2KGQA

Refined solution structure of des-pyro glu brazzein
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Brazzein
publication title Refined solution structure of des-pyro Glu brazzein
rcsb
source organism Pentadiplandra brazzeana
total genus 8
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kgqA00
2BRZA 1GPSA 1WT7A 2SN3A 2KJAA 1DQ7A 2MZ0A 4HHFA 4KYPA 1VNAA 1ZVEA 4UJ0A 1SEGA 1NH5A 3E7UX 1OZZA 1VNBA 1PX9A 2M8BB 2N2QA 1P00A 1N4NA 2E3GA 1CHZA 1LQIA 5KK4A 4AEIA 5CY0A 2LI7A 1JZAA 2N2RA 1PE4A 1AYJA 2E0HA 1ZYVA 3E7RL 1C55A 1AHOA 1WMTA 2KBKA 2KPYA 1BCGA 1TI5A 1GPTA 1T1TA 1ZYWA 2YBRC 2KYQA 2ASCA 1CN2A 1SNBA 2B68A 2KBHA 1JXCA 1I6GA 2KSKA 2N69A 2B3CA 1NRBA 1BK8A 1BRZA 1LQQA 1ZUTA 1JZBA 4V1DC 2LJ7A 4CQKA 1JKZA 1B7DA 1T7AA 1DJTA 1I2VA 2NY9X 1FH3A 2LY6A 1MYNA 1L4VA 1KV0A 2GL1A 1PTXA 2YEOA 1NPIA 4AB0A 2ATBA 2LKBA 2I61A 1T7BA 1MR4A 1I6FA 4HE7A 1C56A 2E3FA 2YC1C 1ZFUA 1NRAA 3PSMA 1ICAA 1NE5A 2LY5A 1I2UA 1T0ZA 1LQHA 2LT8A 1WWNA 1B3CA 1OMYA 2LR3A 1BMRA 1ZVGA 2A7TA 1SN4A 2N66A 1P0AA 1SN1A 2KGQA 1ZU3A 2KBJA 2NY8X 1T7EA 4AAZA 2LJMA
chains in the Genus database with same CATH superfamily
2BRZA 5AR0A 1GPSA 1WT7A 5BPMA 1ATSA 1QQOA 1QQMA 2BUPA 2KJAA 2SN3A 3QFUA 1DQ7A 2QWOA 2MZ0A 2K35A 3IUCA 4HHFA 5AQJA 5FPEA 1HX1A 4KYPA 1VNAA 2QWNA 1QQNA 2V7ZA 5AQWA 5F1XA 3A8YA 3CQXA 2E88A 3KP1A 1KAZA 5EVZA 1ZVEA 2E8AA 3CW4A 4UJ0A 1SEGA 3D2EB 2QWPA 1NH5A 3E7UX 1OZZA 1VNBA 3KHWA 3LDQA 2YIPA 1PX9A 2M8BB 2N2QA 5AQNA 1P00A 3AY9A 2MN5A 1NGBA 3FZMA 4FSVA 3GKUA 1N4NA 5EX5A 1S3XA 2E3GA 1CHZA 1LQIA 3C7NB 1NGDA 1ATRA 5KK4A 4AEIA 5AQKA 5CY0A 3FZHA 2LN8A 2KHOA 5BN8A 5F0XA 1NGGA 4HWIA 2LI7A 3D2EA 2VY6A 1JZAA 3GL1A 2N2RA 1PE4A 3QFPA 1DKGD 1AYJA 3KOZA 2E0HA 1ZYVA 3E7RL 1C55A 3ATVA 1AHOA 3GDQA 5AQLA 1WMTA 2KBKA 2KPYA 1BCGA 1TI5A 1HPMA 1NGEA 1T1TA 3QI7A 5AQPA 1GPTA 1ZYWA 2YBRC 2KYQA 3C7NA 2ASCA 5AQQA 1CN2A 3ATUA 4H5TA 3L6QA 5AQSA 4GNIA 3FZFA 1SNBA 2B68A 1KAYA 3HSCA 2KBHA 1JXCA 5EXWA 5FPNA 3QMLA 5F2RA 1HJOA 4UADE 3LDNA 2QWMA 1I6GA 2KSKA 2N69A 2B3CA 3FZKA 3KOYA 1NRBA 1BK8A 1BRZA 1LQQA 2YIOA 5AQGA 5AQMA 1ZUTA 4H5VA 3KOXA 1JZBA 1NGAA 3M3ZA 4H5WA 3LDPA 4V1DC 5AQUA 3KC6A 2JDQD 2LJ7A 4IO8A 5AQHA 4CQKA 1JKZA 1B7DA 1T7AA 1DJTA 3BK3C 4UAFE 