1I2UA

Nmr solution structures of antifungal heliomicin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2uA00
1DJTA 2LI7A 1L4VA 1C56A 2N69A 1LQHA 1T0ZA 1T7BA 2GL1A 1TI5A 3E7RL 2B3CA 2M8BB 1T1TA 1SEGA 5KK4A 1AYJA 1LQIA 1ZUTA 1ZVGA 1N4NA 2YC1C 2KSKA 1JZBA 1SN1A 4V1DC 1JZAA 1PX9A 2N2RA 3E7UX 1WWNA 2LT8A 1NH5A 2N66A 1ICAA 3PSMA 1SN4A 4HE7A 2LJMA 2I61A 1MYNA 1I2VA 1MR4A 1OZZA 2YBRC 1NRBA 2E0HA 1FH3A 1P00A 4KYPA 1CHZA 1T7EA 1BK8A 1NE5A 1SNBA 1ZYVA 2E3GA 4AAZA 4UJ0A 5CY0A 2KBKA 1PTXA 2KBHA 2YEOA 2LR3A 1VNAA 2KJAA 1GPTA 2LJ7A 1VNBA 1NRAA 1BMRA 4AB0A 1GPSA 1ZVEA 1OMYA 1BCGA 2LKBA 1C55A 1WMTA 2ASCA 4HHFA 4CQKA 1KV0A 2KPYA 1NPIA 1PE4A 2KGQA 2LY6A 1JKZA 4AEIA 2KYQA 1BRZA 1JXCA 1I6GA 1B3CA 1ZU3A 2N2QA 2NY9X 1B7DA 2NY8X 2MZ0A 1DQ7A 2E3FA 2SN3A 1I2UA 1ZFUA 2KBJA 2A7TA 1WT7A 1ZYWA 2LY5A 1I6FA 1P0AA 1T7AA 2ATBA 1LQQA 1CN2A 2BRZA 1AHOA 2B68A
chains in the Genus database with same CATH superfamily
1DJTA 2LI7A 4H5TA 3L56A 1L4VA 5AQFA 1POIA 5AQPA 3C7NA 1C56A 2N69A 1LQHA 3FZKA 1BA0A 2E8AA 1T0ZA 5EY4A 1T7BA 2GL1A 1HX1A 1TI5A 3E7RL 5FPMA 2B3CA 2M8BB 1T1TA 1SEGA 1K8BA 5KK4A 5AQXA 2MN5A 1AYJA 3LDQA 1LQIA 2V7ZA 2G2KA 1ZUTA 1ZVGA 1N4NA 2YC1C 1KAZA 3CW4A 5AQWA 5AQLA 2KSKA 1JZBA 1SN1A 1NGHA 5AQHA 1QQMA 3KOZA 3QFPA 4FSVA 4V1DC 3GL1A 1JZAA 1NGJA 2QWPA 1DKGD 1PX9A 2N2RA 3E7UX 2MBKA 3KOYA 1QQOA 1WWNA 2LT8A 4FL9A 1NH5A 5AQOA 5F0XA 4GNIA 2N66A 1ICAA 3PSMA 1SN4A 4HE7A 2LJMA 2QWMA 2QXLA 3ATVA 2I61A 1MYNA 3D2FB 1I2VA 1MR4A 1OZZA 2QWOA 2YBRC 1BA1A 1NRBA 2E0HA 3I33A 1P00A 3LDLA 5AQZA 2E88A 4KYPA 5BPLA 3D2FA 3M3ZA 1FH3A 1NGAA 1CHZA 1T7EA 3CQXA 5AQYA 1BK8A 1XRSB 3HSCA 1NE5A 3BK3C 3D2EB 4H5VA 3FZMA 3QMLA 1SNBA 1ZYVA 2E3GA 3FZHA 3D2EA 4H5NA 4UADE 5AQVA 4AAZA 4UJ0A 5CY0A 2KBKA 2QWLA 5AQSA 1PTXA 2E2FA 3FZLA 5AQKA 2KBHA 2YEOA 3IUCA 1NGFA 2YIPA 3L6QA 5EX5A 2LR3A 1VNAA 3FE1A 1HPMA 2LN8A 2KJAA 5BN8A 5AQRA 2JDQD 1YUWA 4UAFE 1GPTA 3LDNA 5AR0A 5EXWA 5AQNA 2GMOA 1VNBA 2LJ7A 3KC6A 1NRAA 5BPNA 5FPEA 1BMRA 4AB0A 1GPSA 3KP0A 1ZVEA 2D56A 2QW9A 3KHWA 4H5RA 3LDOA 1OMYA 1BCGA 2LKBA 5FPDA 1QQNA 5AQIA 3L4IA 3JXUA 1C55A 2BUPA 1WMTA 2ASCA 4HWIA 5EVZA 1S3XA 5BPMA 5BN9A 1ATRA 1BUPA 4HHFA 5AQGA 