1I2UA

Nmr solution structures of antifungal heliomicin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
b'DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
molecule tags Antifungal protein
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2uA00
2KGQA 2B3CA 2MZ0A 3PSMA 1T7EA 1N4NA 1C55A 1T1TA 2YBRC 1SN1A 4AAZA 1NPIA 1NRBA 1DQ7A 2KYQA 1ICAA 2LY6A 2LT8A 1ZFUA 2NY9X 1PX9A 2E3FA 1AHOA 1VNAA 1T7AA 1OZZA 1BK8A 1I6GA 1NH5A 2B68A 2LKBA 1I6FA 1WMTA 3E7RL 1ZVEA 2KSKA 2E3GA 5CY0A 2SN3A 4HE7A 1T7BA 2KBKA 2N2RA 1P0AA 1AYJA 1JZBA 2N66A 1VNBA 1TI5A 1MR4A 4KYPA 1B7DA 4CQKA 2A7TA 2E0HA 2KPYA 1JKZA 1SNBA 5KK4A 1L4VA 1DJTA 1JXCA 1MYNA 1B3CA 2ATBA 2KJAA 2LJ7A 1BCGA 1C56A 1SEGA 1WT7A 1ZYVA 2YC1C 1GPTA 1P00A 2LI7A 2ASCA 1BMRA 1GPSA 2LJMA 2N69A 2I61A 1CHZA 4UJ0A 1PTXA 2NY8X 1T0ZA 4V1DC 4AB0A 2YEOA 2N2QA 1NE5A 1ZUTA 1LQHA 2LY5A 1LQQA 3E7UX 2M8BB 1WWNA 1OMYA 1PE4A 1ZVGA 1BRZA 1I2VA 2KBJA 1KV0A 4AEIA 1SN4A 1FH3A 1JZAA 1NRAA 4HHFA 1I2UA 2KBHA 2LR3A 2BRZA 1CN2A 2GL1A 1ZU3A 1LQIA 1ZYWA
chains in the Genus database with same CATH superfamily
5AQWA 2KGQA 5BPMA 2B3CA 4UAFE 1BA0A 2MZ0A 3PSMA 3KVGA 3KOYA 2YIPA 1POIA 5AQXA 1T7EA 1N4NA 3GKUA 5AQFA 3LDQA 3KOZA 4H5RA 3SF4D 1C55A 5FPDA 1QQMA 1T1TA 1SN1A 2YBRC 3L56A 4AAZA 1NPIA 2QXLA 5AQZA 1NRBA 1DQ7A 1NGHA 2KYQA 5AQTA 2BUPA 3FZFA 1ICAA 2LY6A 2LT8A 1ZFUA 2NY9X 3AY9A 3I33A 3FE1A 2QWNA 2GMOA 1HJOA 1PX9A 2YILA 2E3FA 1AHOA 5FPNA 1VNAA 1T7AA 3KOXA 5FPEA 2QWMA 3KOWA 1OZZA 1BK8A 1I6GA 1NGIA 1NH5A 2B68A 2LKBA 5F2RA 1I6FA 1WMTA 1NGFA 2QWOA 3E7RL 5FPMA 3D2EA 3FZLA 1ZVEA 2KSKA 2E3GA 1QQOA 5CY0A 1KAYA 3KC6A 2SN3A 1HPMA 5BPLA 4HE7A 1NGEA 4IO8A 1T7BA 3JXUA 5AQUA 2MN5A 2D56A 2KBKA 5AQPA 2N2RA 2QWLA 3FZMA 1P0AA 4H5NA 5AQMA 1AYJA 1QQNA 1NGBA 1ATRA 1HX1A 1JZBA 2JDQD 3LDOA 5EY4A 5BPNA 2KHOA 1BUPA 2N66A 1DKGD 1VNBA 2VY6A 3QMLA 1TI5A 1MR4A 4KYPA 5AQSA 1B7DA 2E8AA 3C7NA 4CQKA 3QI7A 4HWIA 5AQRA 2A7TA 3LDNA 1XRSB 3IUCA 1NGJA 2E0HA 2KPYA 5AQVA 1JKZA 1NGAA 1SNBA 3D2FA 5KK4A 1L4VA 2K35A 1DJTA 2QWQA 3D2EB 3M3ZA 1JXCA 1MYNA 4KBOA 5AQNA 3FZHA 2YIOA 1B3CA 1K8BA 5EXWA 1S3XA 2ATBA 2KJAA 2G2KA 3KP0A 3R2VA 2LJ7A 5AQGA 1BCGA 3KHWA 1C56A 1SEGA 1WT7A 5EVZA 4H5WA 1KAZA 1ZYVA 5BN9A 