5BPLA 1I2VA 1BUPA 4UAEF 2NY9X 1FH3A 5AQXA 2LY6A 1MYNA 1L4VA 5AQIA 1NGFA 1KV0A 5AQRA 2QWQA 3JXUA 2GL1A 3SF4D 1NGCA 3L56A 3LDLA 1PTXA 2MBKA 2YEOA 5AQVA 1NPIA 1UGLA 4AB0A 2GMOA 2D56A 1BA0A 2ATBA 1NGHA 1BA1A 2YILA 1POIA 2G2KA 3KOWA 3FZLA 2LKBA 1T7BA 1MR4A 2I61A 1I6FA 5FPMA 4HE7A 5EY4A 5BN9A 1C56A 2QW9A 1XRSB 2E3FA 2YC1C 5AQZA 1ZFUA 3D2FB 1KAXA 1NRAA 3PSMA 1NGJA 1ICAA 2QWLA 1NE5A 2LY5A 1NGIA 1I2UA 1T0ZA 5AQTA 5FPDA 1LQHA 4H5RA 3FE1A 5AQFA 2LT8A 1WWNA 5BPNA 1B3CA 1OMYA 2LR3A 5AQOA 3I33A 2QWRA 1BMRA 3LDOA 1ZVGA 3KP0A 2A7TA 1YUWA 3D2FA 1SN4A 2N66A 1P0AA 3R2VA 1K8BA 5AQYA 1SN1A 4H5NA 2KGQA 1ZU3A 4KBOA 2E2FA 2KBJA 3KVGA 3L4IA 2NY8X 1T7EA 4AAZA 4FL9A 2QXLA 2LJMA
chains in the Genus database with same CATH topology
2BRZA 1GPSA 1WT7A 2SN3A 2KJAA 1DQ7A 2MZ0A 4HHFA 4KYPA 1VNAA 1ZVEA 4UJ0A 1SEGA 1NH5A 3E7UX 1OZZA 1VNBA 1PX9A 2M8BB 2N2QA 1P00A 1N4NA 2E3GA 1CHZA 1LQIA 5KK4A 4AEIA 5CY0A 2LI7A 1JZAA 2N2RA 1PE4A 1AYJA 2E0HA 1ZYVA 3E7RL 1C55A 1AHOA 1WMTA 2KBKA 2KPYA 1BCGA 1TI5A 1GPTA 1T1TA 1ZYWA 2YBRC 2KYQA 2ASCA 1CN2A 1SNBA 2B68A 2KBHA 1JXCA 1I6GA 2KSKA 2N69A 2B3CA 1NRBA 1BK8A 1BRZA 1LQQA 1ZUTA 1JZBA 4V1DC 2LJ7A 4CQKA 1JKZA 1B7DA 1T7AA 1DJTA 1I2VA 2NY9X 1FH3A 2LY6A 1MYNA 1L4VA 1KV0A 2GL1A 1PTXA 2YEOA 1NPIA 4AB0A 2ATBA 2LKBA 2I61A 1T7BA 1MR4A 1I6FA 4HE7A 1C56A 2E3FA 2YC1C 1ZFUA 1NRAA 3PSMA 1ICAA 1NE5A 2LY5A 1I2UA 1T0ZA 1LQHA 2LT8A 1WWNA 1B3CA 1OMYA 2LR3A 1BMRA 1ZVGA 2A7TA 1SN4A 2N66A 1P0AA 1SN1A 2KGQA 1ZU3A 2KBJA 2NY8X 1T7EA 4AAZA 2LJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRZ A;  1GPS A;  1WT7 A;  2SN3 A;  2KJA A;  1DQ7 A;  2MZ0 A;  4HHF A;  4KYP A;  1VNA A;  1ZVE A;  4UJ0 A;  1SEG A;  1NH5 A;  3E7U X;  1OZZ A;  1VNB A;  1PX9 A;  2M8B B;  2N2Q A;  1P00 A;  1N4N A;  2E3G A;  1CHZ A;  1LQI A;  5KK4 A;  4AEI A;  5CY0 A;  2LI7 A;  1JZA A;  2N2R A;  1PE4 A;  1AYJ A;  2E0H A;  1ZYV A;  3E7R L;  1C55 A;  1AHO A;  1WMT A;  2KBK A;  2KPY A;  1BCG A;  1TI5 A;  1GPT A;  1T1T A;  1ZYW A;  2YBR C;  2KYQ A;  2ASC A;  1CN2 A;  1SNB A;  2B68 A;  2KBH A;  1JXC A;  1I6G A;  2KSK A;  2N69 A;  2B3C A;  1NRB A;  1BK8 A;  1BRZ A;  1LQQ A;  1ZUT A;  1JZB A;  4V1D C;  2LJ7 A;  4CQK A;  1JKZ A;  1B7D A;  1T7A A;  