1I2UA

Nmr solution structures of antifungal heliomicin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
molecule tags Antifungal protein
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2uA00
1JZBA 2B68A 1VNAA 1SN4A 1P00A 1TI5A 4HHFA 1OMYA 1CHZA 1ZU3A 2M8BB 1T7EA 1DQ7A 2E3FA 1ZFUA 2LJ7A 4V1DC 1BMRA 1MR4A 1WT7A 2LY5A 5CY0A 1VNBA 2KJAA 4UJ0A 2KBJA 2SN3A 1NPIA 1GPTA 1DJTA 2N66A 1PX9A 1OZZA 2YC1C 4KYPA 1ZVGA 1LQHA 2E0HA 1WMTA 2LR3A 1AYJA 2KBKA 2A7TA 1BCGA 3E7RL 1NRBA 2LKBA 3E7UX 1ZYWA 2B3CA 1P0AA 2KYQA 4HE7A 2NY8X 1L4VA 2KSKA 2N2RA 1SNBA 2NY9X 1ICAA 2YEOA 1SEGA 1GPSA 1FH3A 1T7BA 2LJMA 2MZ0A 2I61A 1AHOA 1T1TA 1I2UA 5KK4A 1JKZA 1ZVEA 1BRZA 1CN2A 2BRZA 1N4NA 2E3GA 1NRAA 1T0ZA 2KBHA 4AAZA 2N2QA 1JZAA 2GL1A 1ZYVA 2ASCA 1LQIA 1T7AA 2KGQA 1NH5A 2LY6A 3PSMA 1I6FA 1ZUTA 2LI7A 1NE5A 2N69A 1WWNA 4AEIA 1MYNA 1I6GA 1LQQA 2YBRC 4CQKA 1B7DA 1JXCA 1I2VA 2ATBA 2KPYA 4AB0A 1KV0A 1SN1A 1BK8A 1C55A 1C56A 2LT8A 1PTXA 1PE4A 1B3CA
chains in the Genus database with same CATH superfamily
1JZBA 5FPMA 2V7ZA 2B68A 1HPMA 1VNAA 2YIOA 4GNIA 5EY4A 2G2KA 1SN4A 2MBKA 1P00A 5AQHA 1TI5A 4HHFA 2E88A 3A8YA 3L56A 1OMYA 3AY9A 1CHZA 1ZU3A 4H5NA 1BA1A 2M8BB 3C7NA 3KOZA 5AQLA 5BN8A 1T7EA 1DQ7A 5EX5A 1ATRA 3D2FA 2E3FA 1ZFUA 2GMOA 1NGFA 2LJ7A 4V1DC 1BMRA 1MR4A 5AQYA 1WT7A 3D2EB 2LY5A 3KOWA 5CY0A 3KOYA 1VNBA 2QWNA 2QWOA 2KJAA 4H5TA 5AQKA 2LN8A 4HWIA 4UJ0A 1ATSA 3R2VA 2KBJA 2SN3A 5AQRA 3LDNA 1NGHA 4H5RA 4H5VA 5EVZA 1NPIA 4FSVA 1GPTA 3ATUA 1QQOA 1DJTA 3CQXA 1BUPA 5AQXA 2N66A 1PX9A 1OZZA 1KAXA 1QQNA 2YC1C 4UAFE 4KYPA 3FZHA 3ATVA 1NGCA 2QWRA 3CW4A 3FZFA 3FZMA 1ZVGA 4IO8A 1LQHA 5AQJA 2E0HA 3BK3C 2QWLA 1WMTA 2YILA 2LR3A 3JXUA 3L6QA 5AQVA 1AYJA 1NGEA 2KBKA 2A7TA 1BCGA 1BA0A 1NRBA 2QWPA 3E7RL 5AQPA 3C7NB 3LDLA 2LKBA 3E7UX 1ZYWA 2B3CA 1P0AA 2KYQA 4HE7A 2NY8X 1L4VA 2E8AA 2KSKA 2N2RA 1SNBA 2NY9X 5FPEA 1ICAA 2YEOA 2KHOA 3SF4D 1NGJA 1SEGA 5AR0A 4UAEF 5AQUA 1GPSA 1S3XA 3GDQA 1T7BA 3KC6A 2QXLA 1FH3A 2QWQA 5BN9A 2JDQD 5AQTA 2LJMA 2MZ0A 1XRSB 3KHWA 5BPLA 2VY6A 2I61A 1AHOA 1KAYA 1T1TA 3KOXA 3QMLA 5EXWA 5AQMA 3LDQA 5BPMA 5BPNA 3GKUA 5KK4A 1JKZA 1ZVEA 1BRZA 1CN2A 1I2UA 2QW9A 3LDOA 1QQMA 2BRZA 1N4NA 2E3GA 2QWMA 1NGAA 