2G2KA

Nmr structure of an n-terminal fragment of the eukaryotic initiation factor 5 (eif5)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
156
structure length
156
Chain Sequence
LSVNVNRSVMDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5
total genus 18
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2g2kA02
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 2g2kA01
2E9HA 2G2KA 1K8BA
chains in the Genus database with same CATH superfamily
3I4NI 5AQRA 2YU9I 4A3II 1Q16A 2MBKA 4DGLA 2E2JI 1TI5A 1BCGA 1QQNA 1VNAA 2GL1A 1TWCI 2LKBA 1M901 2GTIA 1VQ8Z 3GDQA 1CN2A 2E9HA 3S1RI 2JS4A 2QRCB 3GKQA 2OTL1 3CD6Z 3FQQA 2IZ3A 4A3KI 4V1DC 3LDQA 2QEX1 2EGTA 3JXUA 2LN8A 1P00A 2GU2A 1VQOZ 1SFOI 2E88A 2N69A 3C7NA 1T7BA 1NGHA 3CC21 3EERA 3GTMI 3LUSA 5AQUA 1KQSY 2KSKA 4NB9A 2VY6A 5T67A 4FL9A 4UAFE 3KIHA 2F4MA 2LY6A 4A3DI 3G4SZ 3CCVZ 1VQ4Z 1KD12 4BY1I 3C7NB 5FPDA 1GPTA 5AQPA 4A3CI 1JZAA 2E3FA 2E2FA 2WB1A 1VLAA 1WIIA 2OTLZ 3CD61 3LDPA 1T7AA 2DE5A 4KBOA 3R2VA 2JDQD 1WW9A 1VQ9Z 3CCRZ 1VQ5Z 1JWHC 1T1TA 1YJNZ 3FKII 5FPNA 5FLXb 4MXUA 1DKGD 5IT9f 3CCR1 3IF8A 1Q861 2JA6I 4MD8A 2KI7B 1AHOA 1AYJA 3IR7A 4A3MI 2MN5A 2PK7A 1BRZA 2RHBA 4HGYA 3G6EZ 4HE7A 3G4S1 5D1OA 1ZVEA 1X3ZA 1LQQA 1VQMZ 4UADE 3G711 2N66A 2NY8X 5BPLA 4E32A 5AQIA 4IO8A 2JIMA 5AQSA 1C55A 2N2QA 4Y52I 3CCL1 3PO3S 3K7AI 1I6GA 5LL6f 3OW2Y 2H85A 4XX2A 1QQMA 3CME1 2JA8I 2VF1A 1YHQ1 3HOUI 4BBSI 2QWLA 3IFUA 3T4NB 4RVFA 3CCJ1 3Q87A 1AA6A 4QTUA 2ATBA 2JIOA 5EVZA 5EXWA 2YADA 3L6QA 1W2BZ 3TE5B 2B68A 2RT9A 3CC2Z 2K3RA 3I4MI 1YUKA 2E2HI 1TWFI 4H5RA 3I561 2DE7A 2BRZA 3KIFA 1NGIA 5AQQA 3CC41 2E8AA 1K731 2O4HA 1SN1A 3I56Z 3CCV1 1I6HI 1Q821 3GTQI 1HPMA 3JAMb 1BA1A 3M4OI 2JMOA 1Y1VI 1PE4A 4DK1A 4NBGA 3M3YI 2QWQA 3ESWA 1KQSZ 3S1MI 1KAYA 1Q811 2VPYA 3CXCZ 1I50I 5BN8A 2QWNA 1VQL1 2P28A 3D2LA 3SF4D 3M3ZA 4RVGA 5CY0A 5D1OB 1VQPZ 2B3CA 3HKZA 1FDOA 2QWRA 1VQNZ 1NGCA 3L56A 1YJW1 3S17I 3KOYA 4H5WA 2KGQA 1TFIA 2RPRA 4HHFA 1VQN1 5EX5A 3FZHA 3F3PC 2IV2X 1Q822 1SEGA 4CL1A 3CPWZ 2YILA 2YIOA 3FZMA 2QA41 1BK8A 5BPNA 5AN9F 2KBHA 1VQ51 5AQZA 4RV9A 1ML8A 4NBEA 2LT8A 1DJTA 5AQTA 1JKZA 3HOYI 4NBAA 1PFTA 2V3VA 1I6FA 2N2RA 2GTHA 1N2FA 3J81f 3GL1A 1YHQZ 1VQLZ 3FZFA 1T0ZA 1ATRA 2OTJ1 4H5VA 1ZU3A 3MZKB 1OMYA 1WCMI 2RIQA 3KOXA 5C44I 1NGBA 5AQHA 4S1TA 5IT9b 3QFUA 1QVGZ 3P5JB 2R6MA 2OOXB 2VPXA 3TDHB 1K8A1 3NH4A 4AEIA 3BG0B 1VQK1 3E7RL 2VPWA 1KAXA 1Z02A 1ZUTA 3GKUA 2QLVB 3D9XA 1YJ9Z 2QA4Z 4MONA 3F3FC 2BJOA 