2YC1C 1GPTA 1P00A 2QWPA 3A8YA 2LI7A 3L4IA 5AQJA 2ASCA 3C7NB 3QFPA 1BMRA 1UGLA 1GPSA 5F0XA 1NGDA 2MBKA 2LJMA 2N69A 2I61A 3FZKA 4UADE 1CHZA 3BK3C 1PTXA 4UJ0A 1YUWA 2NY8X 1T0ZA 3CW4A 3QFUA 4FL9A 3CQXA 4V1DC 5AQLA 1NGCA 5AQHA 4AB0A 2YEOA 2N2QA 3ATVA 4H5VA 3GDQA 5BN8A 2E2FA 2E88A 5EX5A 1BA1A 1NE5A 4UAEF 1ZUTA 1LQHA 2LY5A 5AQQA 4GNIA 1LQQA 3E7UX 5AQOA 2M8BB 1WWNA 1OMYA 3L6QA 2QWRA 1PE4A 1ZVGA 4H5TA 2LN8A 1BRZA 5AQYA 3HSCA 1I2VA 2KBJA 1KV0A 3LDPA 4AEIA 2V7ZA 1SN4A 5AQIA 3GL1A 5F1XA 1ATSA 1FH3A 1JZAA 1NRAA 2QW9A 5AQKA 5AR0A 4HHFA 4FSVA 1I2UA 2KBHA 3LDLA 2LR3A 2BRZA 3ATUA 1CN2A 2GL1A 1ZU3A 1LQIA 3KP1A 1KAXA 3D2FB 1NGGA 1ZYWA
chains in the Genus database with same CATH topology
2KGQA 2B3CA 2MZ0A 3PSMA 1T7EA 1N4NA 1C55A 1T1TA 2YBRC 1SN1A 4AAZA 1NPIA 1NRBA 1DQ7A 2KYQA 1ICAA 2LY6A 2LT8A 1ZFUA 2NY9X 1PX9A 2E3FA 1AHOA 1VNAA 1T7AA 1OZZA 1BK8A 1I6GA 1NH5A 2B68A 2LKBA 1I6FA 1WMTA 3E7RL 1ZVEA 2KSKA 2E3GA 5CY0A 2SN3A 4HE7A 1T7BA 2KBKA 2N2RA 1P0AA 1AYJA 1JZBA 2N66A 1VNBA 1TI5A 1MR4A 4KYPA 1B7DA 4CQKA 2A7TA 2E0HA 2KPYA 1JKZA 1SNBA 5KK4A 1L4VA 1DJTA 1JXCA 1MYNA 1B3CA 2ATBA 2KJAA 2LJ7A 1BCGA 1C56A 1SEGA 1WT7A 1ZYVA 2YC1C 1GPTA 1P00A 2LI7A 2ASCA 1BMRA 1GPSA 2LJMA 2N69A 2I61A 1CHZA 4UJ0A 1PTXA 2NY8X 1T0ZA 4V1DC 4AB0A 2YEOA 2N2QA 1NE5A 1ZUTA 1LQHA 2LY5A 1LQQA 3E7UX 2M8BB 1WWNA 1OMYA 1PE4A 1ZVGA 1BRZA 1I2VA 2KBJA 1KV0A 4AEIA 1SN4A 1FH3A 1JZAA 1NRAA 4HHFA 1I2UA 2KBHA 2LR3A 2BRZA 1CN2A 2GL1A 1ZU3A 1LQIA 1ZYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGQ A;  2B3C A;  2MZ0 A;  3PSM A;  1T7E A;  1N4N A;  1C55 A;  1T1T A;  2YBR C;  1SN1 A;  4AAZ A;  1NPI A;  1NRB A;  1DQ7 A;  2KYQ A;  1ICA A;  2LY6 A;  2LT8 A;  1ZFU A;  2NY9 X;  1PX9 A;  2E3F A;  1AHO A;  1VNA A;  1T7A A;  1OZZ A;  1BK8 A;  1I6G A;  1NH5 A;  2B68 A;  2LKB A;  1I6F A;  1WMT A;  3E7R L;  1ZVE A;  2KSK A;  2E3G A;  5CY0 A;  2SN3 A;  4HE7 A;  1T7B A;  2KBK A;  2N2R A;  1P0A A;  1AYJ A;  1JZB A;  2N66 A;  1VNB A;  1TI5 A;  1MR4 A;  4KYP A;  1B7D A;  4CQK A;  2A7T A;  2E0H A;  2KPY A;  1JKZ A;  1SNB A;  5KK4 A;  1L4V A;  1DJT A;  1JXC A;  1MYN A;  1B3C A;  2ATB A;  2KJA A;  2LJ7 A;  1BCG A;  1C56 A;  1SEG A;  1WT7 A;  1ZYV A;  2YC1 C;  