1WMTA

Scorpion toxin (istx) from opisthacanthus madagascariensis
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
41
structure length
41
Chain Sequence
VHTNIPCRGTSDCYEPCEKKYNCARAKCMNRHCNCYNNCPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IsTX
publication title Solution structure of IsTX: A male scorpion toxin from Opisthacanthus madagascariensis (Ischnuridae)
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1wmtA00
1NRBA 4KYPA 1ZVGA 2KGQA 1WT7A 1BRZA 4AB0A 2N2QA 1B3CA 2KBJA 4UJ0A 2SN3A 1GPSA 1BK8A 1I2VA 2ASCA 1NH5A 1T7EA 2LY5A 2M8BB 1WMTA 1JZAA 1BMRA 1FH3A 1ZVEA 2LT8A 1T1TA 4V1DC 1T7BA 1VNAA 3E7UX 2KBKA 1CN2A 2ATBA 1PX9A 2E0HA 1ZYWA 2GL1A 1LQQA 2NY9X 1KV0A 2N69A 1P00A 1AYJA 2YEOA 5CY0A 1I2UA 2KPYA 4HE7A 2E3GA 1GPTA 3E7RL 2N2RA 4HHFA 1OZZA 2LR3A 4AEIA 1OMYA 2LJ7A 2I61A 1ZFUA 2NY8X 1SN1A 1PE4A 1TI5A 1ZU3A 1T7AA 2B68A 1VNBA 2B3CA 2N66A 1PTXA 1AHOA 1BCGA 1SEGA 3PSMA 1LQIA 1P0AA 1NRAA 1SNBA 1WWNA 1ICAA 1MYNA 1N4NA 2E3FA 2LI7A 5KK4A 1B7DA 2KJAA 4AAZA 2KSKA 1JKZA 4CQKA 1DQ7A 2A7TA 1C56A 2KBHA 1ZUTA 1NE5A 1ZYVA 2KYQA 1I6GA 2LY6A 1LQHA 2LKBA 1T0ZA 1JZBA 1L4VA 1CHZA 1I6FA 2YC1C 2YBRC 1C55A 1DJTA 1JXCA 2LJMA 1SN4A 1MR4A 2MZ0A 1NPIA 2BRZA
chains in the Genus database with same CATH superfamily
4HWIA 1NRBA 3LDPA 5AQMA 5AQLA 4KYPA 2JDQD 3D2FB 1ZVGA 1BA0A 2GMOA 1WT7A 2KGQA 5AQTA 3KP1A 3C7NB 1BRZA 1NGAA 4AB0A 2N2QA 1B3CA 2KBJA 5AQNA 2E2FA 5AQFA 4UJ0A 2SN3A 1GPSA 3A8YA 1BK8A 1I2VA 1POIA 4H5WA 5EX5A 2ASCA 1NH5A 1BA1A 2QWPA 2V7ZA 1T7EA 1DKGD 1K8BA 2LY5A 2M8BB 1WMTA 1KAZA 1QQOA 1JZAA 5EY4A 5EXWA 1BMRA 1FH3A 1ZVEA 5F2RA 2LT8A 1T1TA 3HSCA 1XRSB 3LDNA 3CQXA 5FPEA 4V1DC 1T7BA 1VNAA 3E7UX 2KBKA 1CN2A 1NGGA 1YUWA 3M3ZA 2ATBA 5AQKA 1PX9A 3KHWA 2QWNA 5BN9A 2E0HA 3KOXA 3GL1A 3JXUA 1ZYWA 2VY6A 3SF4D 2GL1A 1HX1A 1LQQA 2NY9X 1KV0A 2E8AA 5AQIA 2N69A 1P00A 2MN5A 1AYJA 3FZKA 2YEOA 5CY0A 1I2UA 3FZHA 3KOWA 2KPYA 4HE7A 4KBOA 2E3GA 5AQOA 1UGLA 5AQHA 1GPTA 3E7RL 2N2RA 4HHFA 1OZZA 2LR3A 4AEIA 2D56A 1QQNA 5BPMA 3FE1A 1OMYA 5FPDA 1KAYA 2LJ7A 2I61A 2MBKA 1ZFUA 2NY8X 1SN1A 1PE4A 1TI5A 1ZU3A 3D2EB 1T7AA 2B68A 1VNBA 5BPNA 2B3CA 1NGEA 1ATSA 5AR0A 1NGFA 3GKUA 5AQRA 1KAXA 2QW9A 5F0XA 3QI7A 1NGDA 2N66A 1PTXA 1AHOA 3KVGA 3L6QA 1BCGA 2QWQA 1SEGA 