4X6AI 3D6WA 1NJI1 1NJI2 1YIJZ 2QWPA 4HWIA 1XRSB 5T6BA 4E2ZA 2JIPA 4A3BI 2NY9X 1VNBA 1NGAA 2QWMA 3PO3I 2MZ0A 3KP0A 1NGEA 2W04A 1Q7Y1 1RLYA 3MONA 2QKDA 1YJWZ 2JIQA 3S1NI 3CCJZ 2LIYA 1GPSA 1VQO1 3FQMA 1M902 1NGDA 1X0TA 1WZNA 1NRAA 1X3WA 3H0GI 1HX1A 3QFPA 4FSVA 1P0AA 2A7TA 1K8BA 3I07A 2NVQI 2AYDA 1FH3A 1Z01A 2JA7I 2KPYA 1CHZA 4RVHA 3CXCY 1NE5A 2K35A 2R7ZI 3CMEZ 2IZ4A 1YIJ1 1ZYWA 4E30A 5BN9A 2QWOA 5EY4A 5AQXA 3IUCA 1Q862 3CMA1 5D1PA 3CCE1 3HOVI 3S16I 1NRBA 3CCUZ 3GTPI 1NPIA 1RO2A 4CQKA 3KC6A 3CCU1 2G2KA 3HOZI 4A3GI 1SNBA 2E7ZA 2KPIA 4NBFA 2VUGA 5AQYA 1VQ81 3GTOI 3GTKI 1P9NA 4AB0A 1WJ2A 1WMTA 3VTNA 3J81b 1ATSA 2KJAA 2D56A 4NOZA 1POIA 4H5NA 2B63I 1QVFY 2LY5A 4UAEF 3CCQZ 4NH1C 3BG1B 1YI21 3CCM1 4MH4A 1Y8CA 1ZH1A 2PM9A 1VQ91 4MRIA 1LQIA 4EWCA 4A93I 3KOWA 3NDJA 2M48A 4TNUA 1QVGY 3ATUA 5AQGA 3PO2I 3HOXI 5C3EI 3CQZI 1USPB 2ZAEB 2E3GA 2VUMI 2YIPA 2V7ZA 3D2EB 5AQWA 1KC82 1YITZ 1TWHI 4MD9A 3G71Z 1ZYVA 3ATVA 5FLMI 5A2Qb 3VB9A 1C56A 3J7A4 2WAQA 2JA5I 1LQHA 2Q51A 3G6E1 3CC4Z 3S14I 5AQNA 3LDNA 2NAPA 4BBRI 1YJ91 2QEXZ 2R92I 5KK4A 3QI7A 2KYQA 3KHWA 1QYPA 2QRDB 4A3LI 1S7MA 3FZKA 4AYBA 1ICAA 1ZVGA 1JJ2Y 2KHOA 5C4XI 5F0XA 2RBLA 2VPZA 4BY7I 1DQ7A 3GCFA 1RNIA 3KP1A 2JUBA 4E31A 5AQLA 3VMHA 3GTJI 2DE6A 1FDIA 1S72Z 1N4NA 4E2WA 1JJ2Z 1NH5A 1K732 3BK3C 1UGLA 2JR6A 1I2UA 3MZLB 2YEOA 3GTLI 2LJMA 2QW9A 3CQXA 2V45A 1HJOA 2E0HA 3RZDI 1TWGI 3GTMS 3L4IA 1B3CA 2HF1A 3NH5A 1Z03A 1ZB8A 1K9M2 1M1K1 3EEDA 3CCQ1 2P3YA 4NBBA 3CCEZ 2LEXA 2NVXI 2I3CA 3CMAZ 3S1QI 3CW4A 1KD11 1NUIA 4NBDA 2LI7A 5AR0A 3QWUA 4MD7A 1B7DA 4Y7NI 2E2II 3CCSZ 4GNIA 3J80b 2O53A 1JXCA 1RQFA 3KVGA 3I551 1ZB9A 1KV0A 3J80f 5F2RA 1N8R1 1NGJA 2LR3A 1YIT1 2V8KA 1K8A2 3D2FA 4UJ0A 1KC81 5AQKA 5T64A 4A3FI 2KBJA 3CC71 3KOZA 2OZKA 3U50C 3HOWI 5C4JI 2M8BB 5AQOA 1VQ61 1W2BY 5IP7I 2BUPA 2Y0SA 2QXLA 2HU9A 4E33A 3LDLA 1VQ6Z 1JZBA 4NB8A 1OZZA 3E7UX 1RO4A 2V8JA 2V8IA 2GMOA 5AQFA 2J6AA 2JNYA 1QVFZ 1YI2Z 4NBHA 1VQP1 1NGGA 1SIWA 2YBRC 1YUWA 5IP9I 4RS4A 1ZFUA 3FZLA 2OTJZ 2NVYI 1BMRA 1I3QI 3NFZA 2SN3A 2M6NA 3LDOA 3D2EA 2R93I 4NBCA 1WWNA 4A3JI 3S15I 1USPA 3RZOI 2KBKA 1Y1WI 2PMZA 5AQMA 4H5TA 3VMGA 3S2HI 4KYPA 5FPEA 3CC7Z 1MR4A 3HSCA 5FPMA 4E2XA 4DQYB 1LQLA 1N8R2 5BPMA 5F1XA 1K9M1 1M1K2 1K83I 1KRLA 1R9TI 1VQ71 4QTTA 1Q812 1I2VA 3CPWY 5A2Qf 5CM2M 1TWAI 4NFRA 2I61A 1L4VA 3JAMf 5AQJA 3I33A 3QMLA 1DL6A 3CCS1 3GTGI 4RVDA 1KAZA 1MYNA 1YUAA 3D2FB 1PX9A 1NGFA 4E2YA 1VQ41 3NH8A 1QF8A 4HH4A 2AKLA 2LFUA 1S721 3S2DI 2QREB 2W03A 1BUPA 1WT7A 1RO0A 2NVTI 3PSMA 1QQOA 3A8YA 3IX0A 2OOYB 5FLXf 2ASCA 1VQM1 2F4OA 1VQKZ 2LJ7A 4A3EI 2K5RA 1PTXA 1S3XA 2YC1C 5AQVA 1T7EA 3NDIA 3CCLZ 1Y1VS 1Q7Y2 1NP6A 1VQ7Z 1BA0A 3AY9A 3FE1A 1L1OC 4HGZA 2QR1B 2JIRA 3CCMZ 3I55Z 4BXXI 1SN4A 3H3VJ 1QXFA 2Q4ZA 4AAZA 3VMIA 1YJN1 3OW2Z