1GPT A;  1P00 A;  2LI7 A;  2ASC A;  1BMR A;  1GPS A;  2LJM A;  2N69 A;  2I61 A;  1CHZ A;  4UJ0 A;  1PTX A;  2NY8 X;  1T0Z A;  4V1D C;  4AB0 A;  2YEO A;  2N2Q A;  1NE5 A;  1ZUT A;  1LQH A;  2LY5 A;  1LQQ A;  3E7U X;  2M8B B;  1WWN A;  1OMY A;  1PE4 A;  1ZVG A;  1BRZ A;  1I2V A;  2KBJ A;  1KV0 A;  4AEI A;  1SN4 A;  1FH3 A;  1JZA A;  1NRA A;  4HHF A;  1I2U A;  2KBH A;  2LR3 A;  2BRZ A;  1CN2 A;  2GL1 A;  1ZU3 A;  1LQI A;  1ZYW A; 
#chains in the Genus database with same CATH topology
 5AQW A;  2KGQ A;  5BPM A;  2B3C A;  4UAF E;  1BA0 A;  2MZ0 A;  3PSM A;  3KVG A;  3KOY A;  2YIP A;  1POI A;  5AQX A;  1T7E A;  1N4N A;  3GKU A;  5AQF A;  3LDQ A;  3KOZ A;  4H5R A;  3SF4 D;  1C55 A;  5FPD A;  1QQM A;  1T1T A;  1SN1 A;  2YBR C;  3L56 A;  4AAZ A;  1NPI A;  2QXL A;  5AQZ A;  1NRB A;  1DQ7 A;  1NGH A;  2KYQ A;  5AQT A;  2BUP A;  3FZF A;  1ICA A;  2LY6 A;  2LT8 A;  1ZFU A;  2NY9 X;  3AY9 A;  3I33 A;  3FE1 A;  2QWN A;  2GMO A;  1HJO A;  1PX9 A;  2YIL A;  2E3F A;  1AHO A;  5FPN A;  1VNA A;  1T7A A;  3KOX A;  5FPE A;  2QWM A;  3KOW A;  1OZZ A;  1BK8 A;  1I6G A;  1NGI A;  1NH5 A;  2B68 A;  2LKB A;  5F2R A;  1I6F A;  1WMT A;  1NGF A;  2QWO A;  3E7R L;  5FPM A;  3D2E A;  3FZL A;  1ZVE A;  2KSK A;  2E3G A;  1QQO A;  5CY0 A;  1KAY A;  3KC6 A;  2SN3 A;  1HPM A;  5BPL A;  4HE7 A;  1NGE A;  4IO8 A;  1T7B A;  3JXU A;  5AQU A;  2MN5 A;  2D56 A;  2KBK A;  5AQP A;  2N2R A;  2QWL A;  3FZM A;  1P0A A;  4H5N A;  5AQM A;  1AYJ A;  1QQN A;  1NGB A;  1ATR A;  1HX1 A;  1JZB A;  2JDQ D;  3LDO A;  5EY4 A;  5BPN A;  2KHO A;  1BUP A;  2N66 A;  1DKG D;  1VNB A;  2VY6 A;  3QML A;  1TI5 A;  1MR4 A;  4KYP A;  5AQS A;  1B7D A;  2E8A A;  3C7N A;  4CQK A;  3QI7 A;  4HWI A;  5AQR A;  2A7T A;  3LDN A;  1XRS B;  3IUC A;  1NGJ A;  2E0H A;  2KPY A;  5AQV A;  1JKZ A;  1NGA A;  1SNB A;  3D2F A;  5KK4 A;  1L4V A;  2K35 A;  1DJT A;  2QWQ A;  3D2E B;  3M3Z A;  1JXC A;  1MYN A;  4KBO A;  5AQN A;  3FZH A;  2YIO A;  1B3C A;  1K8B A;  5EXW A;  1S3X A;  2ATB A;  2KJA A;  2G2K A;  3KP0 A;  3R2V A;  2LJ7 A;  5AQG A;  1BCG A;  3KHW A;  1C56 A;  1SEG A;  1WT7 A;  5EVZ A;  4H5W A;  1KAZ A;  1ZYV A;  5BN9 A;  2YC1 C;  1GPT A;  1P00 