1NE5A

Solution structure of herg specific scorpion toxin cnerg1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ergtoxin
publication title Solution structure of CnErg1 (Ergtoxin), a HERG specific scorpion toxin
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08086 Toxin_17 Ergtoxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ne5A00
2YBRC 1PTXA 1C56A 4AB0A 1I2VA 2KBHA 1VNAA 1ZVGA 2I61A 5CY0A 1PE4A 1MYNA 1BCGA 1WT7A 1AYJA 1JKZA 2N2RA 3E7RL 4AAZA 4HE7A 1OMYA 2BRZA 2LY6A 2A7TA 1B7DA 2KSKA 1NPIA 1SN4A 2M8BB 1OZZA 1JZAA 3PSMA 1NRAA 1AHOA 1LQIA 1I6GA 1CN2A 1ZUTA 2B68A 1BRZA 1TI5A 1DQ7A 1JZBA 4CQKA 1P0AA 1SEGA 2KYQA 2YEOA 4V1DC 1DJTA 1LQQA 2ASCA 2YC1C 1NRBA 4HHFA 3E7UX 1I6FA 1GPSA 1NH5A 1ZU3A 4AEIA 1ICAA 1BK8A 1JXCA 1T0ZA 1NE5A 1T7EA 1N4NA 2SN3A 2LT8A 1KV0A 1T1TA 2KPYA 4UJ0A 2NY8X 1MR4A 2KGQA 2LKBA 1ZVEA 1L4VA 2ATBA 2E3GA 2E0HA 2LJMA 1B3CA 1CHZA 5KK4A 2LR3A 2B3CA 2MZ0A 1BMRA 2N2QA 1FH3A 2NY9X 2E3FA 4KYPA 2KBKA 1LQHA 2KBJA 2LY5A 1WMTA 1PX9A 2N69A 1GPTA 2LI7A 1T7BA 1I2UA 1ZYVA 1SNBA 1WWNA 1VNBA 1ZYWA 1SN1A 1C55A 2N66A 1T7AA 1ZFUA 2GL1A 1P00A 2LJ7A 2KJAA
chains in the Genus database with same CATH superfamily
2YBRC 5AQJA 3D2EB 1YUWA 3C7NB 5AQPA 1PTXA 1S3XA 1C56A 2QWOA 5BPMA 1NGIA 3KC6A 2MBKA 4AB0A 2E8AA 1I2VA 1KAXA 2KBHA 1VNAA 3D2FB 1ZVGA 2I61A 3LDQA 5CY0A 3LDNA 2BUPA 1POIA 2JDQD 1QQOA 5F2RA 5FPDA 1PE4A 5EX5A 1MYNA 3QFPA 1BCGA 2QWMA 3GL1A 1WT7A 1BA0A 1AYJA 1JKZA 2N2RA 3E7RL 5AQTA 5AQKA 4AAZA 4HE7A 1OMYA 2BRZA 2LY6A 1ATRA 3M3ZA 5AR0A 3C7NA 3KHWA 5FPNA 2A7TA 4KBOA 1B7DA 3FZHA 2KSKA 1NPIA 2QXLA 2MN5A 1SN4A 2M8BB 1OZZA 2QWPA 1JZAA 3CW4A 3D2FA 3KOZA 3QI7A 3PSMA 5AQLA 1NRAA 1AHOA 3ATUA 1LQIA 5AQQA 5AQGA 5AQNA 1I6GA 1CN2A 1ZUTA 5AQVA 4H5RA 2B68A 1NGFA 1BRZA 1TI5A 1DQ7A 1JZBA 4CQKA 1P0AA 5F0XA 1SEGA 1QQMA 2KYQA 2YEOA 4V1DC 1DJTA 3I33A 3LDPA 5F1XA 1NGDA 1LQQA 1DKGD 2ASCA 2E2FA 1NRBA 2LN8A 2YC1C 3FZMA 4HHFA 3E7UX 4FSVA 5AQZA 5AQOA 3AY9A 1I6FA 1GPSA 1NH5A 1NGEA 1ZU3A 1HJOA 4AEIA 5AQHA 1ICAA 5EY4A 3GKUA 5AQYA 1BK8A 1QQNA 4H5NA 3KOXA 2GMOA 1JXCA 1KAYA 5BPLA 2YIOA 1T0ZA 1NE5A 3A8YA 1T7EA 2V7ZA 2QW9A 1NGAA 3KP0A 3SF4D 3FZKA 2VY6A 1N4NA 2SN3A 2LT8A 1KV0A 1T1TA 2KPYA 1HX1A 3R2VA 4UJ0A 4UAEF 2NY8X 3QMLA 