2QWNA 1KV0A 4CQKA 5AQTA 2YIOA 1NGIA 2KPYA 1NPIA 3AY9A 3FZFA 3GDQA 1PE4A 2KGQA 2LY6A 3KOWA 5AQJA 4KBOA 3KP1A 1JKZA 1UGLA 1NGGA 4AEIA 3GKUA 2KYQA 5FPNA 1BRZA 1JXCA 1KAXA 1NGEA 1B3CA 4UAEF 1I6GA 1ZU3A 2YILA 2N2QA 2QWRA 2NY9X 1ATSA 2QWQA 2KHOA 3KVGA 1B7DA 2NY8X 5AQMA 1HJOA 3LDPA 3SF4D 2MZ0A 2VY6A 1DQ7A 1NGBA 2E3FA 2SN3A 3ATUA 3QI7A 4IO8A 5AQUA 1ZFUA 5F2RA 5F1XA 1I2UA 1KAYA 2KBJA 4H5WA 2A7TA 3KOXA 2K35A 3R2VA 5AQQA 1NGCA 1WT7A 1ZYWA 2LY5A 3A8YA 1I6FA 1NGDA 1P0AA 3QFUA 1T7AA 2ATBA 1LQQA 1CN2A 2BRZA 3C7NB 1AHOA 2B68A
chains in the Genus database with same CATH topology
1DJTA 2LI7A 1L4VA 1C56A 2N69A 1LQHA 1T0ZA 1T7BA 2GL1A 1TI5A 3E7RL 2B3CA 2M8BB 1T1TA 1SEGA 5KK4A 1AYJA 1LQIA 1ZUTA 1ZVGA 1N4NA 2YC1C 2KSKA 1JZBA 1SN1A 4V1DC 1JZAA 1PX9A 2N2RA 3E7UX 1WWNA 2LT8A 1NH5A 2N66A 1ICAA 3PSMA 1SN4A 4HE7A 2LJMA 2I61A 1MYNA 1I2VA 1MR4A 1OZZA 2YBRC 1NRBA 2E0HA 1FH3A 1P00A 4KYPA 1CHZA 1T7EA 1BK8A 1NE5A 1SNBA 1ZYVA 2E3GA 4AAZA 4UJ0A 5CY0A 2KBKA 1PTXA 2KBHA 2YEOA 2LR3A 1VNAA 2KJAA 1GPTA 2LJ7A 1VNBA 1NRAA 1BMRA 4AB0A 1GPSA 1ZVEA 1OMYA 1BCGA 2LKBA 1C55A 1WMTA 2ASCA 4HHFA 4CQKA 1KV0A 2KPYA 1NPIA 1PE4A 2KGQA 2LY6A 1JKZA 4AEIA 2KYQA 1BRZA 1JXCA 1I6GA 1B3CA 1ZU3A 2N2QA 2NY9X 1B7DA 2NY8X 2MZ0A 1DQ7A 2E3FA 2SN3A 1I2UA 1ZFUA 2KBJA 2A7TA 1WT7A 1ZYWA 2LY5A 1I6FA 1P0AA 1T7AA 2ATBA 1LQQA 1CN2A 2BRZA 1AHOA 2B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJT A;  2LI7 A;  1L4V A;  1C56 A;  2N69 A;  1LQH A;  1T0Z A;  1T7B A;  2GL1 A;  1TI5 A;  3E7R L;  2B3C A;  2M8B B;  1T1T A;  1SEG A;  5KK4 A;  1AYJ A;  1LQI A;  1ZUT A;  1ZVG A;  1N4N A;  2YC1 C;  2KSK A;  1JZB A;  1SN1 A;  4V1D C;  1JZA A;  1PX9 A;  2N2R A;  3E7U X;  1WWN A;  2LT8 A;  1NH5 A;  2N66 A;  1ICA A;  3PSM A;  1SN4 A;  4HE7 A;  2LJM A;  2I61 A;  1MYN A;  1I2V A;  1MR4 A;  1OZZ A;  2YBR C;  1NRB A;  2E0H A;  1FH3 A;  1P00 A;  4KYP A;  1CHZ A;  1T7E A;  1BK8 A;  1NE5 A;  1SNB A;  1ZYV A;  2E3G A;  4AAZ A;  4UJ0 A;  5CY0 A;  2KBK A;  1PTX A;  2KBH A;  2YEO A;  2LR3 A;  1VNA A;  2KJA A;  1GPT A;  2LJ7 A;  1VNB A;  1NRA A;  1BMR A;  4AB0 A;  1GPS A;  1ZVE A;  1OMY A;  1BCG A;  2LKB A;  1C55 A;  1WMT A;  2ASC A;  