2G2KA

Nmr structure of an n-terminal fragment of the eukaryotic initiation factor 5 (eif5)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
156
structure length
156
Chain Sequence
b'LSVNVNRSVMDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSDSGTGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5
publication title Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 18
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.350 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2g2kA02
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 2g2kA01
1K8BA 2E9HA 2G2KA
chains in the Genus database with same CATH superfamily
4AB0A 2VPZA 3VMIA 1NGIA 3K7AI 4NB9A 3I33A 5AQRA 1NRBA 2JMOA 4A3JI 5F1XA 4NBCA 1USPB 2N66A 5AQHA 4MXUA 1VQ6Z 2QA4Z 1XRSB 4HGZA 2RT9A 4NBHA 2A7TA 1PTXA 1WJ2A 1VQL1 5EY4A 2NY9X 3KHWA 1JKZA 3GTLI 2LJ7A 1DJTA 1M901 2QWLA 5AQOA 4NFRA 2N2QA 2KI7B 1QQOA 3KOYA 1ZVGA 3CC2Z 1I3QI 2NVTI 2MZ0A 3D2FB 1B7DA 1PFTA 3C7NA 4BXXI 3CCSZ 5FPEA 2RPRA 3J80b 2ZAEB 3CC7Z 1NE5A 2VY6A 4QTUA 1Y1VI 2OTJZ 1VQM1 2MN5A 1YJW1 1BA0A 2M6NA 1AYJA 3TE5B 3HOXI 3PO2I 1YUKA 5AQGA 3J81b 2RIQA 4A93I 4Y7NI 4HGYA 1KQSZ 3KVGA 3SF4D 1Q7Y2 1RO0A 3NH5A 2RHBA 1KAZA 1NGHA 3CW4A 3FZMA 3AY9A 4HE7A 2V45A 1VQOZ 1YHQ1 3BG0B 3CQXA 4E2YA 2IZ4A 1K732 2PK7A 3CCQ1 5EX5A 2LEXA 2HU9A 1ZB9A 1MYNA 2F4OA 2ASCA 4RVFA 1KQSY 5AQWA 2GMOA 3GKUA 2LIYA 1DL6A 3HOYI 3LDLA 5C4XI 3P5JB 2D56A 3CCLZ 1VQLZ 1ZVEA 1SIWA 1I6GA 4H5WA 3CMAZ 5AQUA 4RV9A 3VB9A 2E0HA 1ATSA 5BPNA 3CXCZ 3NH8A 2LR3A 1Y8CA 2K3RA 2YIPA 1Q861 2QEX1 1YIJ1 2BUPA 3CCU1 3GTPI 3FQQA 4A3DI 3KOZA 1S721 3S14I 1YUAA 2QWQA 5LL6f 1NGDA 4DK1A 2E9HA 1VQ41 1ZH1A 2NVQI 3GTQI 1Y1VS 2H85A 5AQFA 3H0GI 1RQFA 2BJOA 1JZBA 1VQMZ 3L6QA 1Z02A 1Q16A 1LQIA 1NGGA 4E30A 1NRAA 3JXUA 3CXCY 1JJ2Z 1QVFY 5D1OA 1HJOA 2K35A 3QFPA 3IUCA 1BCGA 5CM2M 2OOYB 1YHQZ 4HWIA 1TWCI 1T1TA 1T7BA 2KYQA 3S16I 5AQVA 1Q822 4MD7A 4A3LI 2OOXB 3CCQZ 3NH4A 2O53A 2JA8I 1FDOA 1WMTA 5AQJA 1DKGD 1JJ2Y 3RZOI 2E88A 3GKQA 2NVXI 2GU2A 1I50I 3KOXA 3PO3I 2M48A 3CCE1 1YITZ 2JNYA 2K5RA 1LQHA 4MONA 1P0AA 2Q51A 2VUGA 2KBHA 3S2DI 1YUWA 1N8R1 3GTMI 2LY6A 3QWUA 1VQ71 2NVYI 3I55Z 2EGTA 5IT9f 2WAQA 3VMHA 1M1K2 4FSVA 2QWNA 4A3FI 3BK3C 2QEXZ 3H3VJ 1YIJZ 3CCR1 3CCUZ 3RZDI 3ESWA 3CD6Z 1NGFA 4AYBA 1S72Z 5CY0A 2LY5A 5AN9F 2VUMI 3ATVA 2N69A 5FPNA 2GTIA 3CQZI 4BY7I 1N2FA 2GL1A 2E2FA 2Y0SA 3L4IA 3PSMA 3HKZA 2JA5I 4A3BI 1Q7Y1 1B3CA 1P9NA 1W2BY 4H5TA 1GPSA 1TWAI 2V8IA 5IP7I 3CCJ1 1Z01A 1VQ81 