1NE5A

Solution structure of herg specific scorpion toxin cnerg1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ergtoxin
publication title Solution structure of CnErg1 (Ergtoxin), a HERG specific scorpion toxin
pubmed doi rcsb
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08086 Toxin_17 Ergtoxin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ne5A00
1BCGA 2N66A 1L4VA 1BRZA 2KYQA 2N2RA 1ZVEA 4HE7A 2E3GA 4AAZA 1ZYVA 1KV0A 1SNBA 2N2QA 3E7UX 1ZUTA 1SN4A 2N69A 2SN3A 1MR4A 1MYNA 2LKBA 1JZAA 2BRZA 1ZU3A 2MZ0A 1B7DA 2LJ7A 1GPSA 1FH3A 5CY0A 1LQHA 1VNAA 1T1TA 1PTXA 2KBHA 1T7EA 1OZZA 2KSKA 2LT8A 1I2VA 2YEOA 2E0HA 1OMYA 1C55A 1JZBA 1ZVGA 1WWNA 2LR3A 4KYPA 1NE5A 2KJAA 1CN2A 2YC1C 1DJTA 1N4NA 2B68A 1T7BA 4AEIA 1I6FA 2LY6A 2LY5A 1I2UA 1NPIA 1C56A 1JXCA 1T7AA 2KPYA 1P0AA 1P00A 1NRAA 1GPTA 1B3CA 2M8BB 1BK8A 1DQ7A 1LQIA 4AB0A 1BMRA 1NH5A 2LJMA 1ICAA 1NRBA 2E3FA 1PE4A 2I61A 1WT7A 1AYJA 1ZFUA 4UJ0A 5KK4A 1T0ZA 1LQQA 2KBKA 3PSMA 2NY9X 1CHZA 4V1DC 4HHFA 2A7TA 3E7RL 2LI7A 2ASCA 1JKZA 1I6GA 1ZYWA 4CQKA 1PX9A 1VNBA 2NY8X 2YBRC 1SEGA 2ATBA 1AHOA 1SN1A 2KBJA 1TI5A 2KGQA 2B3CA 2GL1A 1WMTA
chains in the Genus database with same CATH superfamily
1BCGA 2G2KA 2N66A 1L4VA 5AQZA 3KOZA 1BRZA 2E88A 3C7NA 3LDOA 2KYQA 2N2RA 3KP1A 5F0XA 3M3ZA 1ZVEA 3SF4D 4HE7A 2E3GA 4AAZA 1ZYVA 1NGCA 2LN8A 3FZMA 5AQIA 3LDPA 5FPNA 4H5WA 4UADE 3QMLA 5AQFA 1SNBA 2N2QA 3C7NB 3BK3C 5AQUA 3AY9A 3E7UX 4H5VA 3D2EA 5EXWA 4FL9A 4H5TA 1YUWA 1ZUTA 1SN4A 1NGHA 2QWQA 3KHWA 2N69A 4UAFE 2SN3A 1MR4A 1MYNA 3I33A 3QFUA 5BN8A 1K8BA 2LKBA 1JZAA 2MN5A 3KC6A 4UAEF 2BRZA 1KAZA 1ZU3A 2GL1A 1B7DA 2LJ7A 2MZ0A 2QWLA 2V7ZA 5CY0A 1FH3A 1GPSA 1LQHA 3LDNA 1KAXA 1VNAA 3ATVA 3KVGA 1T1TA 1PTXA 2VY6A 2KBHA 3D2EB 3GL1A 5EVZA 1T7EA 3D2FA 3HSCA 3QFPA 3KOXA 1OZZA 2KSKA 2YIPA 5AQRA 2LT8A 1I2VA 2YEOA 2E0HA 1NGGA 2JDQD 4GNIA 1OMYA 2BUPA 1C55A 1JZBA 1ZVGA 5AQNA 3ATUA 1XRSB 2QWPA 1KAYA 1WWNA 2LR3A 3LDLA 1BA0A 4H5NA 4KYPA 5AQSA 5F1XA 1NE5A 2QWRA 2KJAA 3D2FB 1CN2A 2YC1C 3A8YA 1HPMA 1DJTA 1HX1A 1QQNA 3FE1A 3CW4A 1N4NA 5AQMA 5BPLA 5FPMA 2B68A 1T7BA 3L56A 5AQVA 1QQOA 1ATRA 4AEIA 1JKZA 1I6FA 1QQMA 2LY5A 2LY6A 1NPIA 1I2UA 2MBKA 2YILA 5AQWA 1UGLA 1DKGD 5AR0A 1C56A 1JXCA 1T7AA 3FZLA 3GDQA 