4HHFA

Crystal structure of chemically synthesized scorpion alpha-toxin od1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-toxin OD1
publication title Chemical engineering and structural and pharmacological characterization of the alpha-scorpion toxin OD1.
pubmed doi rcsb
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4hhfA00
5KK4A 1WMTA 1AHOA 2KBJA 2B3CA 1NE5A 1C55A 1P0AA 1GPSA 1PX9A 2E3FA 2KGQA 2BRZA 1JZAA 1NRBA 1TI5A 1T1TA 1ZYVA 2I61A 1BMRA 1B3CA 1WT7A 1T7BA 2NY9X 1T7AA 1PE4A 2E3GA 1I6FA 1JZBA 1SN1A 1GPTA 1AYJA 4AEIA 4AB0A 1VNBA 1OMYA 2N2QA 2KYQA 1B7DA 1NH5A 2A7TA 4HE7A 1I6GA 1ZU3A 4V1DC 1ICAA 2M8BB 1CHZA 1LQQA 1ZFUA 2LI7A 1PTXA 1I2UA 1DQ7A 1SNBA 2ASCA 5CY0A 1JKZA 2GL1A 2NY8X 1ZUTA 1NPIA 2N69A 2LY6A 3E7RL 1MR4A 2LT8A 1L4VA 2KJAA 1BK8A 1P00A 1BCGA 1NRAA 2LY5A 1FH3A 2N2RA 1T0ZA 2YC1C 2YEOA 1ZVGA 3PSMA 1JXCA 1SN4A 1C56A 4CQKA 4AAZA 1DJTA 1LQIA 2B68A 1ZYWA 1VNAA 2LJMA 1CN2A 1WWNA 2E0HA 4HHFA 4UJ0A 2KBHA 1MYNA 2KSKA 2LKBA 1ZVEA 2KPYA 2LJ7A 2LR3A 4KYPA 1OZZA 1LQHA 1N4NA 2ATBA 1BRZA 1SEGA 2N66A 2KBKA 2MZ0A 3E7UX 2YBRC 1T7EA 1KV0A 2SN3A 1I2VA
chains in the Genus database with same CATH superfamily
5KK4A 1WMTA 5BN8A 1AHOA 3LDPA 2QWNA 5AQHA 1HX1A 2KBJA 2QWOA 5AQQA 3LDLA 2B3CA 1NE5A 5AQFA 1BA1A 2E88A 1P0AA 3ATUA 1NGEA 1C55A 1GPSA 1PX9A 2E3FA 2LN8A 2MN5A 2KGQA 3KOYA 3KOZA 2BRZA 2QXLA 1JZAA 2QWLA 5AQWA 1NRBA 1TI5A 2QWPA 4H5WA 5AQJA 5AQMA 1NGGA 4H5VA 1T1TA 1ZYVA 5BPLA 2I61A 1QQMA 2VY6A 1BMRA 1K8BA 1B3CA 2GMOA 3I33A 3CW4A 1ATSA 3M3ZA 1NGAA 1WT7A 5FPDA 1T7BA 3C7NB 3ATVA 5AQVA 2QWRA 3LDQA 3GL1A 5BPMA 2NY9X 4FSVA 1T7AA 1PE4A 2E3GA 1I6FA 1JZBA 2KHOA 1ATRA 4HWIA 1NGBA 1SN1A 1GPTA 1AYJA 3BK3C 3LDOA 4AB0A 4AEIA 1QQOA 1VNBA 1OMYA 3FZMA 3CQXA 2N2QA 5AQTA 1NGCA 3A8YA 3QI7A 2KYQA 1B7DA 5AQGA 5F0XA 3GKUA 1NH5A 2A7TA 5AQXA 5BN9A 3QMLA 3D2FA 4HE7A 2QW9A 1UGLA 3KOXA 4UAFE 2V7ZA 1I6GA 1ZU3A 3D2EA 4V1DC 1ICAA 5AQPA 1XRSB 2M8BB 1CHZA 4H5NA 5F1XA 2K35A 5AQUA 5AQLA 1DKGD 1LQQA 1ZFUA 3KC6A 2LI7A 4KBOA 1PTXA 5EXWA 1DQ7A 1I2UA 1SNBA 2ASCA 5CY0A 5AQIA 1KAYA 2GL1A 1ZUTA 2NY8X 3FZKA 5AQYA 1JKZA 1NPIA 2E8AA 2N69A 2LY6A 3FE1A 3GDQA 5EX5A 3E7RL 4IO8A 2YIOA 1MR4A 2LT8A 1L4VA 2KJAA 3FZFA 1P00A 1BCGA 1NGFA 1NRAA 3QFPA 