4TNUA 2W04A 1AHOA 1K731 3OW2Y 2LN8A 1L1OC 1X3ZA 2SN3A 2JIOA 3R2VA 1NGAA 1NH5A 1S3XA 3CCV1 3VMGA 2O4HA 3PO3S 4CQKA 1WW9A 1T7AA 1Z03A 2JA6I 2JIRA 2V8KA 3JAMb 3I561 1QVGY 4CL1A 3HOZI 5AQYA 2J6AA 1HPMA 5T64A 3GTMS 4NBEA 1VQK1 3GTGI 1CHZA 1VQ9Z 2E3GA 1VQ7Z 2OTL1 1NUIA 3C7NB 2F4MA 2RBLA 3CCRZ 3Q87A 4FL9A 4UAFE 3FZKA 1WT7A 3CC41 1VQ51 2PMZA 1NJI2 3GTJI 4NH1C 1VQNZ 3FZFA 2E3FA 2QWPA 1ICAA 5BN9A 4E2ZA 4A3GI 2V3VA 1I6HI 2JS4A 1N4NA 1Q811 1VQP1 2YBRC 2QXLA 5KK4A 4MD9A 2LJMA 3NDIA 1LQQA 3CCJZ 2QWOA 1K83I 3M4OI 5IT9b 1VQ8Z 3FQMA 4HHFA 4X6AI 2WB1A 1QVFZ 2QRDB 3I4NI 2QREB 2KHOA 4GNIA 5C3EI 2BRZA 2DE7A 1KAXA 2M8BB 1L4VA 3HSCA 3D9XA 2B3CA 4NBFA 3I56Z 5AQNA 1NPIA 2G2KA 3HOVI 4RS4A 3NFZA 3EERA 1YJWZ 4E32A 1VQKZ 2LT8A 3CME1 5EXWA 2JIPA 2OTLZ 1KRLA 1M1K1 1TWGI 1WIIA 4H5NA 4NBAA 3FZLA 1K8A1 3CCM1 3CC4Z 2VPWA 4E2WA 1JZAA 4UAEF 5FLMI 2AYDA 5A2Qf 4H5RA 5AQMA 1BUPA 2R93I 1HX1A 1FDIA 2MBKA 1TWHI 1NGEA 5D1OB 2LFUA 5BPLA 3J80f 4UJ0A 1BK8A 1MR4A 1SNBA 3GL1A 4AEIA 2DE5A 5AQLA 2R6MA 1VQPZ 3J81f 3D2LA 4QTTA 1RLYA 5C44I 3S15I 3L56A 3D2EA 4Y52I 3G4S1 2NY8X 2VF1A 3KC6A 4BBSI 1ZUTA 2GTHA 3GCFA 2N2RA 3S1MI 4S1TA 3CPWZ 2KGQA 1W2BZ 3IFUA 4NBGA 3CC21 1RO2A 3MZKB 4RVGA 3MONA 4RVDA 1VQ4Z 2E2HI 3IX0A 5T6BA 2YIOA 2QWRA 5FLXf 3OW2Z 2E2JI 1ZFUA 3FZHA 2I61A 3LDPA 1C55A 1SN4A 1TFIA 2LKBA 2YC1C 1I2UA 4NBBA 4BBRI 2KSKA 2AKLA 3CMEZ 2OTJ1 4MRIA 1SFOI 3QFUA 3CPWY 4E31A 2V7ZA 3TDHB 2VPYA 4E2XA 1USPA 1JWHC 2V8JA 4AAZA 3CCMZ 3FKII 1QVGZ 5AR0A 2YADA 2E8AA 2JDQD 1VQO1 3GDQA 2NAPA 2ATBA 4NBDA 1ZU3A 1KV0A 4DQYB 1KC82 4RVHA 1TWFI 1KD12 1NGJA 1ZYVA 3LDOA 5AQIA 5AQTA 3MZLB 5F0XA 3CCEZ 4BY1I 1QXFA 3D6WA 2PM9A 2JIQA 3IF8A 2Q4ZA 1R9TI 1WWNA 2B68A 3A8YA 1CN2A 1KAYA 3D2FA 5F2RA 3CCL1 1YJ91 2E7ZA 1ATRA 4V1DC 3G4SZ 1UGLA 4UADE 1N8R2 3CMA1 1DQ7A 2R7ZI 5FPMA 2YEOA 2OZKA 5AQKA 2QRCB 5A2Qb 3E7UX 2VPXA 5C4JI 3ATUA 2JUBA 3G6E1 2KJAA 1YJN1 2YU9I 3HOWI 3QI7A 1K9M2 3KOWA 2KBKA 2IZ3A 2JA7I 3LDNA 5D1PA 2KBJA 4IO8A 2QKDA 2W03A 1LQLA 5T67A 5EVZA 2I3CA 2QW9A 1NGCA 3NDJA 1JXCA 3KIHA 3QMLA 1T7EA 2P28A 4HH4A 1X3WA 3S17I 1WZNA 2YILA 3I07A 5IP9I 1Q821 1M902 3FE1A 4A3KI 3LDQA 1FH3A 5AQQA 5BPMA 1QQMA 3CCVZ 1I6FA 2JIMA 3LUSA 1AA6A 3F3PC 3M3ZA 1SN1A 5FLXb 1BMRA 1YI21 2P3YA 2IV2X 3HOUI 1RNIA 5AQPA 4MH4A 1YIT1 1YJ9Z 3G711 2QLVB 5BN8A 4DGLA 4NB8A 3I551 2KPIA 3GTOI 2KPYA 1BRZA 1BA1A 3T4NB 3IR7A 2LI7A 3F3FC 3E7RL 1VQ5Z 3CD61 1ZYWA 3G6EZ 1Y1WI 1YJNZ 3S1NI 1VLAA 3KP1A 5AQZA 3EEDA 4A3CI 3VTNA 2JR6A 3KIFA 5AQSA 1SEGA 2B63I 