4HHF A;  4CQK A;  1KV0 A;  2KPY A;  1NPI A;  1PE4 A;  2KGQ A;  2LY6 A;  1JKZ A;  4AEI A;  2KYQ A;  1BRZ A;  1JXC A;  1I6G A;  1B3C A;  1ZU3 A;  2N2Q A;  2NY9 X;  1B7D A;  2NY8 X;  2MZ0 A;  1DQ7 A;  2E3F A;  2SN3 A;  1I2U A;  1ZFU A;  2KBJ A;  2A7T A;  1WT7 A;  1ZYW A;  2LY5 A;  1I6F A;  1P0A A;  1T7A A;  2ATB A;  1LQQ A;  1CN2 A;  2BRZ A;  1AHO A;  2B68 A; 
#chains in the Genus database with same CATH topology
 1DJT A;  2LI7 A;  4H5T A;  3L56 A;  1L4V A;  5AQF A;  1POI A;  5AQP A;  3C7N A;  1C56 A;  2N69 A;  1LQH A;  3FZK A;  1BA0 A;  2E8A A;  1T0Z A;  5EY4 A;  1T7B A;  2GL1 A;  1HX1 A;  1TI5 A;  3E7R L;  5FPM A;  2B3C A;  2M8B B;  1T1T A;  1SEG A;  1K8B A;  5KK4 A;  5AQX A;  2MN5 A;  1AYJ A;  3LDQ A;  1LQI A;  2V7Z A;  2G2K A;  1ZUT A;  1ZVG A;  1N4N A;  2YC1 C;  1KAZ A;  3CW4 A;  5AQW A;  5AQL A;  2KSK A;  1JZB A;  1SN1 A;  1NGH A;  5AQH A;  1QQM A;  3KOZ A;  3QFP A;  4FSV A;  4V1D C;  3GL1 A;  1JZA A;  1NGJ A;  2QWP A;  1DKG D;  1PX9 A;  2N2R A;  3E7U X;  2MBK A;  3KOY A;  1QQO A;  1WWN A;  2LT8 A;  4FL9 A;  1NH5 A;  5AQO A;  5F0X A;  4GNI A;  2N66 A;  1ICA A;  3PSM A;  1SN4 A;  4HE7 A;  2LJM A;  2QWM A;  2QXL A;  3ATV A;  2I61 A;  1MYN A;  3D2F B;  1I2V A;  1MR4 A;  1OZZ A;  2QWO A;  2YBR C;  1BA1 A;  1NRB A;  2E0H A;  3I33 A;  1P00 A;  3LDL A;  5AQZ A;  2E88 A;  4KYP A;  5BPL A;  3D2F A;  3M3Z A;  1FH3 A;  1NGA A;  1CHZ A;  1T7E A;  3CQX A;  5AQY A;  1BK8 A;  1XRS B;  3HSC A;  1NE5 A;  3BK3 C;  3D2E B;  4H5V A;  3FZM A;  3QML A;  1SNB A;  1ZYV A;  2E3G A;  3FZH A;  3D2E A;  4H5N A;  4UAD E;  5AQV A;  4AAZ A;  4UJ0 A;  5CY0 A;  2KBK A;  2QWL A;  5AQS A;  1PTX A;  2E2F A;  3FZL A;  5AQK A;  2KBH A;  2YEO A;  3IUC A;  1NGF A;  2YIP A;  3L6Q A;  5EX5 A;  2LR3 A;  1VNA A;  3FE1 A;  1HPM A;  2LN8 A;  2KJA A;  5BN8 A;  5AQR A;  2JDQ D;  1YUW A;  4UAF E;  1GPT A;  3LDN A;  5AR0 A;  5EXW A;  5AQN A;  2GMO A;  1VNB A;  2LJ7 A;  3KC6 A;  1NRA A;  5BPN A;  5FPE A;  1BMR A;  4AB0 A;  1GPS A;  3KP0 A;  1ZVE A;  2D56 A;  2QW9 A;  3KHW A;  4H5R A;  3LDO A;  1OMY A;  1BCG A;  2LKB A;  5FPD A;  1QQN A;  5AQI A;  3L4I A;  3JXU A;  1C55 A;  2BUP