chains in the Genus database with same CATH topology
3I4NI 2YU9I 4A3II 4DGLA 2E2JI 1TWCI 1M901 2GTIA 1VQ8Z 2E9HA 3S1RI 2JS4A 2QRCB 3GKQA 2OTL1 3CD6Z 3FQQA 2IZ3A 4A3KI 2QEX1 2EGTA 2GU2A 1VQOZ 1SFOI 3CC21 3EERA 3GTMI 3LUSA 1KQSY 4NB9A 5T67A 3KIHA 2F4MA 4A3DI 3G4SZ 3CCVZ 1VQ4Z 1KD12 4BY1I 4A3CI 2WB1A 1VLAA 1WIIA 2OTLZ 3CD61 2DE5A 1WW9A 1VQ9Z 3CCRZ 1VQ5Z 1JWHC 1YJNZ 3FKII 5FLXb 4MXUA 5IT9f 3CCR1 3IF8A 1Q861 2JA6I 4MD8A 2KI7B 4A3MI 2PK7A 2RHBA 4HGYA 3G6EZ 3G4S1 5D1OA 1X3ZA 1VQMZ 3G711 4E32A 4Y52I 3CCL1 3PO3S 3K7AI 5LL6f 3OW2Y 2H85A 4XX2A 3CME1 2JA8I 2VF1A 1YHQ1 3HOUI 4BBSI 3IFUA 3T4NB 4RVFA 3CCJ1 3Q87A 4QTUA 2YADA 1W2BZ 3TE5B 2RT9A 3CC2Z 2K3RA 3I4MI 1YUKA 2E2HI 1TWFI 3I561 2DE7A 3KIFA 3CC41 1K731 2O4HA 3I56Z 3CCV1 1I6HI 1Q821 3GTQI 3JAMb 3M4OI 2JMOA 1Y1VI 4DK1A 4NBGA 3M3YI 3ESWA 1KQSZ 3S1MI 1Q811 3CXCZ 1I50I 1VQL1 2P28A 4RVGA 5D1OB 1VQPZ 3HKZA 1VQNZ 1YJW1 3S17I 1TFIA 2RPRA 1VQN1 3F3PC 1Q822 4CL1A 3CPWZ 2QA41 5AN9F 1VQ51 4RV9A 1ML8A 4NBEA 3HOYI 4NBAA 1PFTA 2GTHA 1N2FA 3J81f 1YHQZ 1VQLZ 2OTJ1 3MZKB 1WCMI 2RIQA 5C44I 4S1TA 5IT9b 1QVGZ 3P5JB 2R6MA 2OOXB 3TDHB 1K8A1 3NH4A 3BG0B 1VQK1 1Z02A 2QLVB 3D9XA 1YJ9Z 2QA4Z 4MONA 3F3FC 2BJOA 4X6AI 3D6WA 1NJI1 1NJI2 1YIJZ 5T6BA 4E2ZA 4A3BI 3PO3I 1Q7Y1 2W04A 1RLYA 3MONA 2QKDA 1YJWZ 3S1NI 3CCJZ 2LIYA 1VQO1 3FQMA 1M902 1X0TA 1X3WA 3H0GI 1K8BA 3I07A 2NVQI 1Z01A 2JA7I 4RVHA 3CXCY 2R7ZI 3CMEZ 2IZ4A 1YIJ1 4E30A 1Q862 3CMA1 5D1PA 3CCE1 3HOVI 3S16I 3CCUZ 3GTPI 1RO2A 3CCU1 2G2KA 3HOZI 4A3GI 2KPIA 4NBFA 2VUGA 1VQ81 3GTOI 3GTKI 1P9NA 3VTNA 3J81b 4NOZA 2B63I 1QVFY 3CCQZ 4NH1C 3BG1B 1YI21 3CCM1 4MH4A 1ZH1A 2PM9A 1VQ91 4MRIA 4EWCA 4A93I 3NDJA 2M48A 4TNUA 1QVGY 3PO2I 3HOXI 5C3EI 3CQZI 1USPB 2ZAEB 2VUMI 1KC82 1YITZ 1TWHI 4MD9A 3G71Z 5FLMI 5A2Qb 3VB9A 3J7A4 2WAQA 2JA5I 2Q51A 3G6E1 3CC4Z 3S14I 4BBRI 1YJ91 2QEXZ 2R92I 1QYPA 2QRDB 4A3LI 1S7MA 4AYBA 1JJ2Y 5C4XI 2RBLA 4BY7I 3GCFA 1RNIA 2JUBA 4E31A 3VMHA 3GTJI 2DE6A 1S72Z 4E2WA 1JJ2Z 1K732 2JR6A 3MZLB 3GTLI 3RZDI 1TWGI 3GTMS 2HF1A 3NH5A 1Z03A 1ZB8A 1K9M2 1M1K1 3EEDA 3CCQ1 2P3YA 4NBBA 3CCEZ 2NVXI 2I3CA 3CMAZ 3S1QI 1KD11 1NUIA 4NBDA 3QWUA 4MD7A 4Y7NI 2E2II 3CCSZ 