3JAMf 4KBOA 1OZZA 1I2VA 1T0ZA 1VQ61 2QA41 1VNAA 1GPTA 1Q812 5AQXA 1ML8A 1NP6A 4EWCA 3S1QI 1K8BA 2QR1B 2QWMA 1PX9A 1OMYA 3U50C 1RO4A 4E33A 3S2HI 1VNBA 1Q862 3GTKI 1QF8A 1KC81 3KP0A 1KD11 1S7MA 4XX2A 2HF1A 1QQNA 1YI2Z 1P00A 3CCS1 1QYPA 1C56A 1WCMI 3D2EB 4A3II 2E2II 5FPDA 3CC71 3G71Z 4A3MI 1TI5A 3I4MI 4MD8A 3S1RI 1PE4A 1ZB8A 4A3EI 2R92I 1VQ91 1X0TA 3M3YI 4KYPA 1POIA 1NGBA 1K8A2 3J7A4 1NJI1 4NOZA 4H5VA 1K9M1 1VQN1 3BG1B 2DE6A
chains in the Genus database with same CATH topology
3VMIA 3K7AI 4NB9A 2JMOA 4A3JI 4NBCA 1USPB 4MXUA 1VQ6Z 2QA4Z 4HGZA 2RT9A 4NBHA 1VQL1 3GTLI 1M901 4NFRA 2KI7B 3CC2Z 1I3QI 2NVTI 1PFTA 4BXXI 3CCSZ 2RPRA 3J80b 2ZAEB 3CC7Z 4QTUA 1Y1VI 2OTJZ 1VQM1 1YJW1 2M6NA 3TE5B 3HOXI 3PO2I 1YUKA 3J81b 2RIQA 4A93I 4Y7NI 4HGYA 1KQSZ 1Q7Y2 1RO0A 3NH5A 2RHBA 1YHQ1 1VQOZ 3BG0B 4E2YA 2IZ4A 1K732 2PK7A 3CCQ1 2HU9A 1ZB9A 2F4OA 4RVFA 1KQSY 2LIYA 1DL6A 3HOYI 5C4XI 3P5JB 3CCLZ 1VQLZ 3CMAZ 4RV9A 3VB9A 3CXCZ 3NH8A 2K3RA 1Q861 2QEX1 1YIJ1 3CCU1 3GTPI 3FQQA 4A3DI 1S721 3S14I 1YUAA 5LL6f 4DK1A 2E9HA 1VQ41 1ZH1A 2NVQI 3GTQI 1Y1VS 2H85A 3H0GI 1RQFA 2BJOA 1VQMZ 1Z02A 4E30A 3CXCY 1JJ2Z 1QVFY 5D1OA 5CM2M 2OOYB 1YHQZ 1TWCI 3S16I 1Q822 4MD7A 4A3LI 2OOXB 3NH4A 3CCQZ 2O53A 2JA8I 1JJ2Y 3RZOI 3GKQA 2NVXI 2GU2A 1I50I 3PO3I 2M48A 3CCE1 1YITZ 2JNYA 2K5RA 4MONA 2Q51A 2VUGA 3S2DI 1N8R1 3GTMI 3QWUA 1VQ71 2NVYI 3I55Z 2EGTA 5IT9f 2WAQA 3VMHA 1M1K2 4A3FI 2QEXZ 3H3VJ 1YIJZ 3CCR1 3CCUZ 3RZDI 3ESWA 3CD6Z 4AYBA 1S72Z 5AN9F 2VUMI 2GTIA 3CQZI 4BY7I 1N2FA 2Y0SA 3HKZA 2JA5I 4A3BI 1Q7Y1 1P9NA 1W2BY 1TWAI 2V8IA 5IP7I 3CCJ1 1Z01A 1VQ81 4TNUA 2W04A 1K731 3OW2Y 1L1OC 1X3ZA 3CCV1 3VMGA 2O4HA 3PO3S 1WW9A 1Z03A 2JA6I 2V8KA 3JAMb 3I561 1QVGY 4CL1A 3HOZI 2J6AA 5T64A 3GTMS 4NBEA 1VQK1 3GTGI 1VQ9Z 1VQ7Z 2OTL1 1NUIA 2F4MA 2RBLA 3CCRZ 3Q87A 3CC41 1VQ51 2PMZA 1NJI2 3GTJI 4NH1C 1VQNZ 4E2ZA 4A3GI 1I6HI 2JS4A 1Q811 1VQP1 4MD9A 3NDIA 3CCJZ 1K83I 3M4OI 5IT9b 1VQ8Z 3FQMA 4X6AI 2WB1A 1QVFZ 2QRDB 3I4NI 2QREB 5C3EI 2DE7A 3D9XA 4NBFA 3I56Z 2G2KA 3HOVI 4RS4A 3NFZA 3EERA 1YJWZ 4E32A 1VQKZ 3CME1 2OTLZ 1KRLA 1M1K1 1TWGI 1WIIA 4NBAA 1K8A1 3CCM1 3CC4Z 4E2WA 5FLMI 5A2Qf 2R93I 1TWHI 5D1OB 2LFUA 3J80f 2DE5A 2R6MA 1VQPZ 3J81f 4QTTA 1RLYA 5C44I 3S15I 4Y52I 3G4S1 2VF1A 4BBSI 2GTHA 3GCFA 3S1MI 4S1TA 3CPWZ 1W2BZ 3IFUA 4NBGA 3CC21 1RO2A 3MZKB 4RVGA 3MONA 4RVDA 1VQ4Z 2E2HI 3IX0A 5T6BA 5FLXf 3OW2Z 2E2JI 1TFIA 4NBBA 4BBRI 2AKLA 3CMEZ 2OTJ1 4MRIA 1SFOI 3CPWY 4E31A 3TDHB 4E2XA 1USPA 1JWHC 2V8JA 3CCMZ 3FKII 