2LY5A 1BK8A 3R2VA 1FH3A 1NGIA 1HJOA 1QQNA 3KP1A 2N2RA 5AQOA 1HPMA 1T0ZA 1KAZA 2YC1C 2G2KA 1ZVGA 2YEOA 3PSMA 1JXCA 2YIPA 5FPNA 1POIA 2MBKA 4GNIA 3KOWA 1SN4A 1C56A 3QFUA 4FL9A 5AQRA 4CQKA 4AAZA 3D2EB 1BA0A 1DJTA 5EY4A 1NGJA 3KHWA 1BUPA 1NGHA 3LDNA 1LQIA 2B68A 1ZYWA 1KAXA 5AR0A 1VNAA 5FPEA 2LJMA 1CN2A 5FPMA 5AQZA 1WWNA 3L6QA 3SF4D 4UADE 2E0HA 4HHFA 4UJ0A 1YUWA 2QWQA 2KBHA 1MYNA 2JDQD 2KSKA 2QWMA 3FZHA 4UAEF 3JXUA 2LKBA 1ZVEA 2KPYA 2LJ7A 2LR3A 3KP0A 4H5TA 4KYPA 3HSCA 2YILA 5AQKA 1OZZA 1LQHA 1S3XA 1N4NA 2ATBA 3C7NA 4H5RA 1BRZA 3L56A 1SEGA 5AQSA 2N66A 1NGDA 5EVZA 3D2FB 2KBKA 3KVGA 2BUPA 2MZ0A 3AY9A 3E7UX 5BPNA 2YBRC 3FZLA 5AQNA 2D56A 3IUCA 3L4IA 1T7EA 1KV0A 2SN3A 5F2RA 2E2FA 1I2VA
chains in the Genus database with same CATH topology
5KK4A 1WMTA 1AHOA 2KBJA 2B3CA 1NE5A 1C55A 1P0AA 1GPSA 1PX9A 2E3FA 2KGQA 2BRZA 1JZAA 1NRBA 1TI5A 1T1TA 1ZYVA 2I61A 1BMRA 1B3CA 1WT7A 1T7BA 2NY9X 1T7AA 1PE4A 2E3GA 1I6FA 1JZBA 1SN1A 1GPTA 1AYJA 4AEIA 4AB0A 1VNBA 1OMYA 2N2QA 2KYQA 1B7DA 1NH5A 2A7TA 4HE7A 1I6GA 1ZU3A 4V1DC 1ICAA 2M8BB 1CHZA 1LQQA 1ZFUA 2LI7A 1PTXA 1I2UA 1DQ7A 1SNBA 2ASCA 5CY0A 1JKZA 2GL1A 2NY8X 1ZUTA 1NPIA 2N69A 2LY6A 3E7RL 1MR4A 2LT8A 1L4VA 2KJAA 1BK8A 1P00A 1BCGA 1NRAA 2LY5A 1FH3A 2N2RA 1T0ZA 2YC1C 2YEOA 1ZVGA 3PSMA 1JXCA 1SN4A 1C56A 4CQKA 4AAZA 1DJTA 1LQIA 2B68A 1ZYWA 1VNAA 2LJMA 1CN2A 1WWNA 2E0HA 4HHFA 4UJ0A 2KBHA 1MYNA 2KSKA 2LKBA 1ZVEA 2KPYA 2LJ7A 2LR3A 4KYPA 1OZZA 1LQHA 1N4NA 2ATBA 1BRZA 1SEGA 2N66A 2KBKA 2MZ0A 3E7UX 2YBRC 1T7EA 1KV0A 2SN3A 1I2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KK4 A;  1WMT A;  1AHO A;  2KBJ A;  2B3C A;  1NE5 A;  1C55 A;  1P0A A;  1GPS A;  1PX9 A;  2E3F A;  2KGQ A;  2BRZ A;  1JZA A;  1NRB A;  1TI5 A;  1T1T A;  1ZYV A;  2I61 A;  1BMR A;  1B3C A;  1WT7 A;  1T7B A;  2NY9 X;  1T7A A;  1PE4 A;  2E3G A;  1I6F A;  1JZB A;  1SN1 A;  1GPT A;  1AYJ A;  4AEI A;  4AB0 A;  1VNB A;  1OMY A;  2N2Q A;  2KYQ A;  1B7D A;  1NH5 A;  2A7T A;  4HE7 A;  1I6G A;  1ZU3 A;  4V1D C;  1ICA A;  2M8B B;  1CHZ A;  1LQQ A;  1ZFU A;  2LI7 A;  1PTX A;  1I2U A;  1DQ7 A;  1SNB A;  2ASC A;  5CY0 A;  1JKZ A;  2GL1 A;  2NY8 X;  1ZUT A;  1NPI A;  2N69 A;  2LY6 A;  3E7R L;  1MR4 A;  2LT8 A;  1L4V A;  2KJA