1WMTA

Scorpion toxin (istx) from opisthacanthus madagascariensis
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
41
structure length
41
Chain Sequence
VHTNIPCRGTSDCYEPCEKKYNCARAKCMNRHCNCYNNCPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of IsTX: A male scorpion toxin from Opisthacanthus madagascariensis (Ischnuridae)
pubmed doi rcsb
molecule keywords IsTX
molecule tags Toxin
total genus 7
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1wmtA00
2KJAA 2KSKA 1ZFUA 1AYJA 1P0AA 2YBRC 1BK8A 1T7BA 1NRAA 2KBJA 2NY8X 1BCGA 1BMRA 2N69A 4HHFA 1SEGA 1T7AA 1ZYVA 1B7DA 1JZAA 2KYQA 2KPYA 2YC1C 2KGQA 4KYPA 1JKZA 1ZUTA 4UJ0A 1T0ZA 2I61A 1I2UA 1GPTA 1PE4A 4AB0A 1OZZA 1DQ7A 2LJ7A 2B3CA 5CY0A 1ZYWA 1SN4A 2ASCA 1FH3A 2MZ0A 2E0HA 1ZVEA 1I6GA 1NH5A 1NE5A 1JZBA 2A7TA 3E7RL 1I2VA 1DJTA 4V1DC 1I6FA 4CQKA 1MYNA 2LJMA 2E3FA 3PSMA 2M8BB 1GPSA 1CHZA 5KK4A 1C55A 1LQQA 1VNAA 1NRBA 1WMTA 2B68A 1JXCA 1ICAA 1NPIA 4AEIA 2LR3A 1LQHA 1OMYA 1B3CA 2LY6A 1KV0A 2N2QA 1WWNA 2YEOA 2LI7A 1CN2A 2KBHA 1P00A 2BRZA 1ZVGA 1T1TA 1MR4A 3E7UX 2GL1A 1AHOA 1N4NA 1SN1A 2SN3A 1BRZA 2E3GA 2N2RA 2N66A 1PX9A 2LY5A 2NY9X 1WT7A 1T7EA 4HE7A 2KBKA 1SNBA 1ZU3A 1LQIA 1VNBA 2LKBA 1TI5A 2LT8A 4AAZA 1L4VA 2ATBA 1C56A 1PTXA
chains in the Genus database with same CATH superfamily
2KJAA 2KSKA 1ZFUA 3KOZA 5AQRA 1DKGD 3R2VA 2YILA 1AYJA 5AQQA 1P0AA 3LDOA 2YBRC 1BK8A 3LDPA 1T7BA 1NRAA 2KBJA 2NY8X 3FZKA 1BCGA 3QMLA 4UAEF 3LDLA 1BMRA 2N69A 4HHFA 5BN8A 1SEGA 3L56A 1T7AA 4UAFE 2QXLA 1ZYVA 1QQOA 3L4IA 3GDQA 4KBOA 1B7DA 3FZLA 5BPMA 3D2EB 3A8YA 3D2FA 2QWPA 1JZAA 1POIA 1S3XA 1BA1A 2KYQA 2K35A 2VY6A 2KPYA 1KAZA 2YC1C 5AQJA 3L6QA 2KGQA 1NGBA 2D56A 2G2KA 4KYPA 1NGDA 3AY9A 3KP1A 1NGIA 1HX1A 1JKZA 3LDQA 4H5WA 1ZUTA 4UJ0A 5AQFA 1T0ZA 2I61A 1I2UA 1GPTA 1PE4A 4AB0A 1BA0A 1KAXA 1DQ7A 1NGJA 1OZZA 2LJ7A 3QI7A 3QFUA 5AQPA 2QWNA 2B3CA 5AQKA 5CY0A 1ZYWA 1SN4A 3ATUA 5AQIA 2MN5A 4HWIA 2ASCA 1FH3A 2MZ0A 1NGEA 1YUWA 1ATSA 2E0HA 3CQXA 4IO8A 5AQLA 1ZVEA 5F2RA 1I6GA 5AQOA 1NH5A 1NE5A 1JZBA 1QQMA 5FPMA 5F0XA 3C7NA 2V7ZA 3HSCA 2A7TA 2YIOA 3E7RL 3ATVA 1I2VA 1DJTA 1QQNA 3JXUA 3GKUA 4V1DC 4UADE 1I6FA 2E8AA 3KHWA 3FZMA 4CQKA 4H5VA 2GMOA 5AQHA 1MYNA 2LJMA 5FPDA 2E3FA 3GL1A 3KOWA 3PSMA 5FPEA 4H5NA 5AR0A 2M8BB 