1QVGZ 2YADA 1VQO1 4NBDA 4DQYB 1KC82 4RVHA 1TWFI 1KD12 3MZLB 3CCEZ 4BY1I 3D6WA 2PM9A 3IF8A 2Q4ZA 1R9TI 3CCL1 1YJ91 3G4SZ 1N8R2 3CMA1 2R7ZI 2OZKA 2QRCB 5A2Qb 5C4JI 2JUBA 3G6E1 1YJN1 2YU9I 3HOWI 1K9M2 2IZ3A 2JA7I 5D1PA 2QKDA 2W03A 1LQLA 5T67A 2I3CA 3NDJA 3KIHA 2P28A 4HH4A 1X3WA 3S17I 3I07A 5IP9I 1Q821 1M902 4A3KI 3CCVZ 3LUSA 3F3PC 5FLXb 1YI21 2P3YA 3HOUI 1RNIA 4MH4A 1YIT1 1YJ9Z 3G711 2QLVB 4DGLA 4NB8A 3I551 2KPIA 3GTOI 3T4NB 3F3FC 1VQ5Z 3CD61 3G6EZ 1Y1WI 1YJNZ 3S1NI 1VLAA 3EEDA 4A3CI 3VTNA 2JR6A 3KIFA 2B63I 3JAMf 1VQ61 2QA41 1Q812 1ML8A 1NP6A 4EWCA 3S1QI 1K8BA 2QR1B 3U50C 1RO4A 4E33A 3S2HI 1Q862 3GTKI 1QF8A 1KC81 1KD11 1S7MA 4XX2A 2HF1A 1YI2Z 3CCS1 1QYPA 1WCMI 4A3II 2E2II 3CC71 3G71Z 4A3MI 3I4MI 4MD8A 3S1RI 1ZB8A 4A3EI 2R92I 1VQ91 1X0TA 3M3YI 1K8A2 3J7A4 1NJI1 4NOZA 1K9M1 1VQN1 3BG1B 2DE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8B A;  2E9H A;  2G2K A; 
#chains in the Genus database with same CATH topology
 4AB0 A;  2VPZ A;  3VMI A;  1NGI A;  3K7A I;  4NB9 A;  3I33 A;  5AQR A;  1NRB A;  2JMO A;  4A3J I;  5F1X A;  4NBC A;  1USP B;  2N66 A;  5AQH A;  4MXU A;  1VQ6 Z;  2QA4 Z;  1XRS B;  4HGZ A;  2RT9 A;  4NBH A;  2A7T A;  1PTX A;  1WJ2 A;  1VQL 1;  5EY4 A;  2NY9 X;  3KHW A;  1JKZ A;  3GTL I;  2LJ7 A;  1DJT A;  1M90 1;  2QWL A;  5AQO A;  4NFR A;  2N2Q A;  2KI7 B;  1QQO A;  3KOY A;  1ZVG A;  3CC2 Z;  1I3Q I;  2NVT I;  2MZ0 A;  3D2F B;  1B7D A;  1PFT A;  3C7N A;  4BXX I;  3CCS Z;  5FPE A;  2RPR A;  3J80 b;  2ZAE B;  3CC7 Z;  1NE5 A;  2VY6 A;  4QTU A;  1Y1V I;  2OTJ Z;  1VQM 1;  2MN5 A;  1YJW 1;  1BA0 A;  2M6N A;  1AYJ A;  3TE5 B;  3HOX I;  3PO2 I;  1YUK A;  5AQG A;  3J81 b;  2RIQ A;  4A93 I;  4Y7N I;  4HGY A;  1KQS Z;  3KVG A;  3SF4 D;  1Q7Y 2;  1RO0 A;  3NH5 A;  2RHB A;  1KAZ A;  1NGH A;  3CW4 A;  3FZM A;  3AY9 A;  4HE7 A;  2V45 A;  1VQO Z;  1YHQ 1;  3BG0 B;  3CQX A;  4E2Y A;  2IZ4 A;  1K73 2;  2PK7 A;  3CCQ 1;  5EX5 A;  2LEX A;  2HU9 A;  1ZB9 A;  1MYN A;  2F4O A;  2ASC A;  4RVF A;  1KQS Y;  5AQW A;  2GMO A;  3GKU A;  2LIY A;  1DL6 A;  3HOY I;  3LDL A;  5C4X I;  3P5J B;  2D56 A;  3CCL Z;  1VQL Z;  1ZVE A;  1SIW A;  1I6G A;  4H5W A;  3CMA Z;  5AQU A;  4RV9 A;  3VB9 A;  2E0H A;  1ATS A;  5BPN A;  3CXC Z;  3NH8 A;  2LR3 A;  1Y8C A;  2K3R A;  2YIP A;  1Q86 1;  2QEX 1;  1YIJ 1;  2BUP A;  3CCU 1;  3GTP I;  3FQQ A;  4A3D I;  3KOZ A;  1S72 1;  3S14 I;  1YUA A;  2QWQ A;  5LL6 f;  1NGD A;  4DK1 A;  2E9H A;  1VQ4 1;  1ZH1 A;  2NVQ I;  