1DJT A;  1I2V A;  2NY9 X;  1FH3 A;  2LY6 A;  1MYN A;  1L4V A;  1KV0 A;  2GL1 A;  1PTX A;  2YEO A;  1NPI A;  4AB0 A;  2ATB A;  2LKB A;  2I61 A;  1T7B A;  1MR4 A;  1I6F A;  4HE7 A;  1C56 A;  2E3F A;  2YC1 C;  1ZFU A;  1NRA A;  3PSM A;  1ICA A;  1NE5 A;  2LY5 A;  1I2U A;  1T0Z A;  1LQH A;  2LT8 A;  1WWN A;  1B3C A;  1OMY A;  2LR3 A;  1BMR A;  1ZVG A;  2A7T A;  1SN4 A;  2N66 A;  1P0A A;  1SN1 A;  2KGQ A;  1ZU3 A;  2KBJ A;  2NY8 X;  1T7E A;  4AAZ A;  2LJM A; 
#chains in the Genus database with same CATH topology
 2BRZ A;  5AR0 A;  1GPS A;  1WT7 A;  5BPM A;  1ATS A;  1QQO A;  1QQM A;  2BUP A;  2KJA A;  2SN3 A;  3QFU A;  1DQ7 A;  2QWO A;  2MZ0 A;  2K35 A;  3IUC A;  4HHF A;  5AQJ A;  5FPE A;  1HX1 A;  4KYP A;  1VNA A;  2QWN A;  1QQN A;  2V7Z A;  5AQW A;  5F1X A;  3A8Y A;  3CQX A;  2E88 A;  3KP1 A;  1KAZ A;  5EVZ A;  1ZVE A;  2E8A A;  3CW4 A;  4UJ0 A;  1SEG A;  3D2E B;  2QWP A;  1NH5 A;  3E7U X;  1OZZ A;  1VNB A;  3KHW A;  3LDQ A;  2YIP A;  1PX9 A;  2M8B B;  2N2Q A;  5AQN A;  1P00 A;  3AY9 A;  2MN5 A;  1NGB A;  3FZM A;  4FSV A;  3GKU A;  1N4N A;  5EX5 A;  1S3X A;  2E3G A;  1CHZ A;  1LQI A;  3C7N B;  1NGD A;  1ATR A;  5KK4 A;  4AEI A;  5AQK A;  5CY0 A;  3FZH A;  2LN8 A;  2KHO A;  5BN8 A;  5F0X A;  1NGG A;  4HWI A;  2LI7 A;  3D2E A;  2VY6 A;  1JZA A;  3GL1 A;  2N2R A;  1PE4 A;  3QFP A;  1DKG D;  1AYJ A;  3KOZ A;  2E0H A;  1ZYV A;  3E7R L;  1C55 A;  3ATV A;  1AHO A;  3GDQ A;  5AQL A;  1WMT A;  2KBK A;  2KPY A;  1BCG A;  1TI5 A;  1HPM A;  1NGE A;  1T1T A;  3QI7 A;  5AQP A;  1GPT A;  1ZYW A;  2YBR C;  2KYQ A;  3C7N A;  2ASC A;  5AQQ A;  1CN2 A;  3ATU A;  4H5T A;  3L6Q A;  5AQS A;  4GNI A;  3FZF A;  1SNB A;  2B68 A;  1KAY A;  3HSC A;  2KBH A;  1JXC A;  5EXW A;  5FPN A;  3QML A;  5F2R A;  1HJO A;  4UAD E;  3LDN A;  2QWM A;  1I6G A;  2KSK A;  2N69 A;  2B3C A;  3FZK A;  3KOY A;  1NRB A;  1BK8 A;  1BRZ A;  1LQQ A;  2YIO A;  5AQG A;  5AQM A;  1ZUT A;  4H5V A;  3KOX A;  1JZB A;  1NGA A;  3M3Z A;  4H5W A;  3LDP A;  4V1D C;  5AQU A;  3KC6 A;  2JDQ D;  2LJ7 A;  4IO8 A;  5AQH A;  4CQK A;  1JKZ A;  1B7D A;  1T7A A;  1DJT A;  3BK3 C;  4UAF E;  5BPL A;  1I2V A;  1BUP A;  4UAE F;  2NY9 X;  1FH3 A;  5AQX A;  2LY6 