2QWOA 3PSMA 1LQIA 1P0AA 1NRAA 5AQZA 5BN8A 1SNBA 1BUPA 3KOZA 1HPMA 4H5RA 3FZFA 1WWNA 5EVZA 1ICAA 5AQUA 1MYNA 1N4NA 2E3FA 2LI7A 4IO8A 5AQQA 4H5TA 4UADE 1NGJA 5KK4A 1B7DA 3CW4A 2KJAA 2LN8A 5AQJA 2YILA 3KC6A 3L56A 1ATRA 4AAZA 2KSKA 3IUCA 1JKZA 4CQKA 1NGCA 1DQ7A 2A7TA 2QWRA 2QXLA 3QMLA 2QWLA 5BPLA 1QQMA 3KOYA 3LDOA 3FZLA 3FZMA 5AQXA 1C56A 5FPMA 1HJOA 3KP0A 2YIOA 4FSVA 4UAFE 5AQPA 4GNIA 2KBHA 4UAEF 1ZUTA 1NE5A 2E88A 5AQVA 1ZYVA 3D2FA 2KYQA 3L4IA 5AQYA 3LDLA 3LDQA 4H5VA 3C7NA 1I6GA 2LY6A 1LQHA 2LKBA 1T0ZA 5AQWA 1JZBA 1L4VA 3GDQA 5AQGA 3I33A 1CHZA 1I6FA 2YC1C 3QFPA 1NGHA 3ATUA 2G2KA 2BUPA 2KHOA 3R2VA 1NGIA 2YIPA 3AY9A 3BK3C 1S3XA 2YBRC 5AQSA 1NGBA 1C55A 1DJTA 1JXCA 2LJMA 2QWMA 1SN4A 3D2EA 3QFUA 4FL9A 4H5NA 5FPNA 5F1XA 1MR4A 2K35A 1NPIA 2MZ0A 3ATVA 2BRZA
chains in the Genus database with same CATH topology
1NRBA 4KYPA 1ZVGA 2KGQA 1WT7A 1BRZA 4AB0A 2N2QA 1B3CA 2KBJA 4UJ0A 2SN3A 1GPSA 1BK8A 1I2VA 2ASCA 1NH5A 1T7EA 2LY5A 2M8BB 1WMTA 1JZAA 1BMRA 1FH3A 1ZVEA 2LT8A 1T1TA 4V1DC 1T7BA 1VNAA 3E7UX 2KBKA 1CN2A 2ATBA 1PX9A 2E0HA 1ZYWA 2GL1A 1LQQA 2NY9X 1KV0A 2N69A 1P00A 1AYJA 2YEOA 5CY0A 1I2UA 2KPYA 4HE7A 2E3GA 1GPTA 3E7RL 2N2RA 4HHFA 1OZZA 2LR3A 4AEIA 1OMYA 2LJ7A 2I61A 1ZFUA 2NY8X 1SN1A 1PE4A 1TI5A 1ZU3A 1T7AA 2B68A 1VNBA 2B3CA 2N66A 1PTXA 1AHOA 1BCGA 1SEGA 3PSMA 1LQIA 1P0AA 1NRAA 1SNBA 1WWNA 1ICAA 1MYNA 1N4NA 2E3FA 2LI7A 5KK4A 1B7DA 2KJAA 4AAZA 2KSKA 1JKZA 4CQKA 1DQ7A 2A7TA 1C56A 2KBHA 1ZUTA 1NE5A 1ZYVA 2KYQA 1I6GA 2LY6A 1LQHA 2LKBA 1T0ZA 1JZBA 1L4VA 1CHZA 1I6FA 2YC1C 2YBRC 1C55A 1DJTA 1JXCA 2LJMA 1SN4A 1MR4A 2MZ0A 1NPIA 2BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRB A;  4KYP A;  1ZVG A;  2KGQ A;  1WT7 A;  1BRZ A;  4AB0 A;  2N2Q A;  1B3C A;  2KBJ A;  4UJ0 A;  2SN3 A;  1GPS A;  1BK8 A;  1I2V A;  2ASC A;  1NH5 A;  1T7E A;  2LY5 A;  2M8B B;  1WMT A;  1JZA A;  1BMR A;  1FH3 A;  1ZVE A;  2LT8 A;  1T1T A;  4V1D C;  1T7B A;  1VNA A;  3E7U X;  2KBK A;  1CN2 A;  2ATB A;  1PX9 A;  2E0H A;  1ZYW A;  2GL1 A;  1LQQ A;  2NY9 X;  1KV0 A;  2N69 A;  1P00 A;  1AYJ A;  2YEO A;  5CY0 A;  1I2U A;  2KPY A;  4HE7 A;  2E3G A;  1GPT A;  3E7R L;  2N2R A;  4HHF A;  1OZZ A;  2LR3 A;  4AEI A;  1OMY A;  2LJ7 A;  2I61 A;  1ZFU A;  2NY8 X;  1SN1 A;  