3GTQ I;  1Y1V S;  2H85 A;  5AQF A;  3H0G I;  1RQF A;  2BJO A;  1JZB A;  1VQM Z;  3L6Q A;  1Z02 A;  1Q16 A;  1LQI A;  1NGG A;  4E30 A;  1NRA A;  3JXU A;  3CXC Y;  1JJ2 Z;  1QVF Y;  5D1O A;  1HJO A;  2K35 A;  3QFP A;  3IUC A;  1BCG A;  5CM2 M;  2OOY B;  1YHQ Z;  4HWI A;  1TWC I;  1T1T A;  1T7B A;  2KYQ A;  3S16 I;  5AQV A;  1Q82 2;  4MD7 A;  4A3L I;  2OOX B;  3CCQ Z;  3NH4 A;  2O53 A;  2JA8 I;  1FDO A;  1WMT A;  5AQJ A;  1DKG D;  1JJ2 Y;  3RZO I;  2E88 A;  3GKQ A;  2NVX I;  2GU2 A;  1I50 I;  3KOX A;  3PO3 I;  2M48 A;  3CCE 1;  1YIT Z;  2JNY A;  2K5R A;  1LQH A;  4MON A;  1P0A A;  2Q51 A;  2VUG A;  2KBH A;  3S2D I;  1YUW A;  1N8R 1;  3GTM I;  2LY6 A;  3QWU A;  1VQ7 1;  2NVY I;  3I55 Z;  2EGT A;  5IT9 f;  2WAQ A;  3VMH A;  1M1K 2;  4FSV A;  2QWN A;  4A3F I;  3BK3 C;  2QEX Z;  3H3V J;  1YIJ Z;  3CCR 1;  3CCU Z;  3RZD I;  3ESW A;  3CD6 Z;  1NGF A;  4AYB A;  1S72 Z;  5CY0 A;  2LY5 A;  5AN9 F;  2VUM I;  3ATV A;  2N69 A;  5FPN A;  2GTI A;  3CQZ I;  4BY7 I;  1N2F A;  2GL1 A;  2E2F A;  2Y0S A;  3L4I A;  3PSM A;  3HKZ A;  2JA5 I;  4A3B I;  1Q7Y 1;  1B3C A;  1P9N A;  1W2B Y;  4H5T A;  1GPS A;  1TWA I;  2V8I A;  5IP7 I;  3CCJ 1;  1Z01 A;  1VQ8 1;  4TNU A;  2W04 A;  1AHO A;  1K73 1;  3OW2 Y;  2LN8 A;  1L1O C;  1X3Z A;  2SN3 A;  2JIO A;  3R2V A;  1NGA A;  1NH5 A;  1S3X A;  3CCV 1;  3VMG A;  2O4H A;  3PO3 S;  4CQK A;  1WW9 A;  1T7A A;  1Z03 A;  2JA6 I;  2JIR A;  2V8K A;  3JAM b;  3I56 1;  1QVG Y;  4CL1 A;  3HOZ I;  5AQY A;  2J6A A;  1HPM A;  5T64 A;  3GTM S;  4NBE A;  1VQK 1;  3GTG I;  1CHZ A;  1VQ9 Z;  2E3G A;  1VQ7 Z;  2OTL 1;  1NUI A;  3C7N B;  2F4M A;  2RBL A;  3CCR Z;  3Q87 A;  4FL9 A;  4UAF E;  3FZK A;  1WT7 A;  3CC4 1;  1VQ5 1;  2PMZ A;  1NJI 2;  3GTJ I;  4NH1 C;  1VQN Z;  3FZF A;  2E3F A;  2QWP A;  1ICA A;  5BN9 A;  4E2Z A;  4A3G I;  2V3V A;  1I6H I;  2JS4 A;  1N4N A;  1Q81 1;  1VQP 1;  2YBR C;  2QXL A;  5KK4 A;  4MD9 A;  2LJM A;  3NDI A;  1LQQ A;  3CCJ Z;  2QWO A;  1K83 I;  3M4O I;  5IT9 b;  1VQ8 Z;  3FQM A;  4HHF A;  4X6A I;  2WB1 A;  1QVF Z;  2QRD B;  3I4N I;  2QRE B;  2KHO A;  4GNI A;  5C3E I;  2BRZ A;  2DE7 A;  1KAX A;  2M8B B;  1L4V A;  3HSC A;  3D9X A;  2B3C A;  4NBF A;  3I56 Z;  5AQN A;  1NPI A;  2G2K A;  3HOV I;  4RS4 A;  3NFZ A;  3EER A;  1YJW Z;  4E32 A;  1VQK Z;  2LT8 A;  3CME 1;  5EXW A;  2JIP A;  2OTL Z;  1KRL A;  1M1K 1;  1TWG I;  1WII A;  4H5N A;  4NBA A;  3FZL A;  1K8A 1;  3CCM 1;  3CC4 Z;  2VPW A;  4E2W A;  1JZA A;  