2KPYA 1NGJA 1P0AA 1P00A 5EY4A 5BPMA 1NRAA 3IUCA 1GPTA 3FZKA 1B3CA 2M8BB 2YIOA 1BK8A 1DQ7A 1LQIA 2E2FA 2QW9A 4AB0A 3L4IA 1BMRA 1NH5A 2LJMA 5AQQA 5BN9A 1ICAA 1NRBA 2D56A 2E3FA 5F2RA 1NGDA 4H5RA 3QI7A 5BPNA 1PE4A 3KOYA 2I61A 1NGFA 1WT7A 1NGEA 1AYJA 1ZFUA 4UJ0A 3CQXA 5KK4A 5AQTA 1T0ZA 1LQQA 2KBKA 1ATSA 1POIA 4KBOA 3FZFA 3KOWA 1NGAA 2QXLA 5AQHA 5AQKA 3PSMA 2QWOA 2NY9X 1CHZA 3L6QA 4V1DC 5AQOA 5AQJA 4HHFA 2A7TA 3E7RL 1NGIA 1BA1A 2ASCA 2LI7A 2QWMA 3KP0A 4HWIA 5AQYA 1ZYWA 4CQKA 1PX9A 1I6GA 1VNBA 2NY8X 1S3XA 2YBRC 4IO8A 5AQGA 3FZHA 1SEGA 5AQLA 5AQXA 2KHOA 2GMOA 5EX5A 5FPDA 2ATBA 3R2VA 1AHOA 3GKUA 1SN1A 3JXUA 5AQPA 2KBJA 5FPEA 1TI5A 1NGBA 2KGQA 2K35A 2QWNA 2B3CA 1BUPA 4FSVA 1KV0A 3LDQA 1HJOA 2E8AA 1WMTA
chains in the Genus database with same CATH topology
1BCGA 2N66A 1L4VA 1BRZA 2KYQA 2N2RA 1ZVEA 4HE7A 2E3GA 4AAZA 1ZYVA 1KV0A 1SNBA 2N2QA 3E7UX 1ZUTA 1SN4A 2N69A 2SN3A 1MR4A 1MYNA 2LKBA 1JZAA 2BRZA 1ZU3A 2MZ0A 1B7DA 2LJ7A 1GPSA 1FH3A 5CY0A 1LQHA 1VNAA 1T1TA 1PTXA 2KBHA 1T7EA 1OZZA 2KSKA 2LT8A 1I2VA 2YEOA 2E0HA 1OMYA 1C55A 1JZBA 1ZVGA 1WWNA 2LR3A 4KYPA 1NE5A 2KJAA 1CN2A 2YC1C 1DJTA 1N4NA 2B68A 1T7BA 4AEIA 1I6FA 2LY6A 2LY5A 1I2UA 1NPIA 1C56A 1JXCA 1T7AA 2KPYA 1P0AA 1P00A 1NRAA 1GPTA 1B3CA 2M8BB 1BK8A 1DQ7A 1LQIA 4AB0A 1BMRA 1NH5A 2LJMA 1ICAA 1NRBA 2E3FA 1PE4A 2I61A 1WT7A 1AYJA 1ZFUA 4UJ0A 5KK4A 1T0ZA 1LQQA 2KBKA 3PSMA 2NY9X 1CHZA 4V1DC 4HHFA 2A7TA 3E7RL 2LI7A 2ASCA 1JKZA 1I6GA 1ZYWA 4CQKA 1PX9A 1VNBA 2NY8X 2YBRC 1SEGA 2ATBA 1AHOA 1SN1A 2KBJA 1TI5A 2KGQA 2B3CA 2GL1A 1WMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCG A;  2N66 A;  1L4V A;  1BRZ A;  2KYQ A;  2N2R A;  1ZVE A;  4HE7 A;  2E3G A;  4AAZ A;  1ZYV A;  1KV0 A;  1SNB A;  2N2Q A;  3E7U X;  1ZUT A;  1SN4 A;  2N69 A;  2SN3 A;  1MR4 A;  1MYN A;  2LKB A;  1JZA A;  2BRZ A;  1ZU3 A;  2MZ0 A;  1B7D A;  2LJ7 A;  1GPS A;  1FH3 A;  5CY0 A;  1LQH A;  1VNA A;  1T1T A;  1PTX A;  2KBH A;  1T7E A;  1OZZ A;  2KSK A;  2LT8 A;  1I2V A;  2YEO A;  2E0H A;  1OMY A;  1C55 A;  1JZB A;  1ZVG A;  1WWN A;  2LR3 A;  4KYP A;  1NE5 A;  2KJA A;  1CN2 A;  2YC1 C;  1DJT A;  1N4N A;  2B68 A;  1T7B A;  4AEI A;  1I6F A;  2LY6 A;  2LY5 A;  1I2U A;  1NPI A;  1C56 A;  1JXC A;  1T7A A;  