3IUCA 3KOXA 2E2FA 1GPSA 1CHZA 1NGHA 2QWLA 5KK4A 1C55A 1LQQA 1VNAA 1NRBA 1HJOA 1NGFA 3FZFA 2QW9A 1HPMA 5AQSA 1WMTA 3QFPA 3D2EA 2QWQA 2B68A 5F1XA 4FSVA 5AQNA 5AQUA 1JXCA 1ICAA 5AQMA 5FPNA 1NPIA 4AEIA 2LR3A 5BPLA 1LQHA 1OMYA 5EXWA 3BK3C 5BN9A 1B3CA 2LY6A 1BUPA 3FE1A 3D2FB 5AQVA 1KV0A 2N2QA 1WWNA 2JDQD 1NGAA 2YEOA 2LI7A 3FZHA 3KOYA 5EX5A 1CN2A 3CW4A 2KBHA 4GNIA 5AQWA 1NGCA 3KVGA 3LDNA 5AQYA 1K8BA 2KHOA 5AQTA 1KAYA 2BUPA 1P00A 2E88A 1NGGA 1ZVGA 2BRZA 1T1TA 1MR4A 2QWOA 2GL1A 1AHOA 3E7UX 4H5RA 1N4NA 1SN1A 2SN3A 1BRZA 2E3GA 3KP0A 2QWMA 5EVZA 2N2RA 2N66A 2YIPA 1PX9A 5EY4A 3SF4D 1UGLA 2LY5A 2NY9X 1WT7A 1T7EA 4HE7A 5AQXA 2KBKA 1SNBA 1ZU3A 3M3ZA 5AQZA 1LQIA 3I33A 1VNBA 2LKBA 1XRSB 1TI5A 4FL9A 5BPNA 2LT8A 3C7NB 4AAZA 1L4VA 2ATBA 2LN8A 1C56A 5AQGA 2QWRA 1PTXA 4H5TA 3KC6A 1ATRA 2MBKA
chains in the Genus database with same CATH topology
2KJAA 2KSKA 1ZFUA 1AYJA 1P0AA 2YBRC 1BK8A 1T7BA 1NRAA 2KBJA 2NY8X 1BCGA 1BMRA 2N69A 4HHFA 1SEGA 1T7AA 1ZYVA 1B7DA 1JZAA 2KYQA 2KPYA 2YC1C 2KGQA 4KYPA 1JKZA 1ZUTA 4UJ0A 1T0ZA 2I61A 1I2UA 1GPTA 1PE4A 4AB0A 1OZZA 1DQ7A 2LJ7A 2B3CA 5CY0A 1ZYWA 1SN4A 2ASCA 1FH3A 2MZ0A 2E0HA 1ZVEA 1I6GA 1NH5A 1NE5A 1JZBA 2A7TA 3E7RL 1I2VA 1DJTA 4V1DC 1I6FA 4CQKA 1MYNA 2LJMA 2E3FA 3PSMA 2M8BB 1GPSA 1CHZA 5KK4A 1C55A 1LQQA 1VNAA 1NRBA 1WMTA 2B68A 1JXCA 1ICAA 1NPIA 4AEIA 2LR3A 1LQHA 1OMYA 1B3CA 2LY6A 1KV0A 2N2QA 1WWNA 2YEOA 2LI7A 1CN2A 2KBHA 1P00A 2BRZA 1ZVGA 1T1TA 1MR4A 3E7UX 2GL1A 1AHOA 1N4NA 1SN1A 2SN3A 1BRZA 2E3GA 2N2RA 2N66A 1PX9A 2LY5A 2NY9X 1WT7A 1T7EA 4HE7A 2KBKA 1SNBA 1ZU3A 1LQIA 1VNBA 2LKBA 1TI5A 2LT8A 4AAZA 1L4VA 2ATBA 1C56A 1PTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KJA A;  2KSK A;  1ZFU A;  1AYJ A;  1P0A A;  2YBR C;  1BK8 A;  1T7B A;  1NRA A;  2KBJ A;  2NY8 X;  1BCG A;  1BMR A;  2N69 A;  4HHF A;  1SEG A;  1T7A A;  1ZYV A;  1B7D A;  1JZA A;  2KYQ A;  2KPY A;  2YC1 C;  2KGQ A;  4KYP A;  1JKZ A;  1ZUT A;  4UJ0 A;  1T0Z A;  2I61 A;  1I2U A;  1GPT A;  1PE4 A;  4AB0 A;  1OZZ A;  1DQ7 A;  2LJ7 A;  2B3C A;  5CY0 A;  1ZYW A;  1SN4 A;  2ASC A;  1FH3 A;  2MZ0 A;  2E0H A;  1ZVE A;  1I6G A;  1NH5 A;  1NE5 A;  1JZB A;  2A7T A;  3E7R L;  1I2V A;  1DJT A;  4V1D C;  1I6F A;  4CQK A;  1MYN A;  2LJM A;  2E3F A;  3PSM A;  2M8B