4UAE F;  5FLM I;  2AYD A;  5A2Q f;  4H5R A;  5AQM A;  1BUP A;  2R93 I;  1HX1 A;  1FDI A;  2MBK A;  1TWH I;  1NGE A;  5D1O B;  2LFU A;  5BPL A;  3J80 f;  4UJ0 A;  1BK8 A;  1MR4 A;  1SNB A;  3GL1 A;  4AEI A;  2DE5 A;  5AQL A;  2R6M A;  1VQP Z;  3J81 f;  3D2L A;  4QTT A;  1RLY A;  5C44 I;  3S15 I;  3L56 A;  3D2E A;  4Y52 I;  3G4S 1;  2NY8 X;  2VF1 A;  3KC6 A;  4BBS I;  1ZUT A;  2GTH A;  3GCF A;  2N2R A;  3S1M I;  4S1T A;  3CPW Z;  2KGQ A;  1W2B Z;  3IFU A;  4NBG A;  3CC2 1;  1RO2 A;  3MZK B;  4RVG A;  3MON A;  4RVD A;  1VQ4 Z;  2E2H I;  3IX0 A;  5T6B A;  2YIO A;  2QWR A;  5FLX f;  3OW2 Z;  2E2J I;  1ZFU A;  3FZH A;  2I61 A;  3LDP A;  1C55 A;  1SN4 A;  1TFI A;  2LKB A;  2YC1 C;  1I2U A;  4NBB A;  4BBR I;  2KSK A;  2AKL A;  3CME Z;  2OTJ 1;  4MRI A;  1SFO I;  3QFU A;  3CPW Y;  4E31 A;  2V7Z A;  3TDH B;  2VPY A;  4E2X A;  1USP A;  1JWH C;  2V8J A;  4AAZ A;  3CCM Z;  3FKI I;  1QVG Z;  5AR0 A;  2YAD A;  2E8A A;  2JDQ D;  1VQO 1;  3GDQ A;  2NAP A;  2ATB A;  4NBD A;  1ZU3 A;  1KV0 A;  4DQY B;  1KC8 2;  4RVH A;  1TWF I;  1KD1 2;  1NGJ A;  1ZYV A;  3LDO A;  5AQI A;  5AQT A;  3MZL B;  5F0X A;  3CCE Z;  4BY1 I;  1QXF A;  3D6W A;  2PM9 A;  2JIQ A;  3IF8 A;  2Q4Z A;  1R9T I;  1WWN A;  2B68 A;  3A8Y A;  1CN2 A;  1KAY A;  3D2F A;  5F2R A;  3CCL 1;  1YJ9 1;  2E7Z A;  1ATR A;  4V1D C;  3G4S Z;  1UGL A;  4UAD E;  1N8R 2;  3CMA 1;  1DQ7 A;  2R7Z I;  5FPM A;  2YEO A;  2OZK A;  5AQK A;  2QRC B;  5A2Q b;  3E7U X;  2VPX A;  5C4J I;  3ATU A;  2JUB A;  3G6E 1;  2KJA A;  1YJN 1;  2YU9 I;  3HOW I;  3QI7 A;  1K9M 2;  3KOW A;  2KBK A;  2IZ3 A;  2JA7 I;  3LDN A;  5D1P A;  2KBJ A;  4IO8 A;  2QKD A;  2W03 A;  1LQL A;  5T67 A;  5EVZ A;  2I3C A;  2QW9 A;  1NGC A;  3NDJ A;  1JXC A;  3KIH A;  3QML A;  1T7E A;  2P28 A;  4HH4 A;  1X3W A;  3S17 I;  1WZN A;  2YIL A;  3I07 A;  5IP9 I;  1Q82 1;  1M90 2;  3FE1 A;  4A3K I;  3LDQ A;  1FH3 A;  5AQQ A;  5BPM A;  1QQM A;  3CCV Z;  1I6F A;  2JIM A;  3LUS A;  1AA6 A;  3F3P C;  3M3Z A;  1SN1 A;  5FLX b;  1BMR A;  1YI2 1;  2P3Y A;  2IV2 X;  3HOU I;  1RNI A;  5AQP A;  4MH4 A;  1YIT 1;  1YJ9 Z;  3G71 1;  2QLV B;  5BN8 A;  4DGL A;  4NB8 A;  3I55 1;  2KPI A;  3GTO I;  2KPY A;  1BRZ A;  1BA1 A;  3T4N B;  3IR7 A;  2LI7 A;  3F3F C;  3E7R L;  1VQ5 Z;  3CD6 1;  1ZYW A;  3G6E Z;  1Y1W I;  1YJN Z;  3S1N I;  1VLA A;  3KP1 A;  5AQZ A;  3EED A;  4A3C I;  3VTN A;  2JR6 A;  3KIF A;  5AQS A;  1SEG A;  2B63 I;  3JAM f;  4KBO A;  1OZZ A;  1I2V A;  