1MR4A 3KOWA 1NGHA 2KGQA 2LKBA 1ZVEA 4H5WA 1NGBA 3FZLA 5AQIA 1L4VA 2ATBA 5AQMA 2E3GA 2QWRA 2E0HA 3JXUA 2LJMA 1B3CA 1CHZA 1KAZA 1GPTA 5AQXA 5AQUA 5FPEA 3FZFA 5KK4A 2LR3A 2B3CA 2MZ0A 1BMRA 2N2QA 3FE1A 1FH3A 1K8BA 1NGJA 3IUCA 4HWIA 1BA1A 1NGCA 2NY9X 3LDOA 2E3FA 5AQWA 1BUPA 4KYPA 4FL9A 2KBKA 1LQHA 4IO8A 4H5TA 4H5VA 2KBJA 5BPNA 2KHOA 1ATSA 2LY5A 3L4IA 3KP1A 3ATVA 1WMTA 2G2KA 2E88A 3BK3C 1PX9A 4GNIA 2D56A 2N69A 5AQFA 2LI7A 2QWNA 5EVZA 5AQRA 1NGGA 1T7BA 2YILA 1I2UA 1XRSB 1ZYVA 1SNBA 3LDLA 5BN9A 1UGLA 2YIPA 1WWNA 3L6QA 1VNBA 2QWQA 1ZYWA 3D2EA 4UAFE 5BN8A 4UADE 1SN1A 2K35A 5AQSA 5EXWA 2N66A 5FPMA 1C55A 1T7AA 1ZFUA 3GDQA 1HPMA 3CQXA 3QFUA 2QWLA 2GL1A 3KVGA 1P00A 3KOYA 2LJ7A 3L56A 2KJAA 3HSCA
chains in the Genus database with same CATH topology
2YBRC 1PTXA 1C56A 4AB0A 1I2VA 2KBHA 1VNAA 1ZVGA 2I61A 5CY0A 1PE4A 1MYNA 1BCGA 1WT7A 1AYJA 1JKZA 2N2RA 3E7RL 4AAZA 4HE7A 1OMYA 2BRZA 2LY6A 2A7TA 1B7DA 2KSKA 1NPIA 1SN4A 2M8BB 1OZZA 1JZAA 3PSMA 1NRAA 1AHOA 1LQIA 1I6GA 1CN2A 1ZUTA 2B68A 1BRZA 1TI5A 1DQ7A 1JZBA 4CQKA 1P0AA 1SEGA 2KYQA 2YEOA 4V1DC 1DJTA 1LQQA 2ASCA 2YC1C 1NRBA 4HHFA 3E7UX 1I6FA 1GPSA 1NH5A 1ZU3A 4AEIA 1ICAA 1BK8A 1JXCA 1T0ZA 1NE5A 1T7EA 1N4NA 2SN3A 2LT8A 1KV0A 1T1TA 2KPYA 4UJ0A 2NY8X 1MR4A 2KGQA 2LKBA 1ZVEA 1L4VA 2ATBA 2E3GA 2E0HA 2LJMA 1B3CA 1CHZA 5KK4A 2LR3A 2B3CA 2MZ0A 1BMRA 2N2QA 1FH3A 2NY9X 2E3FA 4KYPA 2KBKA 1LQHA 2KBJA 2LY5A 1WMTA 1PX9A 2N69A 1GPTA 2LI7A 1T7BA 1I2UA 1ZYVA 1SNBA 1WWNA 1VNBA 1ZYWA 1SN1A 1C55A 2N66A 1T7AA 1ZFUA 2GL1A 1P00A 2LJ7A 2KJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBR C;  1PTX A;  1C56 A;  4AB0 A;  1I2V A;  2KBH A;  1VNA A;  1ZVG A;  2I61 A;  5CY0 A;  1PE4 A;  1MYN A;  1BCG A;  1WT7 A;  1AYJ A;  1JKZ A;  2N2R A;  3E7R L;  4AAZ A;  4HE7 A;  1OMY A;  2BRZ A;  2LY6 A;  2A7T A;  1B7D A;  2KSK A;  1NPI A;  1SN4 A;  2M8B B;  1OZZ A;  1JZA A;  3PSM A;  1NRA A;  1AHO A;  1LQI A;  1I6G A;  1CN2 A;  1ZUT A;  2B68 A;  1BRZ A;  1TI5 A;  1DQ7 A;  1JZB A;  4CQK A;  1P0A A;  1SEG A;  2KYQ A;  2YEO A;  4V1D C;  1DJT A;  1LQQ A;  2ASC A;  2YC1 C;  1NRB A;  4HHF A;  3E7U X;  1I6F A;  1GPS A;  1NH5 A;  1ZU3 A;  4AEI A;  1ICA A;  1BK8 A;  1JXC A;  1T0Z A;  1NE5 A;  1T7E A;  1N4N A;  