1NRAA 5AQSA 1T0ZA 2KBHA 3D2FB 3HSCA 3QFUA 5AQGA 3KP0A 4AAZA 3QI7A 5AQQA 3KP1A 2N2QA 1JZAA 1NGIA 2GL1A 1HX1A 4H5WA 1ZYVA 5FPDA 1DKGD 2ASCA 3I33A 3FZKA 1LQIA 1T7AA 1NGDA 1KAZA 2KGQA 3FE1A 5AQOA 5AQZA 3FZLA 3GL1A 2BUPA 1NH5A 2LY6A 2D56A 3M3ZA 3PSMA 1I6FA 1NGBA 1ZUTA 2LI7A 5FPNA 4FL9A 1NE5A 2N69A 1YUWA 3L4IA 5AQWA 2K35A 2YIPA 1WWNA 5AQFA 4UADE 4AEIA 1MYNA 5AQIA 1LQQA 1I6GA 4KBOA 5AQNA 1HJOA 2YBRC 1UGLA 3D2EA 3IUCA 5F1XA 2E2FA 4CQKA 2MN5A 1B7DA 1JXCA 3LDPA 1I2VA 2ATBA 2KPYA 1POIA 5F2RA 4AB0A 1KV0A 5F0XA 3QFPA 1NGGA 1SN1A 1BK8A 1C55A 1C56A 2LT8A 1PTXA 1K8BA 1PE4A 3KVGA 1B3CA
chains in the Genus database with same CATH topology
1JZBA 2B68A 1VNAA 1SN4A 1P00A 1TI5A 4HHFA 1OMYA 1CHZA 1ZU3A 2M8BB 1T7EA 1DQ7A 2E3FA 1ZFUA 2LJ7A 4V1DC 1BMRA 1MR4A 1WT7A 2LY5A 5CY0A 1VNBA 2KJAA 4UJ0A 2KBJA 2SN3A 1NPIA 1GPTA 1DJTA 2N66A 1PX9A 1OZZA 2YC1C 4KYPA 1ZVGA 1LQHA 2E0HA 1WMTA 2LR3A 1AYJA 2KBKA 2A7TA 1BCGA 3E7RL 1NRBA 2LKBA 3E7UX 1ZYWA 2B3CA 1P0AA 2KYQA 4HE7A 2NY8X 1L4VA 2KSKA 2N2RA 1SNBA 2NY9X 1ICAA 2YEOA 1SEGA 1GPSA 1FH3A 1T7BA 2LJMA 2MZ0A 2I61A 1AHOA 1T1TA 1I2UA 5KK4A 1JKZA 1ZVEA 1BRZA 1CN2A 2BRZA 1N4NA 2E3GA 1NRAA 1T0ZA 2KBHA 4AAZA 2N2QA 1JZAA 2GL1A 1ZYVA 2ASCA 1LQIA 1T7AA 2KGQA 1NH5A 2LY6A 3PSMA 1I6FA 1ZUTA 2LI7A 1NE5A 2N69A 1WWNA 4AEIA 1MYNA 1I6GA 1LQQA 2YBRC 4CQKA 1B7DA 1JXCA 1I2VA 2ATBA 2KPYA 4AB0A 1KV0A 1SN1A 1BK8A 1C55A 1C56A 2LT8A 1PTXA 1PE4A 1B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZB A;  2B68 A;  1VNA A;  1SN4 A;  1P00 A;  1TI5 A;  4HHF A;  1OMY A;  1CHZ A;  1ZU3 A;  2M8B B;  1T7E A;  1DQ7 A;  2E3F A;  1ZFU A;  2LJ7 A;  4V1D C;  1BMR A;  1MR4 A;  1WT7 A;  2LY5 A;  5CY0 A;  1VNB A;  2KJA A;  4UJ0 A;  2KBJ A;  2SN3 A;  1NPI A;  1GPT A;  1DJT A;  2N66 A;  1PX9 A;  1OZZ A;  2YC1 C;  4KYP A;  1ZVG A;  1LQH A;  2E0H A;  1WMT A;  2LR3 A;  1AYJ A;  2KBK A;  2A7T A;  1BCG A;  3E7R L;  1NRB A;  2LKB A;  3E7U X;  1ZYW A;  2B3C A;  1P0A A;  2KYQ A;  4HE7 A;  2NY8 X;  1L4V A;  2KSK A;  2N2R A;  1SNB A;  2NY9 X;  1ICA A;  2YEO A;  1SEG A;  1GPS A;  1FH3 A;  1T7B A;  2LJM A;  2MZ0 A;  2I61 A;  1AHO A;  1T1T A;  1I2U A;  5KK4 A;  1JKZ A;  1ZVE A;  1BRZ A;  1CN2 A;  