1T0Z A;  1VQ6 1;  2QA4 1;  1VNA A;  1GPT A;  1Q81 2;  5AQX A;  1ML8 A;  1NP6 A;  4EWC A;  3S1Q I;  1K8B A;  2QR1 B;  2QWM A;  1PX9 A;  1OMY A;  3U50 C;  1RO4 A;  4E33 A;  3S2H I;  1VNB A;  1Q86 2;  3GTK I;  1QF8 A;  1KC8 1;  3KP0 A;  1KD1 1;  1S7M A;  4XX2 A;  2HF1 A;  1QQN A;  1YI2 Z;  1P00 A;  3CCS 1;  1QYP A;  1C56 A;  1WCM I;  3D2E B;  4A3I I;  2E2I I;  5FPD A;  3CC7 1;  3G71 Z;  4A3M I;  1TI5 A;  3I4M I;  4MD8 A;  3S1R I;  1PE4 A;  1ZB8 A;  4A3E I;  2R92 I;  1VQ9 1;  1X0T A;  3M3Y I;  4KYP A;  1POI A;  1NGB A;  1K8A 2;  3J7A 4;  1NJI 1;  4NOZ A;  4H5V A;  1K9M 1;  1VQN 1;  3BG1 B;  2DE6 A; 
#chains in the Genus database with same CATH homology
 3VMI A;  3K7A I;  4NB9 A;  2JMO A;  4A3J I;  4NBC A;  1USP B;  4MXU A;  1VQ6 Z;  2QA4 Z;  4HGZ A;  2RT9 A;  4NBH A;  1VQL 1;  3GTL I;  1M90 1;  4NFR A;  2KI7 B;  3CC2 Z;  1I3Q I;  2NVT I;  1PFT A;  4BXX I;  3CCS Z;  2RPR A;  3J80 b;  2ZAE B;  3CC7 Z;  4QTU A;  1Y1V I;  2OTJ Z;  1VQM 1;  1YJW 1;  2M6N A;  3TE5 B;  3HOX I;  3PO2 I;  1YUK A;  3J81 b;  2RIQ A;  4A93 I;  4Y7N I;  4HGY A;  1KQS Z;  1Q7Y 2;  1RO0 A;  3NH5 A;  2RHB A;  1YHQ 1;  1VQO Z;  3BG0 B;  4E2Y A;  2IZ4 A;  1K73 2;  2PK7 A;  3CCQ 1;  2HU9 A;  1ZB9 A;  2F4O A;  4RVF A;  1KQS Y;  2LIY A;  1DL6 A;  3HOY I;  5C4X I;  3P5J B;  3CCL Z;  1VQL Z;  3CMA Z;  4RV9 A;  3VB9 A;  3CXC Z;  3NH8 A;  2K3R A;  1Q86 1;  2QEX 1;  1YIJ 1;  3CCU 1;  3GTP I;  3FQQ A;  4A3D I;  1S72 1;  3S14 I;  1YUA A;  5LL6 f;  4DK1 A;  2E9H A;  1VQ4 1;  1ZH1 A;  2NVQ I;  3GTQ I;  1Y1V S;  2H85 A;  3H0G I;  1RQF A;  2BJO A;  1VQM Z;  1Z02 A;  4E30 A;  3CXC Y;  1JJ2 Z;  1QVF Y;  5D1O A;  5CM2 M;  2OOY B;  1YHQ Z;  1TWC I;  3S16 I;  1Q82 2;  4MD7 A;  4A3L I;  2OOX B;  3NH4 A;  3CCQ Z;  2O53 A;  2JA8 I;  1JJ2 Y;  3RZO I;  3GKQ A;  2NVX I;  2GU2 A;  1I50 I;  3PO3 I;  2M48 A;  3CCE 1;  1YIT Z;  2JNY A;  2K5R A;  4MON A;  2Q51 A;  2VUG A;  3S2D I;  1N8R 1;  3GTM I;  3QWU A;  1VQ7 1;  2NVY I;  3I55 Z;  2EGT A;  5IT9 f;  2WAQ A;  3VMH A;  1M1K 2;  4A3F I;  2QEX Z;  3H3V J;  1YIJ Z;  3CCR 1;  3CCU Z;  3RZD I;  3ESW A;  3CD6 Z;  4AYB A;  1S72 Z;  5AN9 F;  2VUM I;  2GTI A;  3CQZ I;  4BY7 I;  1N2F A;  2Y0S A;  3HKZ A;  2JA5 I;  4A3B I;  1Q7Y 1;  1P9N A;  1W2B Y;  1TWA I;  2V8I A;  5IP7 I;  3CCJ 1;  1Z01 A;  1VQ8 1;  4TNU A;  2W04 A;  1K73 1;  3OW2 Y;  1L1O C;  1X3Z A;  3CCV 1;  3VMG A;  2O4H A;  3PO3 S;  1WW9 A;  1Z03 A;  2JA6 I;  2V8K A;  3JAM b;  3I56 1;  1QVG