2JDQD

C-terminal domain of influenza a virus polymerase pb2 subunit in complex with human importin alpha5
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
63
Chain Sequence
SAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSQTATKRIRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords IMPORTIN ALPHA-1 SUBUNIT
publication title Structure and Nuclear Import Function of the C- Terminal Domain of Influenza Virus Polymerase Pb2 Subunit
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 63
sequence length 69
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2jdqD00
3CW4A 4UADE 2VY6A 3KC6A 3KHWA 3R2VA 2GMOA 4UAEF 3L56A 2JDQD 4UAFE
chains in the Genus database with same CATH superfamily
5AQQA 1CHZA 1NGFA 3KC6A 2BUPA 5EX5A 5CY0A 1NGEA 4UJ0A 2ATBA 3KOYA 1JZAA 2B68A 2QWOA 3D2FA 1YUWA 1SNBA 2QWRA 2QWQA 2QWMA 5AQRA 5AQFA 2LY6A 1NGGA 3D2EB 3SF4D 2LJ7A 1P0AA 3QFUA 5F2RA 3C7NB 1DJTA 1ZFUA 1WWNA 2QWNA 2YEOA 2YIOA 5AQKA 3GL1A 2YILA 1BUPA 1POIA 3R2VA 3QFPA 2QWPA 1NH5A 1BA1A 1P00A 3LDLA 1PX9A 2N66A 2NY9X 1NE5A 1ZU3A 2E3GA 1HJOA 2NY8X 2LR3A 5AQVA 1NGHA 1CN2A 4IO8A 3LDQA 4KYPA 5AQWA 1I6FA 1NGCA 3KVGA 2KGQA 5F1XA 1MR4A 2V7ZA 3FZHA 2E3FA 1BRZA 1LQHA 2MZ0A 3BK3C 3LDOA 3D2EA 3FE1A 4H5VA 2KYQA 1ATRA 3M3ZA 3C7NA 2MN5A 3FZLA 2VY6A 3GKUA 1NPIA 4KBOA 3L6QA 1ZUTA 3FZKA 1B3CA 5AQHA 1KAXA 3E7UX 2GL1A 1QQNA 3CW4A 2E2FA 2KBHA 2N2QA 1ZYWA 1ATSA 4H5TA 5AQLA 3HSCA 5AQYA 3L4IA 1XRSB 1AHOA 2N69A 1NGBA 3A8YA 4HWIA 5F0XA 1S3XA 1NGDA 1KAYA 3KP0A 2QXLA 1JXCA 1N4NA 2KPYA 2YC1C 1I2VA 2LI7A 4HHFA 1LQQA 4AAZA 5EXWA 3IUCA 3KOXA 5AQOA 1VNBA 2LN8A 4FSVA 1BK8A 5AQMA 4HE7A 5AR0A 3L56A 2JDQD 1T7EA 2QW9A 1WT7A 2LJMA 5FPMA 5BN9A 2MBKA 1QQMA 2B3CA 2G2KA 3JXUA 5AQSA 1K8BA 5BN8A 3CQXA 1B7DA 5AQJA 5BPLA 3QI7A 1BA0A 2KBJA 3KP1A 1I2UA 3KOZA 2LY5A 3FZMA 5AQZA 2I61A 4UAEF 3PSMA 1SEGA 1OMYA 5AQIA 2LKBA 5AQUA 3GDQA 1T7AA 4UADE 1SN1A 5EY4A 2E8AA 1HX1A 2YBRC 1BCGA 2KSKA 1DKGD 1TI5A 2KBKA 2KHOA 4H5RA 1C55A 1KAZA 1QQOA 5AQPA 5AQGA 1UGLA 4AEIA 2M8BB 3ATUA 4H5NA 1LQIA 2A7TA 2K35A 4H5WA 1JZBA 1T1TA 3KHWA 5BPMA 1AYJA 1WMTA 1GPTA 1ICAA 3E7RL 1T0ZA 5FPNA 3KOWA 1GPSA 2SN3A 3LDPA 2E88A 1DQ7A 1MYNA 1ZVEA 1VNAA 2N2RA 4FL9A 4UAFE 1JKZA 5BPNA 1I6GA 1C56A 1PE4A 1SN4A 5FPEA 2YIPA 1HPMA 1NRAA 5AQXA 1NRBA 1BMRA 1KV0A 1T7BA 2KJAA 5FPDA 3D2FB 1ZYVA 1NGJA 1ZVGA 3I33A 3FZFA 5EVZA 5AQNA 2GMOA 1FH3A 2ASCA 2D56A 3AY9A 2LT8A 5AQTA 3LDNA 5KK4A 1OZZA 1PTXA 4V1DC 4AB0A 4CQKA 3ATVA 3QMLA 4GNIA 1NGIA 2E0HA 1L4VA 2QWLA 2BRZA 1NGAA
chains in the Genus database with same CATH topology