2BRZ A;  1N4N A;  2E3G A;  1NRA A;  1T0Z A;  2KBH A;  4AAZ A;  2N2Q A;  1JZA A;  2GL1 A;  1ZYV A;  2ASC A;  1LQI A;  1T7A A;  2KGQ A;  1NH5 A;  2LY6 A;  3PSM A;  1I6F A;  1ZUT A;  2LI7 A;  1NE5 A;  2N69 A;  1WWN A;  4AEI A;  1MYN A;  1I6G A;  1LQQ A;  2YBR C;  4CQK A;  1B7D A;  1JXC A;  1I2V A;  2ATB A;  2KPY A;  4AB0 A;  1KV0 A;  1SN1 A;  1BK8 A;  1C55 A;  1C56 A;  2LT8 A;  1PTX A;  1PE4 A;  1B3C A; 
#chains in the Genus database with same CATH topology
 1JZB A;  5FPM A;  2V7Z A;  2B68 A;  1HPM A;  1VNA A;  2YIO A;  4GNI A;  5EY4 A;  2G2K A;  1SN4 A;  2MBK A;  1P00 A;  5AQH A;  1TI5 A;  4HHF A;  2E88 A;  3A8Y A;  3L56 A;  1OMY A;  3AY9 A;  1CHZ A;  1ZU3 A;  4H5N A;  1BA1 A;  2M8B B;  3C7N A;  3KOZ A;  5AQL A;  5BN8 A;  1T7E A;  1DQ7 A;  5EX5 A;  1ATR A;  3D2F A;  2E3F A;  1ZFU A;  2GMO A;  1NGF A;  2LJ7 A;  4V1D C;  1BMR A;  1MR4 A;  5AQY A;  1WT7 A;  3D2E B;  2LY5 A;  3KOW A;  5CY0 A;  3KOY A;  1VNB A;  2QWN A;  2QWO A;  2KJA A;  4H5T A;  5AQK A;  2LN8 A;  4HWI A;  4UJ0 A;  1ATS A;  3R2V A;  2KBJ A;  2SN3 A;  5AQR A;  3LDN A;  1NGH A;  4H5R A;  4H5V A;  5EVZ A;  1NPI A;  4FSV A;  1GPT A;  3ATU A;  1QQO A;  1DJT A;  3CQX A;  1BUP A;  5AQX A;  2N66 A;  1PX9 A;  1OZZ A;  1KAX A;  1QQN A;  2YC1 C;  4UAF E;  4KYP A;  3FZH A;  3ATV A;  1NGC A;  2QWR A;  3CW4 A;  3FZF A;  3FZM A;  1ZVG A;  4IO8 A;  1LQH A;  5AQJ A;  2E0H A;  3BK3 C;  2QWL A;  1WMT A;  2YIL A;  2LR3 A;  3JXU A;  3L6Q A;  5AQV A;  1AYJ A;  1NGE A;  2KBK A;  2A7T A;  1BCG A;  1BA0 A;  1NRB A;  2QWP A;  3E7R L;  5AQP A;  3C7N B;  3LDL A;  2LKB A;  3E7U X;  1ZYW A;  2B3C A;  1P0A A;  2KYQ A;  4HE7 A;  2NY8 X;  1L4V A;  2E8A A;  2KSK A;  2N2R A;  1SNB A;  2NY9 X;  5FPE A;  1ICA A;  2YEO A;  2KHO A;  3SF4 D;  1NGJ A;  1SEG A;  5AR0 A;  4UAE F;  5AQU A;  1GPS A;  1S3X A;  3GDQ A;  1T7B A;  3KC6 A;  2QXL A;  1FH3 A;  2QWQ A;  5BN9 A;  2JDQ D;  5AQT A;  2LJM A;  2MZ0 A;  1XRS B;  3KHW A;  5BPL A;  2VY6 A;  2I61 A;  1AHO A;  1KAY A;  1T1T A;  3KOX A;  3QML A;  5EXW A;  5AQM A;  3LDQ A;  5BPM A;  5BPN A;  3GKU A;  5KK4 A;  1JKZ A;  1ZVE A;  1BRZ A;  1CN2 A;  1I2U A;  2QW9 A;  3LDO A;  1QQM A;  2BRZ A;  1N4N