3J80b 2O53A 1RQFA 3I551 1ZB9A 3J80f 1N8R1 1YIT1 2V8KA 1K8A2 1KC81 5T64A 4A3FI 3CC71 2OZKA 3U50C 3HOWI 5C4JI 1VQ61 1W2BY 5IP7I 2Y0SA 2HU9A 4E33A 1VQ6Z 4NB8A 1RO4A 2V8JA 2V8IA 2J6AA 2JNYA 1QVFZ 1YI2Z 4NBHA 1VQP1 5IP9I 4RS4A 2OTJZ 2NVYI 1I3QI 3NFZA 2M6NA 2R93I 4NBCA 4A3JI 3S15I 1USPA 3RZOI 1Y1WI 2PMZA 3VMGA 3S2HI 3CC7Z 4E2XA 4DQYB 1LQLA 1N8R2 1K9M1 1M1K2 1K83I 1KRLA 1R9TI 1VQ71 4QTTA 1Q812 3CPWY 5A2Qf 5CM2M 1TWAI 4NFRA 3JAMf 1DL6A 3CCS1 3GTGI 4RVDA 1YUAA 4E2YA 1VQ41 3NH8A 1QF8A 4HH4A 2AKLA 2LFUA 1S721 3S2DI 2QREB 2W03A 1RO0A 2NVTI 3IX0A 2OOYB 5FLXf 1VQM1 2F4OA 1VQKZ 4A3EI 2K5RA 3NDIA 3CCLZ 1Y1VS 1Q7Y2 1NP6A 1VQ7Z 1L1OC 4HGZA 2QR1B 3CCMZ 3I55Z 4BXXI 3H3VJ 2Q4ZA 3VMIA 1YJN1 3OW2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9H A;  2G2K A;  1K8B A; 
#chains in the Genus database with same CATH topology
 3I4N I;  5AQR A;  2YU9 I;  4A3I I;  1Q16 A;  2MBK A;  4DGL A;  2E2J I;  1TI5 A;  1BCG A;  1QQN A;  1VNA A;  2GL1 A;  1TWC I;  2LKB A;  1M90 1;  2GTI A;  1VQ8 Z;  3GDQ A;  1CN2 A;  2E9H A;  3S1R I;  2JS4 A;  2QRC B;  3GKQ A;  2OTL 1;  3CD6 Z;  3FQQ A;  2IZ3 A;  4A3K I;  4V1D C;  3LDQ A;  2QEX 1;  2EGT A;  3JXU A;  2LN8 A;  1P00 A;  2GU2 A;  1VQO Z;  1SFO I;  2E88 A;  2N69 A;  3C7N A;  1T7B A;  1NGH A;  3CC2 1;  3EER A;  3GTM I;  3LUS A;  5AQU A;  1KQS Y;  2KSK A;  4NB9 A;  2VY6 A;  5T67 A;  4FL9 A;  4UAF E;  3KIH A;  2F4M A;  2LY6 A;  4A3D I;  3G4S Z;  3CCV Z;  1VQ4 Z;  1KD1 2;  4BY1 I;  3C7N B;  5FPD A;  1GPT A;  5AQP A;  4A3C I;  1JZA A;  2E3F A;  2E2F A;  2WB1 A;  1VLA A;  1WII A;  2OTL Z;  3CD6 1;  3LDP A;  1T7A A;  2DE5 A;  4KBO A;  3R2V A;  2JDQ D;  1WW9 A;  1VQ9 Z;  3CCR Z;  1VQ5 Z;  1JWH C;  1T1T A;  1YJN Z;  3FKI I;  5FPN A;  5FLX b;  4MXU A;  1DKG D;  5IT9 f;  3CCR 1;  3IF8 A;  1Q86 1;  2JA6 I;  4MD8 A;  2KI7 B;  1AHO A;  1AYJ A;  3IR7 A;  4A3M I;  2MN5 A;  2PK7 A;  1BRZ A;  2RHB A;  4HGY A;  3G6E Z;  4HE7 A;  3G4S 1;  5D1O A;  1ZVE A;  1X3Z A;  1LQQ A;  1VQM Z;  4UAD E;  3G71 1;  2N66 A;  2NY8 X;  5BPL A;  4E32 A;  5AQI A;  4IO8 A;  2JIM A;  5AQS A;  1C55 A;  2N2Q A;  4Y52 I;  3CCL 1;  3PO3 S;  3K7A I;  1I6G A;  5LL6 f;  3OW2 Y;  2H85 A;  4XX2 A;  1QQM A;  3CME 1;  2JA8 I;  2VF1 A;  1YHQ 1;  3HOU I;  4BBS I;  2QWL A;  3IFU A;  3T4N B;  4RVF A;  3CCJ 1;  3Q87 A;  1AA6 A;  4QTU A;  2ATB A;  2JIO A;  5EVZ A;  5EXW A;  2YAD A;  3L6Q A;  1W2B Z;  3TE5 B;  2B68 A;  2RT9 A;  3CC2 Z;  2K3R A;  3I4M I;  