1PE4 A;  1TI5 A;  1ZU3 A;  1T7A A;  2B68 A;  1VNB A;  2B3C A;  2N66 A;  1PTX A;  1AHO A;  1BCG A;  1SEG A;  3PSM A;  1LQI A;  1P0A A;  1NRA A;  1SNB A;  1WWN A;  1ICA A;  1MYN A;  1N4N A;  2E3F A;  2LI7 A;  5KK4 A;  1B7D A;  2KJA A;  4AAZ A;  2KSK A;  1JKZ A;  4CQK A;  1DQ7 A;  2A7T A;  1C56 A;  2KBH A;  1ZUT A;  1NE5 A;  1ZYV A;  2KYQ A;  1I6G A;  2LY6 A;  1LQH A;  2LKB A;  1T0Z A;  1JZB A;  1L4V A;  1CHZ A;  1I6F A;  2YC1 C;  2YBR C;  1C55 A;  1DJT A;  1JXC A;  2LJM A;  1SN4 A;  1MR4 A;  2MZ0 A;  1NPI A;  2BRZ A; 
#chains in the Genus database with same CATH topology
 4HWI A;  1NRB A;  3LDP A;  5AQM A;  5AQL A;  4KYP A;  2JDQ D;  3D2F B;  1ZVG A;  1BA0 A;  2GMO A;  1WT7 A;  2KGQ A;  5AQT A;  3KP1 A;  3C7N B;  1BRZ A;  1NGA A;  4AB0 A;  2N2Q A;  1B3C A;  2KBJ A;  5AQN A;  2E2F A;  5AQF A;  4UJ0 A;  2SN3 A;  1GPS A;  3A8Y A;  1BK8 A;  1I2V A;  1POI A;  4H5W A;  5EX5 A;  2ASC A;  1NH5 A;  1BA1 A;  2QWP A;  2V7Z A;  1T7E A;  1DKG D;  1K8B A;  2LY5 A;  2M8B B;  1WMT A;  1KAZ A;  1QQO A;  1JZA A;  5EY4 A;  5EXW A;  1BMR A;  1FH3 A;  1ZVE A;  5F2R A;  2LT8 A;  1T1T A;  3HSC A;  1XRS B;  3LDN A;  3CQX A;  5FPE A;  4V1D C;  1T7B A;  1VNA A;  3E7U X;  2KBK A;  1CN2 A;  1NGG A;  1YUW A;  3M3Z A;  2ATB A;  5AQK A;  1PX9 A;  3KHW A;  2QWN A;  5BN9 A;  2E0H A;  3KOX A;  3GL1 A;  3JXU A;  1ZYW A;  2VY6 A;  3SF4 D;  2GL1 A;  1HX1 A;  1LQQ A;  2NY9 X;  1KV0 A;  2E8A A;  5AQI A;  2N69 A;  1P00 A;  2MN5 A;  1AYJ A;  3FZK A;  2YEO A;  5CY0 A;  1I2U A;  3FZH A;  3KOW A;  2KPY A;  4HE7 A;  4KBO A;  2E3G A;  5AQO A;  1UGL A;  5AQH A;  1GPT A;  3E7R L;  2N2R A;  4HHF A;  1OZZ A;  2LR3 A;  4AEI A;  2D56 A;  1QQN A;  5BPM A;  3FE1 A;  1OMY A;  5FPD A;  1KAY A;  2LJ7 A;  2I61 A;  2MBK A;  1ZFU A;  2NY8 X;  1SN1 A;  1PE4 A;  1TI5 A;  1ZU3 A;  3D2E B;  1T7A A;  2B68 A;  1VNB A;  5BPN A;  2B3C A;  1NGE A;  1ATS A;  5AR0 A;  1NGF A;  3GKU A;  5AQR A;  1KAX A;  2QW9 A;  5F0X A;  3QI7 A;  1NGD A;  2N66 A;  1PTX A;  1AHO A;  3KVG A;  3L6Q A;  1BCG A;  2QWQ A;  1SEG A;  2QWO A;  3PSM A;  1LQI A;  1P0A A;  1NRA A;  5AQZ A;  5BN8 A;  1SNB A;  1BUP A;  3KOZ A;  1HPM A;  4H5R A;  3FZF A;  1WWN A;  5EVZ A;  1ICA A;  5AQU A;  1MYN A;  1N4N A;  2E3F