2KPY A;  1P0A A;  1P00 A;  1NRA A;  1GPT A;  1B3C A;  2M8B B;  1BK8 A;  1DQ7 A;  1LQI A;  4AB0 A;  1BMR A;  1NH5 A;  2LJM A;  1ICA A;  1NRB A;  2E3F A;  1PE4 A;  2I61 A;  1WT7 A;  1AYJ A;  1ZFU A;  4UJ0 A;  5KK4 A;  1T0Z A;  1LQQ A;  2KBK A;  3PSM A;  2NY9 X;  1CHZ A;  4V1D C;  4HHF A;  2A7T A;  3E7R L;  2LI7 A;  2ASC A;  1JKZ A;  1I6G A;  1ZYW A;  4CQK A;  1PX9 A;  1VNB A;  2NY8 X;  2YBR C;  1SEG A;  2ATB A;  1AHO A;  1SN1 A;  2KBJ A;  1TI5 A;  2KGQ A;  2B3C A;  2GL1 A;  1WMT A; 
#chains in the Genus database with same CATH topology
 1BCG A;  2G2K A;  2N66 A;  1L4V A;  5AQZ A;  3KOZ A;  1BRZ A;  2E88 A;  3C7N A;  3LDO A;  2KYQ A;  2N2R A;  3KP1 A;  5F0X A;  3M3Z A;  1ZVE A;  3SF4 D;  4HE7 A;  2E3G A;  4AAZ A;  1ZYV A;  1NGC A;  2LN8 A;  3FZM A;  5AQI A;  3LDP A;  5FPN A;  4H5W A;  4UAD E;  3QML A;  5AQF A;  1SNB A;  2N2Q A;  3C7N B;  3BK3 C;  5AQU A;  3AY9 A;  3E7U X;  4H5V A;  3D2E A;  5EXW A;  4FL9 A;  4H5T A;  1YUW A;  1ZUT A;  1SN4 A;  1NGH A;  2QWQ A;  3KHW A;  2N69 A;  4UAF E;  2SN3 A;  1MR4 A;  1MYN A;  3I33 A;  3QFU A;  5BN8 A;  1K8B A;  2LKB A;  1JZA A;  2MN5 A;  3KC6 A;  4UAE F;  2BRZ A;  1KAZ A;  1ZU3 A;  2GL1 A;  1B7D A;  2LJ7 A;  2MZ0 A;  2QWL A;  2V7Z A;  5CY0 A;  1FH3 A;  1GPS A;  1LQH A;  3LDN A;  1KAX A;  1VNA A;  3ATV A;  3KVG A;  1T1T A;  1PTX A;  2VY6 A;  2KBH A;  3D2E B;  3GL1 A;  5EVZ A;  1T7E A;  3D2F A;  3HSC A;  3QFP A;  3KOX A;  1OZZ A;  2KSK A;  2YIP A;  5AQR A;  2LT8 A;  1I2V A;  2YEO A;  2E0H A;  1NGG A;  2JDQ D;  4GNI A;  1OMY A;  2BUP A;  1C55 A;  1JZB A;  1ZVG A;  5AQN A;  3ATU A;  1XRS B;  2QWP A;  1KAY A;  1WWN A;  2LR3 A;  3LDL A;  1BA0 A;  4H5N A;  4KYP A;  5AQS A;  5F1X A;  1NE5 A;  2QWR A;  2KJA A;  3D2F B;  1CN2 A;  2YC1 C;  3A8Y A;  1HPM A;  1DJT A;  1HX1 A;  1QQN A;  3FE1 A;  3CW4 A;  1N4N A;  5AQM A;  5BPL A;  5FPM A;  2B68 A;  1T7B A;  3L56 A;  5AQV A;  1QQO A;  1ATR A;  4AEI A;  1JKZ A;  1I6F A;  1QQM A;  2LY5 A;  2LY6 A;  1NPI A;  1I2U A;  2MBK A;  2YIL A;  5AQW A;  1UGL A;  1DKG D;  5AR0 A;  1C56 A;  1JXC A;  1T7A A;  3FZL A;  3GDQ A;  2KPY A;  1NGJ A;  1P0A A;  1P00 A;  5EY4 A;  5BPM A;  1NRA A;  3IUC A;  1GPT A;  3FZK A;  1B3C A;  2M8B B;  2YIO