1YUK A;  2E2H I;  1TWF I;  4H5R A;  3I56 1;  2DE7 A;  2BRZ A;  3KIF A;  1NGI A;  5AQQ A;  3CC4 1;  2E8A A;  1K73 1;  2O4H A;  1SN1 A;  3I56 Z;  3CCV 1;  1I6H I;  1Q82 1;  3GTQ I;  1HPM A;  3JAM b;  1BA1 A;  3M4O I;  2JMO A;  1Y1V I;  1PE4 A;  4DK1 A;  4NBG A;  3M3Y I;  2QWQ A;  3ESW A;  1KQS Z;  3S1M I;  1KAY A;  1Q81 1;  2VPY A;  3CXC Z;  1I50 I;  5BN8 A;  2QWN A;  1VQL 1;  2P28 A;  3D2L A;  3SF4 D;  3M3Z A;  4RVG A;  5CY0 A;  5D1O B;  1VQP Z;  2B3C A;  3HKZ A;  1FDO A;  2QWR A;  1VQN Z;  1NGC A;  3L56 A;  1YJW 1;  3S17 I;  3KOY A;  4H5W A;  2KGQ A;  1TFI A;  2RPR A;  4HHF A;  1VQN 1;  5EX5 A;  3FZH A;  3F3P C;  2IV2 X;  1Q82 2;  1SEG A;  4CL1 A;  3CPW Z;  2YIL A;  2YIO A;  3FZM A;  2QA4 1;  1BK8 A;  5BPN A;  5AN9 F;  2KBH A;  1VQ5 1;  5AQZ A;  4RV9 A;  1ML8 A;  4NBE A;  2LT8 A;  1DJT A;  5AQT A;  1JKZ A;  3HOY I;  4NBA A;  1PFT A;  2V3V A;  1I6F A;  2N2R A;  2GTH A;  1N2F A;  3J81 f;  3GL1 A;  1YHQ Z;  1VQL Z;  3FZF A;  1T0Z A;  1ATR A;  2OTJ 1;  4H5V A;  1ZU3 A;  3MZK B;  1OMY A;  1WCM I;  2RIQ A;  3KOX A;  5C44 I;  1NGB A;  5AQH A;  4S1T A;  5IT9 b;  3QFU A;  1QVG Z;  3P5J B;  2R6M A;  2OOX B;  2VPX A;  3TDH B;  1K8A 1;  3NH4 A;  4AEI A;  3BG0 B;  1VQK 1;  3E7R L;  2VPW A;  1KAX A;  1Z02 A;  1ZUT A;  3GKU A;  2QLV B;  3D9X A;  1YJ9 Z;  2QA4 Z;  4MON A;  3F3F C;  2BJO A;  4X6A I;  3D6W A;  1NJI 1;  1NJI 2;  1YIJ Z;  2QWP A;  4HWI A;  1XRS B;  5T6B A;  4E2Z A;  2JIP A;  4A3B I;  2NY9 X;  1VNB A;  1NGA A;  2QWM A;  3PO3 I;  2MZ0 A;  3KP0 A;  1NGE A;  2W04 A;  1Q7Y 1;  1RLY A;  3MON A;  2QKD A;  1YJW Z;  2JIQ A;  3S1N I;  3CCJ Z;  2LIY A;  1GPS A;  1VQO 1;  3FQM A;  1M90 2;  1NGD A;  1X0T A;  1WZN A;  1NRA A;  1X3W A;  3H0G I;  1HX1 A;  3QFP A;  4FSV A;  1P0A A;  2A7T A;  1K8B A;  3I07 A;  2NVQ I;  2AYD A;  1FH3 A;  1Z01 A;  2JA7 I;  2KPY A;  1CHZ A;  4RVH A;  3CXC Y;  1NE5 A;  2K35 A;  2R7Z I;  3CME Z;  2IZ4 A;  1YIJ 1;  1ZYW A;  4E30 A;  5BN9 A;  2QWO A;  5EY4 A;  5AQX A;  3IUC A;  1Q86 2;  3CMA 1;  5D1P A;  3CCE 1;  3HOV I;  3S16 I;  1NRB A;  3CCU Z;  3GTP I;  1NPI A;  1RO2 A;  4CQK A;  3KC6 A;  3CCU 1;  2G2K A;  3HOZ I;  4A3G I;  1SNB A;  2E7Z A;  2KPI A;  4NBF A;  2VUG A;  5AQY A;  1VQ8 1;  3GTO I;  3GTK I;  1P9N A;  4AB0 A;  1WJ2 A;  1WMT A;  3VTN A;  3J81 b;  1ATS A;  2KJA A;  2D56 A;  4NOZ A;  1POI A;  4H5N A;  2B63 I;  1QVF Y;  2LY5 A;  4UAE F;  3CCQ Z;  4NH1 C;  3BG1 B;  1YI2 1;  3CCM 1;  4MH4 