5AQQA 1NGFA 3KC6A 2BUPA 5EX5A 1NGEA 2QWOA 3D2FA 1YUWA 2QWRA 2QWQA 2QWMA 5AQRA 5AQFA 1NGGA 3D2EB 3SF4D 3QFUA 5F2RA 3C7NB 2QWNA 2YIOA 5AQKA 3GL1A 2YILA 1BUPA 1POIA 3R2VA 3QFPA 2QWPA 1BA1A 3LDLA 1HJOA 5AQVA 1NGHA 4IO8A 3LDQA 5AQWA 1NGCA 3KVGA 5F1XA 2V7ZA 3FZHA 3BK3C 4H5VA 3LDOA 3D2EA 3FE1A 1ATRA 3M3ZA 3C7NA 2MN5A 3FZLA 2VY6A 4KBOA 3L6QA 3FZKA 5AQHA 1KAXA 1QQNA 3CW4A 2E2FA 1ATSA 4H5TA 5AQLA 3HSCA 5AQYA 3L4IA 1NGBA 3A8YA 4HWIA 5F0XA 1S3XA 1NGDA 1KAYA 2QXLA 5EXWA 3IUCA 5AQOA 2LN8A 4FSVA 5AQMA 5AR0A 3L56A 2JDQD 2QW9A 5FPMA 5BN9A 2MBKA 1QQMA 3JXUA 5AQSA 5BN8A 3CQXA 5BPLA 5AQJA 3QI7A 1BA0A 5AQZA 3FZMA 4UAEF 5AQUA 5AQIA 3GDQA 4UADE 5EY4A 2E8AA 1HX1A 4H5RA 2KHOA 1DKGD 1KAZA 1QQOA 5AQPA 5AQGA 3ATUA 4H5NA 2K35A 4H5WA 5BPMA 3KHWA 5FPNA 3LDPA 2E88A 4UAFE 4FL9A 5BPNA 5FPEA 2YIPA 1HPMA 5AQXA 5FPDA 3D2FB 1NGJA 3I33A 3FZFA 5EVZA 5AQNA 2GMOA 2D56A 3AY9A 5AQTA 3LDNA 3ATVA 3QMLA 4GNIA 1NGIA 2QWLA 1NGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CW4 A;  4UAD E;  2VY6 A;  3KC6 A;  3KHW A;  3R2V A;  2GMO A;  4UAE F;  3L56 A;  2JDQ D;  4UAF E; 
#chains in the Genus database with same CATH topology
 5AQQ A;  1CHZ A;  1NGF A;  3KC6 A;  2BUP A;  5EX5 A;  5CY0 A;  1NGE A;  4UJ0 A;  2ATB A;  3KOY A;  1JZA A;  2B68 A;  2QWO A;  3D2F A;  1YUW A;  1SNB A;  2QWR A;  2QWQ A;  2QWM A;  5AQR A;  5AQF A;  2LY6 A;  1NGG A;  3D2E B;  3SF4 D;  2LJ7 A;  1P0A A;  3QFU A;  5F2R A;  3C7N B;  1DJT A;  1ZFU A;  1WWN A;  2QWN A;  2YEO A;  2YIO A;  5AQK A;  3GL1 A;  2YIL A;  1BUP A;  1POI A;  3R2V A;  3QFP A;  2QWP A;  1NH5 A;  1BA1 A;  1P00 A;  3LDL A;  1PX9 A;  2N66 A;  2NY9 X;  1NE5 A;  1ZU3 A;  2E3G A;  1HJO A;  2NY8 X;  2LR3 A;  5AQV A;  1NGH A;  1CN2 A;  4IO8 A;  3LDQ A;  4KYP A;  5AQW A;  1I6F A;  1NGC A;  3KVG A;  2KGQ A;  5F1X A;  1MR4 A;  2V7Z A;  3FZH A;  2E3F A;  1BRZ A;  1LQH A;  2MZ0 A;  3BK3 C;  3LDO A;  3D2E A;  3FE1 A;  4H5V A;  2KYQ A;  1ATR A;  3M3Z A;  3C7N A;  2MN5 A;  3FZL A;  2VY6 A;  3GKU A;  1NPI A;  4KBO A;  3L6Q A;  1ZUT A;  3FZK A;  1B3C A;  5AQH A;  1KAX A;  3E7U X;  2GL1 A;  1QQN A;  3CW4 A;  2E2F A;  2KBH A;  2N2Q A;  1ZYW A;  1ATS A;  4H5T A;  5AQL A;  3HSC A;  5AQY A;  3L4I A;  1XRS B;  1AHO A;  2N69 A;  1NGB A;  3A8Y A;  4HWI A;  5F0X A;  1S3X A;  1NGD A;  1KAY A;  3KP0 A;  2QXL A;  1JXC A;  1N4N A;  2KPY A;  2YC1 C;  1I2V A;  2LI7 A;  4HHF A;  1LQQ A;  4AAZ A;  5EXW A;  3IUC A;  3KOX A;  5AQO A;  1VNB A;  2LN8 A;  4FSV A;  1BK8 A;  5AQM A;  4HE7 A;  5AR0 A;  3L56 A;  2JDQ D;  1T7E A;  2QW9 A;  1WT7 A;  2LJM A;  5FPM A;  5BN9 A;  2MBK A;  1QQM A;  2B3C A;  2G2K A;  3JXU A;  5AQS A;  1K8B A;  5BN8 A;  3CQX A;  1B7D A;  5AQJ A;  