2SN3 A;  2LT8 A;  1KV0 A;  1T1T A;  2KPY A;  4UJ0 A;  2NY8 X;  1MR4 A;  2KGQ A;  2LKB A;  1ZVE A;  1L4V A;  2ATB A;  2E3G A;  2E0H A;  2LJM A;  1B3C A;  1CHZ A;  5KK4 A;  2LR3 A;  2B3C A;  2MZ0 A;  1BMR A;  2N2Q A;  1FH3 A;  2NY9 X;  2E3F A;  4KYP A;  2KBK A;  1LQH A;  2KBJ A;  2LY5 A;  1WMT A;  1PX9 A;  2N69 A;  1GPT A;  2LI7 A;  1T7B A;  1I2U A;  1ZYV A;  1SNB A;  1WWN A;  1VNB A;  1ZYW A;  1SN1 A;  1C55 A;  2N66 A;  1T7A A;  1ZFU A;  2GL1 A;  1P00 A;  2LJ7 A;  2KJA A; 
#chains in the Genus database with same CATH topology
 2YBR C;  5AQJ A;  3D2E B;  1YUW A;  3C7N B;  5AQP A;  1PTX A;  1S3X A;  1C56 A;  2QWO A;  5BPM A;  1NGI A;  3KC6 A;  2MBK A;  4AB0 A;  2E8A A;  1I2V A;  1KAX A;  2KBH A;  1VNA A;  3D2F B;  1ZVG A;  2I61 A;  3LDQ A;  5CY0 A;  3LDN A;  2BUP A;  1POI A;  2JDQ D;  1QQO A;  5F2R A;  5FPD A;  1PE4 A;  5EX5 A;  1MYN A;  3QFP A;  1BCG A;  2QWM A;  3GL1 A;  1WT7 A;  1BA0 A;  1AYJ A;  1JKZ A;  2N2R A;  3E7R L;  5AQT A;  5AQK A;  4AAZ A;  4HE7 A;  1OMY A;  2BRZ A;  2LY6 A;  1ATR A;  3M3Z A;  5AR0 A;  3C7N A;  3KHW A;  5FPN A;  2A7T A;  4KBO A;  1B7D A;  3FZH A;  2KSK A;  1NPI A;  2QXL A;  2MN5 A;  1SN4 A;  2M8B B;  1OZZ A;  2QWP A;  1JZA A;  3CW4 A;  3D2F A;  3KOZ A;  3QI7 A;  3PSM A;  5AQL A;  1NRA A;  1AHO A;  3ATU A;  1LQI A;  5AQQ A;  5AQG A;  5AQN A;  1I6G A;  1CN2 A;  1ZUT A;  5AQV A;  4H5R A;  2B68 A;  1NGF A;  1BRZ A;  1TI5 A;  1DQ7 A;  1JZB A;  4CQK A;  1P0A A;  5F0X A;  1SEG A;  1QQM A;  2KYQ A;  2YEO A;  4V1D C;  1DJT A;  3I33 A;  3LDP A;  5F1X A;  1NGD A;  1LQQ A;  1DKG D;  2ASC A;  2E2F A;  1NRB A;  2LN8 A;  2YC1 C;  3FZM A;  4HHF A;  3E7U X;  4FSV A;  5AQZ A;  5AQO A;  3AY9 A;  1I6F A;  1GPS A;  1NH5 A;  1NGE A;  1ZU3 A;  1HJO A;  4AEI A;  5AQH A;  1ICA A;  5EY4 A;  3GKU A;  5AQY A;  1BK8 A;  1QQN A;  4H5N A;  3KOX A;  2GMO A;  1JXC A;  1KAY A;  5BPL A;  2YIO A;  1T0Z A;  1NE5 A;  3A8Y A;  1T7E A;  2V7Z A;  2QW9 A;  1NGA A;  3KP0 A;  3SF4 D;  3FZK A;  2VY6 A;  1N4N A;  2SN3 A;  2LT8 A;  1KV0 A;  1T1T A;  2KPY A;  1HX1 A;  3R2V A;  4UJ0 A;  4UAE F;  2NY8 X;  3QML A;  1MR4 A;  3KOW A;  1NGH A;  2KGQ A;  2LKB A;  1ZVE A;  4H5W A;  1NGB A;  3FZL A;  5AQI A;  1L4V A;  