A;  1Y8C A;  1ZH1 A;  2PM9 A;  1VQ9 1;  4MRI A;  1LQI A;  4EWC A;  4A93 I;  3KOW A;  3NDJ A;  2M48 A;  4TNU A;  1QVG Y;  3ATU A;  5AQG A;  3PO2 I;  3HOX I;  5C3E I;  3CQZ I;  1USP B;  2ZAE B;  2E3G A;  2VUM I;  2YIP A;  2V7Z A;  3D2E B;  5AQW A;  1KC8 2;  1YIT Z;  1TWH I;  4MD9 A;  3G71 Z;  1ZYV A;  3ATV A;  5FLM I;  5A2Q b;  3VB9 A;  1C56 A;  3J7A 4;  2WAQ A;  2JA5 I;  1LQH A;  2Q51 A;  3G6E 1;  3CC4 Z;  3S14 I;  5AQN A;  3LDN A;  2NAP A;  4BBR I;  1YJ9 1;  2QEX Z;  2R92 I;  5KK4 A;  3QI7 A;  2KYQ A;  3KHW A;  1QYP A;  2QRD B;  4A3L I;  1S7M A;  3FZK A;  4AYB A;  1ICA A;  1ZVG A;  1JJ2 Y;  2KHO A;  5C4X I;  5F0X A;  2RBL A;  2VPZ A;  4BY7 I;  1DQ7 A;  3GCF A;  1RNI A;  3KP1 A;  2JUB A;  4E31 A;  5AQL A;  3VMH A;  3GTJ I;  2DE6 A;  1FDI A;  1S72 Z;  1N4N A;  4E2W A;  1JJ2 Z;  1NH5 A;  1K73 2;  3BK3 C;  1UGL A;  2JR6 A;  1I2U A;  3MZL B;  2YEO A;  3GTL I;  2LJM A;  2QW9 A;  3CQX A;  2V45 A;  1HJO A;  2E0H A;  3RZD I;  1TWG I;  3GTM S;  3L4I A;  1B3C A;  2HF1 A;  3NH5 A;  1Z03 A;  1ZB8 A;  1K9M 2;  1M1K 1;  3EED A;  3CCQ 1;  2P3Y A;  4NBB A;  3CCE Z;  2LEX A;  2NVX I;  2I3C A;  3CMA Z;  3S1Q I;  3CW4 A;  1KD1 1;  1NUI A;  4NBD A;  2LI7 A;  5AR0 A;  3QWU A;  4MD7 A;  1B7D A;  4Y7N I;  2E2I I;  3CCS Z;  4GNI A;  3J80 b;  2O53 A;  1JXC A;  1RQF A;  3KVG A;  3I55 1;  1ZB9 A;  1KV0 A;  3J80 f;  5F2R A;  1N8R 1;  1NGJ A;  2LR3 A;  1YIT 1;  2V8K A;  1K8A 2;  3D2F A;  4UJ0 A;  1KC8 1;  5AQK A;  5T64 A;  4A3F I;  2KBJ A;  3CC7 1;  3KOZ A;  2OZK A;  3U50 C;  3HOW I;  5C4J I;  2M8B B;  5AQO A;  1VQ6 1;  1W2B Y;  5IP7 I;  2BUP A;  2Y0S A;  2QXL A;  2HU9 A;  4E33 A;  3LDL A;  1VQ6 Z;  1JZB A;  4NB8 A;  1OZZ A;  3E7U X;  1RO4 A;  2V8J A;  2V8I A;  2GMO A;  5AQF A;  2J6A A;  2JNY A;  1QVF Z;  1YI2 Z;  4NBH A;  1VQP 1;  1NGG A;  1SIW A;  2YBR C;  1YUW A;  5IP9 I;  4RS4 A;  1ZFU A;  3FZL A;  2OTJ Z;  2NVY I;  1BMR A;  1I3Q I;  3NFZ A;  2SN3 A;  2M6N A;  3LDO A;  3D2E A;  2R93 I;  4NBC A;  1WWN A;  4A3J I;  3S15 I;  1USP A;  3RZO I;  2KBK A;  1Y1W I;  2PMZ A;  5AQM A;  4H5T A;  3VMG A;  3S2H I;  4KYP A;  5FPE A;  3CC7 Z;  1MR4 A;  3HSC A;  5FPM A;  4E2X A;  4DQY B;  1LQL A;  1N8R 2;  5BPM A;  5F1X A;  1K9M 1;  1M1K 2;  1K83 I;  1KRL A;  1R9T I;  1VQ7 1;  4QTT A;  1Q81 2;  1I2V A;  3CPW Y;  5A2Q f;  5CM2 M;  1TWA I;  4NFR A;  2I61 A;  1L4V A;  3JAM f;  5AQJ A;  3I33 A;  3QML A;  1DL6 A;  3CCS 1;  3GTG I;  4RVD A;  1KAZ A;  