Y;  4CL1 A;  3HOZ I;  2J6A A;  5T64 A;  3GTM S;  4NBE A;  1VQK 1;  3GTG I;  1VQ9 Z;  1VQ7 Z;  2OTL 1;  1NUI A;  2F4M A;  2RBL A;  3CCR Z;  3Q87 A;  3CC4 1;  1VQ5 1;  2PMZ A;  1NJI 2;  3GTJ I;  4NH1 C;  1VQN Z;  4E2Z A;  4A3G I;  1I6H I;  2JS4 A;  1Q81 1;  1VQP 1;  4MD9 A;  3NDI A;  3CCJ Z;  1K83 I;  3M4O I;  5IT9 b;  1VQ8 Z;  3FQM A;  4X6A I;  2WB1 A;  1QVF Z;  2QRD B;  3I4N I;  2QRE B;  5C3E I;  2DE7 A;  3D9X A;  4NBF A;  3I56 Z;  2G2K A;  3HOV I;  4RS4 A;  3NFZ A;  3EER A;  1YJW Z;  4E32 A;  1VQK Z;  3CME 1;  2OTL Z;  1KRL A;  1M1K 1;  1TWG I;  1WII A;  4NBA A;  1K8A 1;  3CCM 1;  3CC4 Z;  4E2W A;  5FLM I;  5A2Q f;  2R93 I;  1TWH I;  5D1O B;  2LFU A;  3J80 f;  2DE5 A;  2R6M A;  1VQP Z;  3J81 f;  4QTT A;  1RLY A;  5C44 I;  3S15 I;  4Y52 I;  3G4S 1;  2VF1 A;  4BBS I;  2GTH A;  3GCF A;  3S1M I;  4S1T A;  3CPW Z;  1W2B Z;  3IFU A;  4NBG A;  3CC2 1;  1RO2 A;  3MZK B;  4RVG A;  3MON A;  4RVD A;  1VQ4 Z;  2E2H I;  3IX0 A;  5T6B A;  5FLX f;  3OW2 Z;  2E2J I;  1TFI A;  4NBB A;  4BBR I;  2AKL A;  3CME Z;  2OTJ 1;  4MRI A;  1SFO I;  3CPW Y;  4E31 A;  3TDH B;  4E2X A;  1USP A;  1JWH C;  2V8J A;  3CCM Z;  3FKI I;  1QVG Z;  2YAD A;  1VQO 1;  4NBD A;  4DQY B;  1KC8 2;  4RVH A;  1TWF I;  1KD1 2;  3MZL B;  3CCE Z;  4BY1 I;  3D6W A;  2PM9 A;  3IF8 A;  2Q4Z A;  1R9T I;  3CCL 1;  1YJ9 1;  3G4S Z;  1N8R 2;  3CMA 1;  2R7Z I;  2OZK A;  2QRC B;  5A2Q b;  5C4J I;  2JUB A;  3G6E 1;  1YJN 1;  2YU9 I;  3HOW I;  1K9M 2;  2IZ3 A;  2JA7 I;  5D1P A;  2QKD A;  2W03 A;  1LQL A;  5T67 A;  2I3C A;  3NDJ A;  3KIH A;  2P28 A;  4HH4 A;  1X3W A;  3S17 I;  3I07 A;  5IP9 I;  1Q82 1;  1M90 2;  4A3K I;  3CCV Z;  3LUS A;  3F3P C;  5FLX b;  1YI2 1;  2P3Y A;  3HOU I;  1RNI A;  4MH4 A;  1YIT 1;  1YJ9 Z;  3G71 1;  2QLV B;  4DGL A;  4NB8 A;  3I55 1;  2KPI A;  3GTO I;  3T4N B;  3F3F C;  1VQ5 Z;  3CD6 1;  3G6E Z;  1Y1W I;  1YJN Z;  3S1N I;  1VLA A;  3EED A;  4A3C I;  3VTN A;  2JR6 A;  3KIF A;  2B63 I;  3JAM f;  1VQ6 1;  2QA4 1;  1Q81 2;  1ML8 A;  1NP6 A;  4EWC A;  3S1Q I;  1K8B A;  2QR1 B;  3U50 C;  1RO4 A;  4E33 A;  3S2H I;  1Q86 2;  3GTK I;  1QF8 A;  1KC8 1;  1KD1 1;  1S7M A;  4XX2 A;  2HF1 A;  1YI2 Z;  3CCS 1;  1QYP A;  1WCM I;  4A3I I;  2E2I I;  3CC7 1;  3G71 Z;  4A3M I;  3I4M I;  4MD8 A;  3S1R I;  1ZB8 A;  4A3E I;  2R92 I;  1VQ9 1;  1X0T A;  3M3Y I;  1K8A 2;  3J7A 4;  1NJI 1;  4NOZ A;  1K9M 1;  1VQN 1;  3BG1 B;  2DE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...