A;  1MYN A;  1L4V A;  5AQI A;  1NGF A;  1KV0 A;  5AQR A;  2QWQ A;  3JXU A;  2GL1 A;  3SF4 D;  1NGC A;  3L56 A;  3LDL A;  1PTX A;  2MBK A;  2YEO A;  5AQV A;  1NPI A;  1UGL A;  4AB0 A;  2GMO A;  2D56 A;  1BA0 A;  2ATB A;  1NGH A;  1BA1 A;  2YIL A;  1POI A;  2G2K A;  3KOW A;  3FZL A;  2LKB A;  1T7B A;  1MR4 A;  2I61 A;  1I6F A;  5FPM A;  4HE7 A;  5EY4 A;  5BN9 A;  1C56 A;  2QW9 A;  1XRS B;  2E3F A;  2YC1 C;  5AQZ A;  1ZFU A;  3D2F B;  1KAX A;  1NRA A;  3PSM A;  1NGJ A;  1ICA A;  2QWL A;  1NE5 A;  2LY5 A;  1NGI A;  1I2U A;  1T0Z A;  5AQT A;  5FPD A;  1LQH A;  4H5R A;  3FE1 A;  5AQF A;  2LT8 A;  1WWN A;  5BPN A;  1B3C A;  1OMY A;  2LR3 A;  5AQO A;  3I33 A;  2QWR A;  1BMR A;  3LDO A;  1ZVG A;  3KP0 A;  2A7T A;  1YUW A;  3D2F A;  1SN4 A;  2N66 A;  1P0A A;  3R2V A;  1K8B A;  5AQY A;  1SN1 A;  4H5N A;  2KGQ A;  1ZU3 A;  4KBO A;  2E2F A;  2KBJ A;  3KVG A;  3L4I A;  2NY8 X;  1T7E A;  4AAZ A;  4FL9 A;  2QXL A;  2LJM A; 
#chains in the Genus database with same CATH homology
 2BRZ A;  1GPS A;  1WT7 A;  2SN3 A;  2KJA A;  1DQ7 A;  2MZ0 A;  4HHF A;  4KYP A;  1VNA A;  1ZVE A;  4UJ0 A;  1SEG A;  1NH5 A;  3E7U X;  1OZZ A;  1VNB A;  1PX9 A;  2M8B B;  2N2Q A;  1P00 A;  1N4N A;  2E3G A;  1CHZ A;  1LQI A;  5KK4 A;  4AEI A;  5CY0 A;  2LI7 A;  1JZA A;  2N2R A;  1PE4 A;  1AYJ A;  2E0H A;  1ZYV A;  3E7R L;  1C55 A;  1AHO A;  1WMT A;  2KBK A;  2KPY A;  1BCG A;  1TI5 A;  1GPT A;  1T1T A;  1ZYW A;  2YBR C;  2KYQ A;  2ASC A;  1CN2 A;  1SNB A;  2B68 A;  2KBH A;  1JXC A;  1I6G A;  2KSK A;  2N69 A;  2B3C A;  1NRB A;  1BK8 A;  1BRZ A;  1LQQ A;  1ZUT A;  1JZB A;  4V1D C;  2LJ7 A;  4CQK A;  1JKZ A;  1B7D A;  1T7A A;  1DJT A;  1I2V A;  2NY9 X;  1FH3 A;  2LY6 A;  1MYN A;  1L4V A;  1KV0 A;  2GL1 A;  1PTX A;  2YEO A;  1NPI A;  4AB0 A;  2ATB A;  2LKB A;  2I61 A;  1T7B A;  1MR4 A;  1I6F A;  4HE7 A;  1C56 A;  2E3F A;  2YC1 C;  1ZFU A;  1NRA A;  3PSM A;  1ICA A;  1NE5 A;  2LY5 A;  1I2U A;  1T0Z A;  1LQH A;  2LT8 A;  1WWN A;  1B3C A;  1OMY A;  2LR3 A;  1BMR A;  1ZVG A;  2A7T A;  1SN4 A;  2N66 A;  1P0A A;  1SN1 A;  2KGQ A;  1ZU3 A;  2KBJ A;  2NY8 X;  1T7E A;  4AAZ A;  2LJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...