A;  1WMT A;  2ASC A;  4HWI A;  5EVZ A;  1S3X A;  5BPM A;  5BN9 A;  1ATR A;  1BUP A;  4HHF A;  5AQG A;  2QWN A;  1KV0 A;  4CQK A;  5AQT A;  2YIO A;  1NGI A;  2KPY A;  1NPI A;  3AY9 A;  3FZF A;  3GDQ A;  1PE4 A;  2KGQ A;  2LY6 A;  3KOW A;  5AQJ A;  4KBO A;  3KP1 A;  1JKZ A;  1UGL A;  1NGG A;  4AEI A;  3GKU A;  2KYQ A;  5FPN A;  1BRZ A;  1JXC A;  1KAX A;  1NGE A;  1B3C A;  4UAE F;  1I6G A;  1ZU3 A;  2YIL A;  2N2Q A;  2QWR A;  2NY9 X;  1ATS A;  2QWQ A;  2KHO A;  3KVG A;  1B7D A;  2NY8 X;  5AQM A;  1HJO A;  3LDP A;  3SF4 D;  2MZ0 A;  2VY6 A;  1DQ7 A;  1NGB A;  2E3F A;  2SN3 A;  3ATU A;  3QI7 A;  4IO8 A;  5AQU A;  1ZFU A;  5F2R A;  5F1X A;  1I2U A;  1KAY A;  2KBJ A;  4H5W A;  2A7T A;  3KOX A;  2K35 A;  3R2V A;  5AQQ A;  1NGC A;  1WT7 A;  1ZYW A;  2LY5 A;  3A8Y A;  1I6F A;  1NGD A;  1P0A A;  3QFU A;  1T7A A;  2ATB A;  1LQQ A;  1CN2 A;  2BRZ A;  3C7N B;  1AHO A;  2B68 A; 
#chains in the Genus database with same CATH homology
 1DJT A;  2LI7 A;  1L4V A;  1C56 A;  2N69 A;  1LQH A;  1T0Z A;  1T7B A;  2GL1 A;  1TI5 A;  3E7R L;  2B3C A;  2M8B B;  1T1T A;  1SEG A;  5KK4 A;  1AYJ A;  1LQI A;  1ZUT A;  1ZVG A;  1N4N A;  2YC1 C;  2KSK A;  1JZB A;  1SN1 A;  4V1D C;  1JZA A;  1PX9 A;  2N2R A;  3E7U X;  1WWN A;  2LT8 A;  1NH5 A;  2N66 A;  1ICA A;  3PSM A;  1SN4 A;  4HE7 A;  2LJM A;  2I61 A;  1MYN A;  1I2V A;  1MR4 A;  1OZZ A;  2YBR C;  1NRB A;  2E0H A;  1FH3 A;  1P00 A;  4KYP A;  1CHZ A;  1T7E A;  1BK8 A;  1NE5 A;  1SNB A;  1ZYV A;  2E3G A;  4AAZ A;  4UJ0 A;  5CY0 A;  2KBK A;  1PTX A;  2KBH A;  2YEO A;  2LR3 A;  1VNA A;  2KJA A;  1GPT A;  2LJ7 A;  1VNB A;  1NRA A;  1BMR A;  4AB0 A;  1GPS A;  1ZVE A;  1OMY A;  1BCG A;  2LKB A;  1C55 A;  1WMT A;  2ASC A;  4HHF A;  4CQK A;  1KV0 A;  2KPY A;  1NPI A;  1PE4 A;  2KGQ A;  2LY6 A;  1JKZ A;  4AEI A;  2KYQ A;  1BRZ A;  1JXC A;  1I6G A;  1B3C A;  1ZU3 A;  2N2Q A;  2NY9 X;  1B7D A;  2NY8 X;  2MZ0 A;  1DQ7 A;  2E3F A;  2SN3 A;  1I2U A;  1ZFU A;  2KBJ A;  2A7T A;  1WT7 A;  1ZYW A;  2LY5 A;  1I6F A;  1P0A A;  1T7A A;  2ATB A;  1LQQ A;  1CN2 A;  2BRZ A;  1AHO A;  2B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...