B;  1GPS A;  1CHZ A;  5KK4 A;  1C55 A;  1LQQ A;  1VNA A;  1NRB A;  1WMT A;  2B68 A;  1JXC A;  1ICA A;  1NPI A;  4AEI A;  2LR3 A;  1LQH A;  1OMY A;  1B3C A;  2LY6 A;  1KV0 A;  2N2Q A;  1WWN A;  2YEO A;  2LI7 A;  1CN2 A;  2KBH A;  1P00 A;  2BRZ A;  1ZVG A;  1T1T A;  1MR4 A;  3E7U X;  2GL1 A;  1AHO A;  1N4N A;  1SN1 A;  2SN3 A;  1BRZ A;  2E3G A;  2N2R A;  2N66 A;  1PX9 A;  2LY5 A;  2NY9 X;  1WT7 A;  1T7E A;  4HE7 A;  2KBK A;  1SNB A;  1ZU3 A;  1LQI A;  1VNB A;  2LKB A;  1TI5 A;  2LT8 A;  4AAZ A;  1L4V A;  2ATB A;  1C56 A;  1PTX A; 
#chains in the Genus database with same CATH topology
 2KJA A;  2KSK A;  1ZFU A;  3KOZ A;  5AQR A;  1DKG D;  3R2V A;  2YIL A;  1AYJ A;  5AQQ A;  1P0A A;  3LDO A;  2YBR C;  1BK8 A;  3LDP A;  1T7B A;  1NRA A;  2KBJ A;  2NY8 X;  3FZK A;  1BCG A;  3QML A;  4UAE F;  3LDL A;  1BMR A;  2N69 A;  4HHF A;  5BN8 A;  1SEG A;  3L56 A;  1T7A A;  4UAF E;  2QXL A;  1ZYV A;  1QQO A;  3L4I A;  3GDQ A;  4KBO A;  1B7D A;  3FZL A;  5BPM A;  3D2E B;  3A8Y A;  3D2F A;  2QWP A;  1JZA A;  1POI A;  1S3X A;  1BA1 A;  2KYQ A;  2K35 A;  2VY6 A;  2KPY A;  1KAZ A;  2YC1 C;  5AQJ A;  3L6Q A;  2KGQ A;  1NGB A;  2D56 A;  2G2K A;  4KYP A;  1NGD A;  3AY9 A;  3KP1 A;  1NGI A;  1HX1 A;  1JKZ A;  3LDQ A;  4H5W A;  1ZUT A;  4UJ0 A;  5AQF A;  1T0Z A;  2I61 A;  1I2U A;  1GPT A;  1PE4 A;  4AB0 A;  1BA0 A;  1KAX A;  1DQ7 A;  1NGJ A;  1OZZ A;  2LJ7 A;  3QI7 A;  3QFU A;  5AQP A;  2QWN A;  2B3C A;  5AQK A;  5CY0 A;  1ZYW A;  1SN4 A;  3ATU A;  5AQI A;  2MN5 A;  4HWI A;  2ASC A;  1FH3 A;  2MZ0 A;  1NGE A;  1YUW A;  1ATS A;  2E0H A;  3CQX A;  4IO8 A;  5AQL A;  1ZVE A;  5F2R A;  1I6G A;  5AQO A;  1NH5 A;  1NE5 A;  1JZB A;  1QQM A;  5FPM A;  5F0X A;  3C7N A;  2V7Z A;  3HSC A;  2A7T A;  2YIO A;  3E7R L;  3ATV A;  1I2V A;  1DJT A;  1QQN A;  3JXU A;  3GKU A;  4V1D C;  4UAD E;  1I6F A;  2E8A A;  3KHW A;  3FZM A;  4CQK A;  4H5V A;  2GMO A;  5AQH A;  1MYN A;  2LJM A;  5FPD A;  2E3F A;  3GL1 A;  3KOW A;  3PSM A;  5FPE A;  4H5N A;  5AR0 A;  2M8B B;  3IUC A;  3KOX A;  2E2F A;  1GPS A;  1CHZ A;  1NGH A;  2QWL A;  5KK4 A;  1C55 A;  1LQQ A;  1VNA A;  1NRB A;  1HJO A;  1NGF A;  3FZF A;  2QW9 A;  1HPM A;  5AQS A;  1WMT A;  3QFP A;  3D2E A;  2QWQ A;  2B68 A;  