5BPL A;  3QI7 A;  1BA0 A;  2KBJ A;  3KP1 A;  1I2U A;  3KOZ A;  2LY5 A;  3FZM A;  5AQZ A;  2I61 A;  4UAE F;  3PSM A;  1SEG A;  1OMY A;  5AQI A;  2LKB A;  5AQU A;  3GDQ A;  1T7A A;  4UAD E;  1SN1 A;  5EY4 A;  2E8A A;  1HX1 A;  2YBR C;  1BCG A;  2KSK A;  1DKG D;  1TI5 A;  2KBK A;  2KHO A;  4H5R A;  1C55 A;  1KAZ A;  1QQO A;  5AQP A;  5AQG A;  1UGL A;  4AEI A;  2M8B B;  3ATU A;  4H5N A;  1LQI A;  2A7T A;  2K35 A;  4H5W A;  1JZB A;  1T1T A;  3KHW A;  5BPM A;  1AYJ A;  1WMT A;  1GPT A;  1ICA A;  3E7R L;  1T0Z A;  5FPN A;  3KOW A;  1GPS A;  2SN3 A;  3LDP A;  2E88 A;  1DQ7 A;  1MYN A;  1ZVE A;  1VNA A;  2N2R A;  4FL9 A;  4UAF E;  1JKZ A;  5BPN A;  1I6G A;  1C56 A;  1PE4 A;  1SN4 A;  5FPE A;  2YIP A;  1HPM A;  1NRA A;  5AQX A;  1NRB A;  1BMR A;  1KV0 A;  1T7B A;  2KJA A;  5FPD A;  3D2F B;  1ZYV A;  1NGJ A;  1ZVG A;  3I33 A;  3FZF A;  5EVZ A;  5AQN A;  2GMO A;  1FH3 A;  2ASC A;  2D56 A;  3AY9 A;  2LT8 A;  5AQT A;  3LDN A;  5KK4 A;  1OZZ A;  1PTX A;  4V1D C;  4AB0 A;  4CQK A;  3ATV A;  3QML A;  4GNI A;  1NGI A;  2E0H A;  1L4V A;  2QWL A;  2BRZ A;  1NGA A; 
#chains in the Genus database with same CATH homology
 5AQQ A;  1NGF A;  3KC6 A;  2BUP A;  5EX5 A;  1NGE A;  2QWO A;  3D2F A;  1YUW A;  2QWR A;  2QWQ A;  2QWM A;  5AQR A;  5AQF A;  1NGG A;  3D2E B;  3SF4 D;  3QFU A;  5F2R A;  3C7N B;  2QWN A;  2YIO A;  5AQK A;  3GL1 A;  2YIL A;  1BUP A;  1POI A;  3R2V A;  3QFP A;  2QWP A;  1BA1 A;  3LDL A;  1HJO A;  5AQV A;  1NGH A;  4IO8 A;  3LDQ A;  5AQW A;  1NGC A;  3KVG A;  5F1X A;  2V7Z A;  3FZH A;  3BK3 C;  4H5V A;  3LDO A;  3D2E A;  3FE1 A;  1ATR A;  3M3Z A;  3C7N A;  2MN5 A;  3FZL A;  2VY6 A;  4KBO A;  3L6Q A;  3FZK A;  5AQH A;  1KAX A;  1QQN A;  3CW4 A;  2E2F A;  1ATS A;  4H5T A;  5AQL A;  3HSC A;  5AQY A;  3L4I A;  1NGB A;  3A8Y A;  4HWI A;  5F0X A;  1S3X A;  1NGD A;  1KAY A;  2QXL A;  5EXW A;  3IUC A;  5AQO A;  2LN8 A;  4FSV A;  5AQM A;  5AR0 A;  3L56 A;  2JDQ D;  2QW9 A;  5FPM A;  5BN9 A;  2MBK A;  1QQM A;  3JXU A;  5AQS A;  5BN8 A;  3CQX A;  5BPL A;  5AQJ A;  3QI7 A;  1BA0 A;  5AQZ A;  3FZM A;  4UAE F;  5AQU A;  5AQI A;  3GDQ A;  4UAD E;  5EY4 A;  2E8A A;  1HX1 A;  4H5R A;  2KHO A;  1DKG D;  1KAZ A;  1QQO A;  5AQP A;  5AQG A;  3ATU A;  4H5N A;  2K35 A;  4H5W A;  5BPM A;  3KHW A;  5FPN A;  3LDP A;  2E88 A;  4UAF E;  4FL9 A;  5BPN A;  5FPE A;  2YIP A;  1HPM A;  5AQX A;  5FPD A;  3D2F B;  1NGJ A;  3I33 A;  3FZF A;  5EVZ A;  5AQN A;  2GMO A;  2D56 A;  3AY9 A;  5AQT A;  3LDN A;  3ATV A;  3QML A;  4GNI A;  1NGI A;  2QWL A;  1NGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...