A;  1BK8 A;  1P00 A;  1BCG A;  1NRA A;  2LY5 A;  1FH3 A;  2N2R A;  1T0Z A;  2YC1 C;  2YEO A;  1ZVG A;  3PSM A;  1JXC A;  1SN4 A;  1C56 A;  4CQK A;  4AAZ A;  1DJT A;  1LQI A;  2B68 A;  1ZYW A;  1VNA A;  2LJM A;  1CN2 A;  1WWN A;  2E0H A;  4HHF A;  4UJ0 A;  2KBH A;  1MYN A;  2KSK A;  2LKB A;  1ZVE A;  2KPY A;  2LJ7 A;  2LR3 A;  4KYP A;  1OZZ A;  1LQH A;  1N4N A;  2ATB A;  1BRZ A;  1SEG A;  2N66 A;  2KBK A;  2MZ0 A;  3E7U X;  2YBR C;  1T7E A;  1KV0 A;  2SN3 A;  1I2V A; 
#chains in the Genus database with same CATH topology
 5KK4 A;  1WMT A;  5BN8 A;  1AHO A;  3LDP A;  2QWN A;  5AQH A;  1HX1 A;  2KBJ A;  2QWO A;  5AQQ A;  3LDL A;  2B3C A;  1NE5 A;  5AQF A;  1BA1 A;  2E88 A;  1P0A A;  3ATU A;  1NGE A;  1C55 A;  1GPS A;  1PX9 A;  2E3F A;  2LN8 A;  2MN5 A;  2KGQ A;  3KOY A;  3KOZ A;  2BRZ A;  2QXL A;  1JZA A;  2QWL A;  5AQW A;  1NRB A;  1TI5 A;  2QWP A;  4H5W A;  5AQJ A;  5AQM A;  1NGG A;  4H5V A;  1T1T A;  1ZYV A;  5BPL A;  2I61 A;  1QQM A;  2VY6 A;  1BMR A;  1K8B A;  1B3C A;  2GMO A;  3I33 A;  3CW4 A;  1ATS A;  3M3Z A;  1NGA A;  1WT7 A;  5FPD A;  1T7B A;  3C7N B;  3ATV A;  5AQV A;  2QWR A;  3LDQ A;  3GL1 A;  5BPM A;  2NY9 X;  4FSV A;  1T7A A;  1PE4 A;  2E3G A;  1I6F A;  1JZB A;  2KHO A;  1ATR A;  4HWI A;  1NGB A;  1SN1 A;  1GPT A;  1AYJ A;  3BK3 C;  3LDO A;  4AB0 A;  4AEI A;  1QQO A;  1VNB A;  1OMY A;  3FZM A;  3CQX A;  2N2Q A;  5AQT A;  1NGC A;  3A8Y A;  3QI7 A;  2KYQ A;  1B7D A;  5AQG A;  5F0X A;  3GKU A;  1NH5 A;  2A7T A;  5AQX A;  5BN9 A;  3QML A;  3D2F A;  4HE7 A;  2QW9 A;  1UGL A;  3KOX A;  4UAF E;  2V7Z A;  1I6G A;  1ZU3 A;  3D2E A;  4V1D C;  1ICA A;  5AQP A;  1XRS B;  2M8B B;  1CHZ A;  4H5N A;  5F1X A;  2K35 A;  5AQU A;  5AQL A;  1DKG D;  1LQQ A;  1ZFU A;  3KC6 A;  2LI7 A;  4KBO A;  1PTX A;  5EXW A;  1DQ7 A;  1I2U A;  1SNB A;  2ASC A;  5CY0 A;  5AQI A;  1KAY A;  2GL1 A;  1ZUT A;  2NY8 X;  3FZK A;  5AQY A;  1JKZ A;  1NPI A;  2E8A A;  2N69 A;  2LY6 A;  3FE1 A;  3GDQ A;  5EX5 A;  3E7R L;  4IO8 A;  2YIO A;  1MR4 A;  2LT8 A;  1L4V A;  2KJA A;  3FZF A;  1P00 A;  1BCG A;  1NGF A;  1NRA A;  3QFP A;  2LY5 A;  1BK8 A;  3R2V A;  1FH3 A;  1NGI A;  1HJO A;  1QQN A;  3KP1 A;  2N2R A;  5AQO A;  1HPM