y;  3GTQ I;  1YJW Z;  3NH8 A;  1QYP A;  4NBA A;  3CQZ I;  1VQ6 Z;  2YU9 I;  3EER A;  1Q82 1;  4A93 I;  3I4M I;  4A3F I;  1X3W A;  4TNU A;  2Y0S A;  3FQQ A;  1JWH C;  2QRD B;  3GTM I;  2JA5 I;  3KIF A;  5D1O B;  4E31 A;  3G4S 1;  3CC2 Z;  4DGL A;  2JA6 I;  3HOY I;  3I56 Z;  3CPW Z;  5IT9 b;  1M1K 2;  1YJW 1;  4E2Z A;  2V8J A;  1RNI A;  1VQO Z;  3CCV Z;  1VQ6 1;  1Q86 2;  3MON A;  4NB9 A;  2RIQ A;  2VUM I;  4A3M I;  3CCQ Z;  2AKL A;  2Q4Z A;  4MXU A;  4NB8 A;  1JJ2 Y;  3CC2 1;  3I56 1;  3CCL Z;  4MH4 A;  1VQO 1;  1KC8 1;  4NBB A;  3FQM A;  4MRI A;  1VQL Z;  2GU2 A;  3S1Q I;  5AN9 F;  3JAM f;  1X3Z A;  4QTU A;  5T6B A;  3TDH B;  4EWC A;  2LIY A;  1YHQ Z;  2B63 I;  1NUI A;  2E9H A;  1VQK Z;  4DQY B;  3VTN A;  1YJN Z;  3GTL I;  3GTJ I;  3CD6 Z;  1NJI 1;  2I3C A;  2JNY A;  1W2B Y;  4BY1 I;  3J80 b;  1VQL 1;  2HU9 A;  3CCU 1;  3EED A;  2IZ4 A;  4Y7N I;  5A2Q b;  3I4N I;  2QR1 B;  4A3B I;  1YHQ 1;  2OTJ Z;  4RVH A;  4DK1 A;  3ESW A;  5CM2 M;  1Z01 A;  1YUA A;  1YJN 1;  1VQP 1;  4A3L I;  1TWG I;  1L1O C;  5T64 A;  4RVG A;  3CD6 1;  3HOU I;  4S1T A;  2VF1 A;  1W2B Z;  1R9T I;  2OOX B;  1TFI A;  2NVY I;  2Q51 A;  1M90 2;  1K73 1;  2OTL Z;  4BXX I;  3MZL B;  3NFZ A;  5LL6 f;  3CCJ Z;  1YIJ Z;  2OTJ 1;  2QRE B;  1TWA I;  1KD1 1;  3S15 I;  4NBF A;  3J81 b;  3CC7 1;  3VMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...