A;  2LI7 A;  4IO8 A;  5AQQ A;  4H5T A;  4UAD E;  1NGJ A;  5KK4 A;  1B7D A;  3CW4 A;  2KJA A;  2LN8 A;  5AQJ A;  2YIL A;  3KC6 A;  3L56 A;  1ATR A;  4AAZ A;  2KSK A;  3IUC A;  1JKZ A;  4CQK A;  1NGC A;  1DQ7 A;  2A7T A;  2QWR A;  2QXL A;  3QML A;  2QWL A;  5BPL A;  1QQM A;  3KOY A;  3LDO A;  3FZL A;  3FZM A;  5AQX A;  1C56 A;  5FPM A;  1HJO A;  3KP0 A;  2YIO A;  4FSV A;  4UAF E;  5AQP A;  4GNI A;  2KBH A;  4UAE F;  1ZUT A;  1NE5 A;  2E88 A;  5AQV A;  1ZYV A;  3D2F A;  2KYQ A;  3L4I A;  5AQY A;  3LDL A;  3LDQ A;  4H5V A;  3C7N A;  1I6G A;  2LY6 A;  1LQH A;  2LKB A;  1T0Z A;  5AQW A;  1JZB A;  1L4V A;  3GDQ A;  5AQG A;  3I33 A;  1CHZ A;  1I6F A;  2YC1 C;  3QFP A;  1NGH A;  3ATU A;  2G2K A;  2BUP A;  2KHO A;  3R2V A;  1NGI A;  2YIP A;  3AY9 A;  3BK3 C;  1S3X A;  2YBR C;  5AQS A;  1NGB A;  1C55 A;  1DJT A;  1JXC A;  2LJM A;  2QWM A;  1SN4 A;  3D2E A;  3QFU A;  4FL9 A;  4H5N A;  5FPN A;  5F1X A;  1MR4 A;  2K35 A;  1NPI A;  2MZ0 A;  3ATV A;  2BRZ A; 
#chains in the Genus database with same CATH homology
 1NRB A;  4KYP A;  1ZVG A;  2KGQ A;  1WT7 A;  1BRZ A;  4AB0 A;  2N2Q A;  1B3C A;  2KBJ A;  4UJ0 A;  2SN3 A;  1GPS A;  1BK8 A;  1I2V A;  2ASC A;  1NH5 A;  1T7E A;  2LY5 A;  2M8B B;  1WMT A;  1JZA A;  1BMR A;  1FH3 A;  1ZVE A;  2LT8 A;  1T1T A;  4V1D C;  1T7B A;  1VNA A;  3E7U X;  2KBK A;  1CN2 A;  2ATB A;  1PX9 A;  2E0H A;  1ZYW A;  2GL1 A;  1LQQ A;  2NY9 X;  1KV0 A;  2N69 A;  1P00 A;  1AYJ A;  2YEO A;  5CY0 A;  1I2U A;  2KPY A;  4HE7 A;  2E3G A;  1GPT A;  3E7R L;  2N2R A;  4HHF A;  1OZZ A;  2LR3 A;  4AEI A;  1OMY A;  2LJ7 A;  2I61 A;  1ZFU A;  2NY8 X;  1SN1 A;  1PE4 A;  1TI5 A;  1ZU3 A;  1T7A A;  2B68 A;  1VNB A;  2B3C A;  2N66 A;  1PTX A;  1AHO A;  1BCG A;  1SEG A;  3PSM A;  1LQI A;  1P0A A;  1NRA A;  1SNB A;  1WWN A;  1ICA A;  1MYN A;  1N4N A;  2E3F A;  2LI7 A;  5KK4 A;  1B7D A;  2KJA A;  4AAZ A;  2KSK A;  1JKZ A;  4CQK A;  1DQ7 A;  2A7T A;  1C56 A;  2KBH A;  1ZUT A;  1NE5 A;  1ZYV A;  2KYQ A;  1I6G A;  2LY6 A;  1LQH A;  2LKB A;  1T0Z A;  1JZB A;  1L4V A;  1CHZ A;  1I6F A;  2YC1 C;  2YBR C;  1C55 A;  1DJT A;  1JXC A;  2LJM A;  1SN4 A;  1MR4 A;  2MZ0 A;  1NPI A;  2BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...