1MYN A;  1YUA A;  3D2F B;  1PX9 A;  1NGF A;  4E2Y A;  1VQ4 1;  3NH8 A;  1QF8 A;  4HH4 A;  2AKL A;  2LFU A;  1S72 1;  3S2D I;  2QRE B;  2W03 A;  1BUP A;  1WT7 A;  1RO0 A;  2NVT I;  3PSM A;  1QQO A;  3A8Y A;  3IX0 A;  2OOY B;  5FLX f;  2ASC A;  1VQM 1;  2F4O A;  1VQK Z;  2LJ7 A;  4A3E I;  2K5R A;  1PTX A;  1S3X A;  2YC1 C;  5AQV A;  1T7E A;  3NDI A;  3CCL Z;  1Y1V S;  1Q7Y 2;  1NP6 A;  1VQ7 Z;  1BA0 A;  3AY9 A;  3FE1 A;  1L1O C;  4HGZ A;  2QR1 B;  2JIR A;  3CCM Z;  3I55 Z;  4BXX I;  1SN4 A;  3H3V J;  1QXF A;  2Q4Z A;  4AAZ A;  3VMI A;  1YJN 1;  3OW2 Z; 
#chains in the Genus database with same CATH homology
 3I4N I;  2YU9 I;  4A3I I;  4DGL A;  2E2J I;  1TWC I;  1M90 1;  2GTI A;  1VQ8 Z;  2E9H A;  3S1R I;  2JS4 A;  2QRC B;  3GKQ A;  2OTL 1;  3CD6 Z;  3FQQ A;  2IZ3 A;  4A3K I;  2QEX 1;  2EGT A;  2GU2 A;  1VQO Z;  1SFO I;  3CC2 1;  3EER A;  3GTM I;  3LUS A;  1KQS Y;  4NB9 A;  5T67 A;  3KIH A;  2F4M A;  4A3D I;  3G4S Z;  3CCV Z;  1VQ4 Z;  1KD1 2;  4BY1 I;  4A3C I;  2WB1 A;  1VLA A;  1WII A;  2OTL Z;  3CD6 1;  2DE5 A;  1WW9 A;  1VQ9 Z;  3CCR Z;  1VQ5 Z;  1JWH C;  1YJN Z;  3FKI I;  5FLX b;  4MXU A;  5IT9 f;  3CCR 1;  3IF8 A;  1Q86 1;  2JA6 I;  4MD8 A;  2KI7 B;  4A3M I;  2PK7 A;  2RHB A;  4HGY A;  3G6E Z;  3G4S 1;  5D1O A;  1X3Z A;  1VQM Z;  3G71 1;  4E32 A;  4Y52 I;  3CCL 1;  3PO3 S;  3K7A I;  5LL6 f;  3OW2 Y;  2H85 A;  4XX2 A;  3CME 1;  2JA8 I;  2VF1 A;  1YHQ 1;  3HOU I;  4BBS I;  3IFU A;  3T4N B;  4RVF A;  3CCJ 1;  3Q87 A;  4QTU A;  2YAD A;  1W2B Z;  3TE5 B;  2RT9 A;  3CC2 Z;  2K3R A;  3I4M I;  1YUK A;  2E2H I;  1TWF I;  3I56 1;  2DE7 A;  3KIF A;  3CC4 1;  1K73 1;  2O4H A;  3I56 Z;  3CCV 1;  1I6H I;  1Q82 1;  3GTQ I;  3JAM b;  3M4O I;  2JMO A;  1Y1V I;  4DK1 A;  4NBG A;  3M3Y I;  3ESW A;  1KQS Z;  3S1M I;  1Q81 1;  3CXC Z;  1I50 I;  1VQL 1;  2P28 A;  4RVG A;  5D1O B;  1VQP Z;  3HKZ A;  1VQN Z;  1YJW 1;  3S17 I;  1TFI A;  2RPR A;  1VQN 1;  3F3P C;  1Q82 2;  4CL1 A;  3CPW Z;  2QA4 1;  5AN9 F;  1VQ5 1;  4RV9 A;  1ML8 A;  4NBE A;  3HOY I;  4NBA A;  1PFT A;  2GTH A;  1N2F A;  3J81 f;  1YHQ Z;  1VQL Z;  2OTJ 1;  3MZK B;  1WCM I;  2RIQ A;  5C44 I;  4S1T A;  5IT9 b;  1QVG Z;  3P5J B;  2R6M A;  2OOX B;  3TDH B;  1K8A 1;  3NH4 A;  3BG0 B;  1VQK 1;  1Z02 A;  2QLV B;  3D9X A;  1YJ9 Z;  2QA4 Z;  4MON A;  3F3F C;  2BJO A;  4X6A I;  3D6W A;  1NJI 1;  1NJI 2;  1YIJ Z;  5T6B A;  4E2Z A;  4A3B I;  3PO3 I;  1Q7Y 1;  2W04 A;  