A;  1T0Z A;  1KAZ A;  2YC1 C;  2G2K A;  1ZVG A;  2YEO A;  3PSM A;  1JXC A;  2YIP A;  5FPN A;  1POI A;  2MBK A;  4GNI A;  3KOW A;  1SN4 A;  1C56 A;  3QFU A;  4FL9 A;  5AQR A;  4CQK A;  4AAZ A;  3D2E B;  1BA0 A;  1DJT A;  5EY4 A;  1NGJ A;  3KHW A;  1BUP A;  1NGH A;  3LDN A;  1LQI A;  2B68 A;  1ZYW A;  1KAX A;  5AR0 A;  1VNA A;  5FPE A;  2LJM A;  1CN2 A;  5FPM A;  5AQZ A;  1WWN A;  3L6Q A;  3SF4 D;  4UAD E;  2E0H A;  4HHF A;  4UJ0 A;  1YUW A;  2QWQ A;  2KBH A;  1MYN A;  2JDQ D;  2KSK A;  2QWM A;  3FZH A;  4UAE F;  3JXU A;  2LKB A;  1ZVE A;  2KPY A;  2LJ7 A;  2LR3 A;  3KP0 A;  4H5T A;  4KYP A;  3HSC A;  2YIL A;  5AQK A;  1OZZ A;  1LQH A;  1S3X A;  1N4N A;  2ATB A;  3C7N A;  4H5R A;  1BRZ A;  3L56 A;  1SEG A;  5AQS A;  2N66 A;  1NGD A;  5EVZ A;  3D2F B;  2KBK A;  3KVG A;  2BUP A;  2MZ0 A;  3AY9 A;  3E7U X;  5BPN A;  2YBR C;  3FZL A;  5AQN A;  2D56 A;  3IUC A;  3L4I A;  1T7E A;  1KV0 A;  2SN3 A;  5F2R A;  2E2F A;  1I2V A; 
#chains in the Genus database with same CATH homology
 5KK4 A;  1WMT A;  1AHO A;  2KBJ A;  2B3C A;  1NE5 A;  1C55 A;  1P0A A;  1GPS A;  1PX9 A;  2E3F A;  2KGQ A;  2BRZ A;  1JZA A;  1NRB A;  1TI5 A;  1T1T A;  1ZYV A;  2I61 A;  1BMR A;  1B3C A;  1WT7 A;  1T7B A;  2NY9 X;  1T7A A;  1PE4 A;  2E3G A;  1I6F A;  1JZB A;  1SN1 A;  1GPT A;  1AYJ A;  4AEI A;  4AB0 A;  1VNB A;  1OMY A;  2N2Q A;  2KYQ A;  1B7D A;  1NH5 A;  2A7T A;  4HE7 A;  1I6G A;  1ZU3 A;  4V1D C;  1ICA A;  2M8B B;  1CHZ A;  1LQQ A;  1ZFU A;  2LI7 A;  1PTX A;  1I2U A;  1DQ7 A;  1SNB A;  2ASC A;  5CY0 A;  1JKZ A;  2GL1 A;  2NY8 X;  1ZUT A;  1NPI A;  2N69 A;  2LY6 A;  3E7R L;  1MR4 A;  2LT8 A;  1L4V A;  2KJA A;  1BK8 A;  1P00 A;  1BCG A;  1NRA A;  2LY5 A;  1FH3 A;  2N2R A;  1T0Z A;  2YC1 C;  2YEO A;  1ZVG A;  3PSM A;  1JXC A;  1SN4 A;  1C56 A;  4CQK A;  4AAZ A;  1DJT A;  1LQI A;  2B68 A;  1ZYW A;  1VNA A;  2LJM A;  1CN2 A;  1WWN A;  2E0H A;  4HHF A;  4UJ0 A;  2KBH A;  1MYN A;  2KSK A;  2LKB A;  1ZVE A;  2KPY A;  2LJ7 A;  2LR3 A;  4KYP A;  1OZZ A;  1LQH A;  1N4N A;  2ATB A;  1BRZ A;  1SEG A;  2N66 A;  2KBK A;  2MZ0 A;  3E7U X;  2YBR C;  1T7E A;  1KV0 A;  2SN3 A;  1I2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...