A;  1BK8 A;  1DQ7 A;  1LQI A;  2E2F A;  2QW9 A;  4AB0 A;  3L4I A;  1BMR A;  1NH5 A;  2LJM A;  5AQQ A;  5BN9 A;  1ICA A;  1NRB A;  2D56 A;  2E3F A;  5F2R A;  1NGD A;  4H5R A;  3QI7 A;  5BPN A;  1PE4 A;  3KOY A;  2I61 A;  1NGF A;  1WT7 A;  1NGE A;  1AYJ A;  1ZFU A;  4UJ0 A;  3CQX A;  5KK4 A;  5AQT A;  1T0Z A;  1LQQ A;  2KBK A;  1ATS A;  1POI A;  4KBO A;  3FZF A;  3KOW A;  1NGA A;  2QXL A;  5AQH A;  5AQK A;  3PSM A;  2QWO A;  2NY9 X;  1CHZ A;  3L6Q A;  4V1D C;  5AQO A;  5AQJ A;  4HHF A;  2A7T A;  3E7R L;  1NGI A;  1BA1 A;  2ASC A;  2LI7 A;  2QWM A;  3KP0 A;  4HWI A;  5AQY A;  1ZYW A;  4CQK A;  1PX9 A;  1I6G A;  1VNB A;  2NY8 X;  1S3X A;  2YBR C;  4IO8 A;  5AQG A;  3FZH A;  1SEG A;  5AQL A;  5AQX A;  2KHO A;  2GMO A;  5EX5 A;  5FPD A;  2ATB A;  3R2V A;  1AHO A;  3GKU A;  1SN1 A;  3JXU A;  5AQP A;  2KBJ A;  5FPE A;  1TI5 A;  1NGB A;  2KGQ A;  2K35 A;  2QWN A;  2B3C A;  1BUP A;  4FSV A;  1KV0 A;  3LDQ A;  1HJO A;  2E8A A;  1WMT A; 
#chains in the Genus database with same CATH homology
 1BCG A;  2N66 A;  1L4V A;  1BRZ A;  2KYQ A;  2N2R A;  1ZVE A;  4HE7 A;  2E3G A;  4AAZ A;  1ZYV A;  1KV0 A;  1SNB A;  2N2Q A;  3E7U X;  1ZUT A;  1SN4 A;  2N69 A;  2SN3 A;  1MR4 A;  1MYN A;  2LKB A;  1JZA A;  2BRZ A;  1ZU3 A;  2MZ0 A;  1B7D A;  2LJ7 A;  1GPS A;  1FH3 A;  5CY0 A;  1LQH A;  1VNA A;  1T1T A;  1PTX A;  2KBH A;  1T7E A;  1OZZ A;  2KSK A;  2LT8 A;  1I2V A;  2YEO A;  2E0H A;  1OMY A;  1C55 A;  1JZB A;  1ZVG A;  1WWN A;  2LR3 A;  4KYP A;  1NE5 A;  2KJA A;  1CN2 A;  2YC1 C;  1DJT A;  1N4N A;  2B68 A;  1T7B A;  4AEI A;  1I6F A;  2LY6 A;  2LY5 A;  1I2U A;  1NPI A;  1C56 A;  1JXC A;  1T7A A;  2KPY A;  1P0A A;  1P00 A;  1NRA A;  1GPT A;  1B3C A;  2M8B B;  1BK8 A;  1DQ7 A;  1LQI A;  4AB0 A;  1BMR A;  1NH5 A;  2LJM A;  1ICA A;  1NRB A;  2E3F A;  1PE4 A;  2I61 A;  1WT7 A;  1AYJ A;  1ZFU A;  4UJ0 A;  5KK4 A;  1T0Z A;  1LQQ A;  2KBK A;  3PSM A;  2NY9 X;  1CHZ A;  4V1D C;  4HHF A;  2A7T A;  3E7R L;  2LI7 A;  2ASC A;  1JKZ A;  1I6G A;  1ZYW A;  4CQK A;  1PX9 A;  1VNB A;  2NY8 X;  2YBR C;  1SEG A;  2ATB A;  1AHO A;  1SN1 A;  2KBJ A;  1TI5 A;  2KGQ A;  2B3C A;  2GL1 A;  1WMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...