1RLY A;  3MON A;  2QKD A;  1YJW Z;  3S1N I;  3CCJ Z;  2LIY A;  1VQO 1;  3FQM A;  1M90 2;  1X0T A;  1X3W A;  3H0G I;  1K8B A;  3I07 A;  2NVQ I;  1Z01 A;  2JA7 I;  4RVH A;  3CXC Y;  2R7Z I;  3CME Z;  2IZ4 A;  1YIJ 1;  4E30 A;  1Q86 2;  3CMA 1;  5D1P A;  3CCE 1;  3HOV I;  3S16 I;  3CCU Z;  3GTP I;  1RO2 A;  3CCU 1;  2G2K A;  3HOZ I;  4A3G I;  2KPI A;  4NBF A;  2VUG A;  1VQ8 1;  3GTO I;  3GTK I;  1P9N A;  3VTN A;  3J81 b;  4NOZ A;  2B63 I;  1QVF Y;  3CCQ Z;  4NH1 C;  3BG1 B;  1YI2 1;  3CCM 1;  4MH4 A;  1ZH1 A;  2PM9 A;  1VQ9 1;  4MRI A;  4EWC A;  4A93 I;  3NDJ A;  2M48 A;  4TNU A;  1QVG Y;  3PO2 I;  3HOX I;  5C3E I;  3CQZ I;  1USP B;  2ZAE B;  2VUM I;  1KC8 2;  1YIT Z;  1TWH I;  4MD9 A;  3G71 Z;  5FLM I;  5A2Q b;  3VB9 A;  3J7A 4;  2WAQ A;  2JA5 I;  2Q51 A;  3G6E 1;  3CC4 Z;  3S14 I;  4BBR I;  1YJ9 1;  2QEX Z;  2R92 I;  1QYP A;  2QRD B;  4A3L I;  1S7M A;  4AYB A;  1JJ2 Y;  5C4X I;  2RBL A;  4BY7 I;  3GCF A;  1RNI A;  2JUB A;  4E31 A;  3VMH A;  3GTJ I;  2DE6 A;  1S72 Z;  4E2W A;  1JJ2 Z;  1K73 2;  2JR6 A;  3MZL B;  3GTL I;  3RZD I;  1TWG I;  3GTM S;  2HF1 A;  3NH5 A;  1Z03 A;  1ZB8 A;  1K9M 2;  1M1K 1;  3EED A;  3CCQ 1;  2P3Y A;  4NBB A;  3CCE Z;  2NVX I;  2I3C A;  3CMA Z;  3S1Q I;  1KD1 1;  1NUI A;  4NBD A;  3QWU A;  4MD7 A;  4Y7N I;  2E2I I;  3CCS Z;  3J80 b;  2O53 A;  1RQF A;  3I55 1;  1ZB9 A;  3J80 f;  1N8R 1;  1YIT 1;  2V8K A;  1K8A 2;  1KC8 1;  5T64 A;  4A3F I;  3CC7 1;  2OZK A;  3U50 C;  3HOW I;  5C4J I;  1VQ6 1;  1W2B Y;  5IP7 I;  2Y0S A;  2HU9 A;  4E33 A;  1VQ6 Z;  4NB8 A;  1RO4 A;  2V8J A;  2V8I A;  2J6A A;  2JNY A;  1QVF Z;  1YI2 Z;  4NBH A;  1VQP 1;  5IP9 I;  4RS4 A;  2OTJ Z;  2NVY I;  1I3Q I;  3NFZ A;  2M6N A;  2R93 I;  4NBC A;  4A3J I;  3S15 I;  1USP A;  3RZO I;  1Y1W I;  2PMZ A;  3VMG A;  3S2H I;  3CC7 Z;  4E2X A;  4DQY B;  1LQL A;  1N8R 2;  1K9M 1;  1M1K 2;  1K83 I;  1KRL A;  1R9T I;  1VQ7 1;  4QTT A;  1Q81 2;  3CPW Y;  5A2Q f;  5CM2 M;  1TWA I;  4NFR A;  3JAM f;  1DL6 A;  3CCS 1;  3GTG I;  4RVD A;  1YUA A;  4E2Y A;  1VQ4 1;  3NH8 A;  1QF8 A;  4HH4 A;  2AKL A;  2LFU A;  1S72 1;  3S2D I;  2QRE B;  2W03 A;  1RO0 A;  2NVT I;  3IX0 A;  2OOY B;  5FLX f;  1VQM 1;  2F4O A;  1VQK Z;  4A3E I;  2K5R A;  3NDI A;  3CCL Z;  1Y1V S;  1Q7Y 2;  1NP6 A;  1VQ7 Z;  1L1O C;  4HGZ A;  2QR1 B;  3CCM Z;  3I55 Z;  4BXX I;  3H3V J;  2Q4Z A;  3VMI A;  1YJN 1;  3OW2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...