A;  2QWP A;  3A8Y A;  2LI7 A;  3L4I A;  5AQJ A;  2ASC A;  3C7N B;  3QFP A;  1BMR A;  1UGL A;  1GPS A;  5F0X A;  1NGD A;  2MBK A;  2LJM A;  2N69 A;  2I61 A;  3FZK A;  4UAD E;  1CHZ A;  3BK3 C;  1PTX A;  4UJ0 A;  1YUW A;  2NY8 X;  1T0Z A;  3CW4 A;  3QFU A;  4FL9 A;  3CQX A;  4V1D C;  5AQL A;  1NGC A;  5AQH A;  4AB0 A;  2YEO A;  2N2Q A;  3ATV A;  4H5V A;  3GDQ A;  5BN8 A;  2E2F A;  2E88 A;  5EX5 A;  1BA1 A;  1NE5 A;  4UAE F;  1ZUT A;  1LQH A;  2LY5 A;  5AQQ A;  4GNI A;  1LQQ A;  3E7U X;  5AQO A;  2M8B B;  1WWN A;  1OMY A;  3L6Q A;  2QWR A;  1PE4 A;  1ZVG A;  4H5T A;  2LN8 A;  1BRZ A;  5AQY A;  3HSC A;  1I2V A;  2KBJ A;  1KV0 A;  3LDP A;  4AEI A;  2V7Z A;  1SN4 A;  5AQI A;  3GL1 A;  5F1X A;  1ATS A;  1FH3 A;  1JZA A;  1NRA A;  2QW9 A;  5AQK A;  5AR0 A;  4HHF A;  4FSV A;  1I2U A;  2KBH A;  3LDL A;  2LR3 A;  2BRZ A;  3ATU A;  1CN2 A;  2GL1 A;  1ZU3 A;  1LQI A;  3KP1 A;  1KAX A;  3D2F B;  1NGG A;  1ZYW A; 
#chains in the Genus database with same CATH homology
 2KGQ A;  2B3C A;  2MZ0 A;  3PSM A;  1T7E A;  1N4N A;  1C55 A;  1T1T A;  2YBR C;  1SN1 A;  4AAZ A;  1NPI A;  1NRB A;  1DQ7 A;  2KYQ A;  1ICA A;  2LY6 A;  2LT8 A;  1ZFU A;  2NY9 X;  1PX9 A;  2E3F A;  1AHO A;  1VNA A;  1T7A A;  1OZZ A;  1BK8 A;  1I6G A;  1NH5 A;  2B68 A;  2LKB A;  1I6F A;  1WMT A;  3E7R L;  1ZVE A;  2KSK A;  2E3G A;  5CY0 A;  2SN3 A;  4HE7 A;  1T7B A;  2KBK A;  2N2R A;  1P0A A;  1AYJ A;  1JZB A;  2N66 A;  1VNB A;  1TI5 A;  1MR4 A;  4KYP A;  1B7D A;  4CQK A;  2A7T A;  2E0H A;  2KPY A;  1JKZ A;  1SNB A;  5KK4 A;  1L4V A;  1DJT A;  1JXC A;  1MYN A;  1B3C A;  2ATB A;  2KJA A;  2LJ7 A;  1BCG A;  1C56 A;  1SEG A;  1WT7 A;  1ZYV A;  2YC1 C;  1GPT A;  1P00 A;  2LI7 A;  2ASC A;  1BMR A;  1GPS A;  2LJM A;  2N69 A;  2I61 A;  1CHZ A;  4UJ0 A;  1PTX A;  2NY8 X;  1T0Z A;  4V1D C;  4AB0 A;  2YEO A;  2N2Q A;  1NE5 A;  1ZUT A;  1LQH A;  2LY5 A;  1LQQ A;  3E7U X;  2M8B B;  1WWN A;  1OMY A;  1PE4 A;  1ZVG A;  1BRZ A;  1I2V A;  2KBJ A;  1KV0 A;  4AEI A;  1SN4 A;  1FH3 A;  1JZA A;  1NRA A;  4HHF A;  1I2U A;  2KBH A;  2LR3 A;  2BRZ A;  1CN2 A;  2GL1 A;  1ZU3 A;  1LQI A;  1ZYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...