5F1X A;  4FSV A;  5AQN A;  5AQU A;  1JXC A;  1ICA A;  5AQM A;  5FPN A;  1NPI A;  4AEI A;  2LR3 A;  5BPL A;  1LQH A;  1OMY A;  5EXW A;  3BK3 C;  5BN9 A;  1B3C A;  2LY6 A;  1BUP A;  3FE1 A;  3D2F B;  5AQV A;  1KV0 A;  2N2Q A;  1WWN A;  2JDQ D;  1NGA A;  2YEO A;  2LI7 A;  3FZH A;  3KOY A;  5EX5 A;  1CN2 A;  3CW4 A;  2KBH A;  4GNI A;  5AQW A;  1NGC A;  3KVG A;  3LDN A;  5AQY A;  1K8B A;  2KHO A;  5AQT A;  1KAY A;  2BUP A;  1P00 A;  2E88 A;  1NGG A;  1ZVG A;  2BRZ A;  1T1T A;  1MR4 A;  2QWO A;  2GL1 A;  1AHO A;  3E7U X;  4H5R A;  1N4N A;  1SN1 A;  2SN3 A;  1BRZ A;  2E3G A;  3KP0 A;  2QWM A;  5EVZ A;  2N2R A;  2N66 A;  2YIP A;  1PX9 A;  5EY4 A;  3SF4 D;  1UGL A;  2LY5 A;  2NY9 X;  1WT7 A;  1T7E A;  4HE7 A;  5AQX A;  2KBK A;  1SNB A;  1ZU3 A;  3M3Z A;  5AQZ A;  1LQI A;  3I33 A;  1VNB A;  2LKB A;  1XRS B;  1TI5 A;  4FL9 A;  5BPN A;  2LT8 A;  3C7N B;  4AAZ A;  1L4V A;  2ATB A;  2LN8 A;  1C56 A;  5AQG A;  2QWR A;  1PTX A;  4H5T A;  3KC6 A;  1ATR A;  2MBK A; 
#chains in the Genus database with same CATH homology
 2KJA A;  2KSK A;  1ZFU A;  1AYJ A;  1P0A A;  2YBR C;  1BK8 A;  1T7B A;  1NRA A;  2KBJ A;  2NY8 X;  1BCG A;  1BMR A;  2N69 A;  4HHF A;  1SEG A;  1T7A A;  1ZYV A;  1B7D A;  1JZA A;  2KYQ A;  2KPY A;  2YC1 C;  2KGQ A;  4KYP A;  1JKZ A;  1ZUT A;  4UJ0 A;  1T0Z A;  2I61 A;  1I2U A;  1GPT A;  1PE4 A;  4AB0 A;  1OZZ A;  1DQ7 A;  2LJ7 A;  2B3C A;  5CY0 A;  1ZYW A;  1SN4 A;  2ASC A;  1FH3 A;  2MZ0 A;  2E0H A;  1ZVE A;  1I6G A;  1NH5 A;  1NE5 A;  1JZB A;  2A7T A;  3E7R L;  1I2V A;  1DJT A;  4V1D C;  1I6F A;  4CQK A;  1MYN A;  2LJM A;  2E3F A;  3PSM A;  2M8B B;  1GPS A;  1CHZ A;  5KK4 A;  1C55 A;  1LQQ A;  1VNA A;  1NRB A;  1WMT A;  2B68 A;  1JXC A;  1ICA A;  1NPI A;  4AEI A;  2LR3 A;  1LQH A;  1OMY A;  1B3C A;  2LY6 A;  1KV0 A;  2N2Q A;  1WWN A;  2YEO A;  2LI7 A;  1CN2 A;  2KBH A;  1P00 A;  2BRZ A;  1ZVG A;  1T1T A;  1MR4 A;  3E7U X;  2GL1 A;  1AHO A;  1N4N A;  1SN1 A;  2SN3 A;  1BRZ A;  2E3G A;  2N2R A;  2N66 A;  1PX9 A;  2LY5 A;  2NY9 X;  1WT7 A;  1T7E A;  4HE7 A;  2KBK A;  1SNB A;  1ZU3 A;  1LQI A;  1VNB A;  2LKB A;  1TI5 A;  2LT8 A;  4AAZ A;  1L4V A;  2ATB A;  1C56 A;  1PTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...