A;  2E3G A;  2QWM A;  1NGA A;  1NRA A;  5AQS A;  1T0Z A;  2KBH A;  3D2F B;  3HSC A;  3QFU A;  5AQG A;  3KP0 A;  4AAZ A;  3QI7 A;  5AQQ A;  3KP1 A;  2N2Q A;  1JZA A;  1NGI A;  2GL1 A;  1HX1 A;  4H5W A;  1ZYV A;  5FPD A;  1DKG D;  2ASC A;  3I33 A;  3FZK A;  1LQI A;  1T7A A;  1NGD A;  1KAZ A;  2KGQ A;  3FE1 A;  5AQO A;  5AQZ A;  3FZL A;  3GL1 A;  2BUP A;  1NH5 A;  2LY6 A;  2D56 A;  3M3Z A;  3PSM A;  1I6F A;  1NGB A;  1ZUT A;  2LI7 A;  5FPN A;  4FL9 A;  1NE5 A;  2N69 A;  1YUW A;  3L4I A;  5AQW A;  2K35 A;  2YIP A;  1WWN A;  5AQF A;  4UAD E;  4AEI A;  1MYN A;  5AQI A;  1LQQ A;  1I6G A;  4KBO A;  5AQN A;  1HJO A;  2YBR C;  1UGL A;  3D2E A;  3IUC A;  5F1X A;  2E2F A;  4CQK A;  2MN5 A;  1B7D A;  1JXC A;  3LDP A;  1I2V A;  2ATB A;  2KPY A;  1POI A;  5F2R A;  4AB0 A;  1KV0 A;  5F0X A;  3QFP A;  1NGG A;  1SN1 A;  1BK8 A;  1C55 A;  1C56 A;  2LT8 A;  1PTX A;  1K8B A;  1PE4 A;  3KVG A;  1B3C A; 
#chains in the Genus database with same CATH homology
 1JZB A;  2B68 A;  1VNA A;  1SN4 A;  1P00 A;  1TI5 A;  4HHF A;  1OMY A;  1CHZ A;  1ZU3 A;  2M8B B;  1T7E A;  1DQ7 A;  2E3F A;  1ZFU A;  2LJ7 A;  4V1D C;  1BMR A;  1MR4 A;  1WT7 A;  2LY5 A;  5CY0 A;  1VNB A;  2KJA A;  4UJ0 A;  2KBJ A;  2SN3 A;  1NPI A;  1GPT A;  1DJT A;  2N66 A;  1PX9 A;  1OZZ A;  2YC1 C;  4KYP A;  1ZVG A;  1LQH A;  2E0H A;  1WMT A;  2LR3 A;  1AYJ A;  2KBK A;  2A7T A;  1BCG A;  3E7R L;  1NRB A;  2LKB A;  3E7U X;  1ZYW A;  2B3C A;  1P0A A;  2KYQ A;  4HE7 A;  2NY8 X;  1L4V A;  2KSK A;  2N2R A;  1SNB A;  2NY9 X;  1ICA A;  2YEO A;  1SEG A;  1GPS A;  1FH3 A;  1T7B A;  2LJM A;  2MZ0 A;  2I61 A;  1AHO A;  1T1T A;  1I2U A;  5KK4 A;  1JKZ A;  1ZVE A;  1BRZ A;  1CN2 A;  2BRZ A;  1N4N A;  2E3G A;  1NRA A;  1T0Z A;  2KBH A;  4AAZ A;  2N2Q A;  1JZA A;  2GL1 A;  1ZYV A;  2ASC A;  1LQI A;  1T7A A;  2KGQ A;  1NH5 A;  2LY6 A;  3PSM A;  1I6F A;  1ZUT A;  2LI7 A;  1NE5 A;  2N69 A;  1WWN A;  4AEI A;  1MYN A;  1I6G A;  1LQQ A;  2YBR C;  4CQK A;  1B7D A;  1JXC A;  1I2V A;  2ATB A;  2KPY A;  4AB0 A;  1KV0 A;  1SN1 A;  1BK8 A;  1C55 A;  1C56 A;  2LT8 A;  1PTX A;  1PE4 A;  1B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...