2ATB A;  5AQM A;  2E3G A;  2QWR A;  2E0H A;  3JXU A;  2LJM A;  1B3C A;  1CHZ A;  1KAZ A;  1GPT A;  5AQX A;  5AQU A;  5FPE A;  3FZF A;  5KK4 A;  2LR3 A;  2B3C A;  2MZ0 A;  1BMR A;  2N2Q A;  3FE1 A;  1FH3 A;  1K8B A;  1NGJ A;  3IUC A;  4HWI A;  1BA1 A;  1NGC A;  2NY9 X;  3LDO A;  2E3F A;  5AQW A;  1BUP A;  4KYP A;  4FL9 A;  2KBK A;  1LQH A;  4IO8 A;  4H5T A;  4H5V A;  2KBJ A;  5BPN A;  2KHO A;  1ATS A;  2LY5 A;  3L4I A;  3KP1 A;  3ATV A;  1WMT A;  2G2K A;  2E88 A;  3BK3 C;  1PX9 A;  4GNI A;  2D56 A;  2N69 A;  5AQF A;  2LI7 A;  2QWN A;  5EVZ A;  5AQR A;  1NGG A;  1T7B A;  2YIL A;  1I2U A;  1XRS B;  1ZYV A;  1SNB A;  3LDL A;  5BN9 A;  1UGL A;  2YIP A;  1WWN A;  3L6Q A;  1VNB A;  2QWQ A;  1ZYW A;  3D2E A;  4UAF E;  5BN8 A;  4UAD E;  1SN1 A;  2K35 A;  5AQS A;  5EXW A;  2N66 A;  5FPM A;  1C55 A;  1T7A A;  1ZFU A;  3GDQ A;  1HPM A;  3CQX A;  3QFU A;  2QWL A;  2GL1 A;  3KVG A;  1P00 A;  3KOY A;  2LJ7 A;  3L56 A;  2KJA A;  3HSC A; 
#chains in the Genus database with same CATH homology
 2YBR C;  1PTX A;  1C56 A;  4AB0 A;  1I2V A;  2KBH A;  1VNA A;  1ZVG A;  2I61 A;  5CY0 A;  1PE4 A;  1MYN A;  1BCG A;  1WT7 A;  1AYJ A;  1JKZ A;  2N2R A;  3E7R L;  4AAZ A;  4HE7 A;  1OMY A;  2BRZ A;  2LY6 A;  2A7T A;  1B7D A;  2KSK A;  1NPI A;  1SN4 A;  2M8B B;  1OZZ A;  1JZA A;  3PSM A;  1NRA A;  1AHO A;  1LQI A;  1I6G A;  1CN2 A;  1ZUT A;  2B68 A;  1BRZ A;  1TI5 A;  1DQ7 A;  1JZB A;  4CQK A;  1P0A A;  1SEG A;  2KYQ A;  2YEO A;  4V1D C;  1DJT A;  1LQQ A;  2ASC A;  2YC1 C;  1NRB A;  4HHF A;  3E7U X;  1I6F A;  1GPS A;  1NH5 A;  1ZU3 A;  4AEI A;  1ICA A;  1BK8 A;  1JXC A;  1T0Z A;  1NE5 A;  1T7E A;  1N4N A;  2SN3 A;  2LT8 A;  1KV0 A;  1T1T A;  2KPY A;  4UJ0 A;  2NY8 X;  1MR4 A;  2KGQ A;  2LKB A;  1ZVE A;  1L4V A;  2ATB A;  2E3G A;  2E0H A;  2LJM A;  1B3C A;  1CHZ A;  5KK4 A;  2LR3 A;  2B3C A;  2MZ0 A;  1BMR A;  2N2Q A;  1FH3 A;  2NY9 X;  2E3F A;  4KYP A;  2KBK A;  1LQH A;  2KBJ A;  2LY5 A;  1WMT A;  1PX9 A;  2N69 A;  1GPT A;  2LI7 A;  1T7B A;  1I2U A;  1ZYV A;  1SNB A;  1WWN A;  1VNB A;  1ZYW A;  1SN1 A;  1C55 A;  2N66 A;  1T7A A;  1ZFU A;  2GL1 A;  1P00 A;  2LJ7 A;  2KJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...