1K8BA

Nmr structure analysis of the n-terminal domain of archaeal translation initiation factor 2 subunit beta
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
EILIEGNRTIIRNFRELAKAVNRDEEFFAKYLLKETGSAGNLEGGRLILQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSLATION INITIATION FACTOR 2 BETA SUBUNIT
publication title Structure of the beta subunit of translation initiation factor 2 from the archaeon Methanococcus jannaschii: a representative of the eIF2beta/eIF5 family of proteins.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 1k8bA00
2G2KA 1K8BA
chains in the Genus database with same CATH superfamily
3FZMA 3CW4A 3GKUA 2B68A 1ZYWA 2MN5A 2K35A 5AQIA 2NY8X 1NGDA 1ZYVA 2NY9X 3QI7A 1SNBA 2QWMA 4UADE 1QQMA 1DKGD 1BK8A 1P00A 4HHFA 3HSCA 1ZFUA 5AQHA 1LQHA 2I61A 4H5TA 5AQYA 5FPDA 1T1TA 2LJMA 2LKBA 1QQNA 2N66A 2YC1C 3LDNA 3M3ZA 5AQRA 1ZVEA 5BN9A 2A7TA 3C7NA 5F2RA 1UGLA 5BPLA 5BPMA 1KAYA 1NGHA 1TI5A 1ZU3A 2QWNA 3I33A 1HJOA 5AQMA 1QQOA 3KC6A 5AQOA 4UJ0A 1JKZA 1MR4A 1T7AA 3D2EA 1MYNA 5AQKA 1BMRA 4H5RA 3LDPA 1NGJA 5FPEA 4H5VA 2LI7A 1AYJA 2QWLA 3IUCA 5AQWA 5CY0A 1I2UA 2YILA 3L56A 3L6QA 1DJTA 2YIOA 2E2FA 3KP1A 3ATUA 3FZHA 3FZFA 1HPMA 2ASCA 1KAXA 5AR0A 5FPNA 2VY6A 3D2FB 4KYPA 1NGAA 1OMYA 3PSMA 2QXLA 1SN4A 1KAZA 1OZZA 5AQPA 1C56A 1NH5A 3FZKA 2BUPA 3LDQA 2MZ0A 1WWNA 2E0HA 4HWIA 3GL1A 3QFUA 4FSVA 4UAEF 1BRZA 2E88A 2QWQA 1GPSA 3R2VA 1WT7A 3FZLA 4CQKA 1CHZA 1NGIA 2YEOA 3D2FA 1B7DA 5AQUA 1JZAA 1GPTA 1I6FA 5EY4A 1L4VA 1NGBA 2N69A 1T7BA 3KP0A 3L4IA 2E8AA 3SF4D 1I2VA 1NGGA 1POIA 1JZBA 5AQNA 2YBRC 4AEIA 2KBHA 3ATVA 5KK4A 4H5NA 1C55A 1VNAA 2D56A 1FH3A 1PTXA 1B3CA 3A8YA 1WMTA 1NGCA 2SN3A 5AQTA 5BN8A 1I6GA 2YIPA 5BPNA 1CN2A 5AQSA 5AQGA 2QWRA 3BK3C 1VNBA 5F1XA 1DQ7A 3CQXA 1T0ZA 1BA0A 2B3CA 2G2KA 3LDLA 3FE1A 4IO8A 1NRBA 4AB0A 2V7ZA 2LR3A 5AQXA 1PX9A 1PE4A 4KBOA 2KYQA 5AQVA 1K8BA 2BRZA 5EX5A 2KBJA 1XRSB 4V1DC 2KPYA 4UAFE 5AQZA 5EVZA 1BA1A 1BCGA 1KV0A 4AAZA 5EXWA 2QWOA 2GL1A 4H5WA 5AQFA 2LN8A 5AQLA 2LY6A 1ATSA 2E3FA 3E7RL 2KHOA 1P0AA 2LT8A 3C7NB 3KOWA 1ATRA 2QWPA 3QFPA 2LY5A 1T7EA 4GNIA 1NE5A 4HE7A 3KOZA 5AQQA 1BUPA 1S3XA 3QMLA 1ZUTA 2ATBA 3D2EB 1LQQA 3KVGA 1NPIA 1JXCA 5AQJA 1NGFA 2GMOA 1LQIA 2QW9A 1NRAA 2KBKA 5F0XA 1SEGA 2KGQA 2M8BB 2N2RA 3KOYA 1AHOA 1ZVGA 1ICAA 1NGEA 1YUWA 1N4NA 2LJ7A 3E7UX 3JXUA 1SN1A 3KHWA 3GDQA 3KOXA 2E3GA 3AY9A 4FL9A 1HX1A 2N2QA 2JDQD 2KSKA 2KJAA 2MBKA 5FPMA 3LDOA
chains in the Genus database with same CATH topology
2G2KA 1K8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2K A;  1K8B A; 
#chains in the Genus database with same CATH topology
 3FZM A;  3CW4 A;  3GKU A;  2B68 A;  1ZYW A;  2MN5 A;  2K35 A;  5AQI A;  2NY8 X;  1NGD A;  1ZYV A;  2NY9 X;  3QI7 A;  1SNB A;  2QWM A;  4UAD E;  1QQM A;  1DKG D;  1BK8 A;  1P00 A;  4HHF A;  3HSC A;  1ZFU A;  5AQH A;  1LQH A;  2I61 A;  4H5T A;  5AQY A;  5FPD A;  1T1T A;  2LJM A;  2LKB A;  1QQN A;  2N66 A;  2YC1 C;  3LDN A;  3M3Z A;  5AQR A;  1ZVE A;  5BN9 A;  2A7T A;  3C7N A;  5F2R A;  1UGL A;  5BPL A;  5BPM A;  1KAY A;  1NGH A;  1TI5 A;  1ZU3 A;  2QWN A;  3I33 A;  1HJO A;  5AQM A;  1QQO A;  3KC6 A;  5AQO A;  4UJ0 A;  1JKZ A;  1MR4 A;  1T7A A;  3D2E A;  1MYN A;  5AQK A;  1BMR A;  4H5R A;  3LDP A;  1NGJ A;  5FPE A;  4H5V A;  2LI7 A;  1AYJ A;  2QWL A;  3IUC A;  5AQW A;  5CY0 A;  1I2U A;  2YIL A;  3L56 A;  3L6Q A;  1DJT A;  2YIO A;  2E2F A;  3KP1 A;  3ATU A;  3FZH A;  3FZF A;  1HPM A;  2ASC A;  1KAX A;  5AR0 A;  5FPN A;  2VY6 A;  3D2F B;  4KYP A;  1NGA A;  1OMY A;  3PSM A;  2QXL A;  1SN4 A;  1KAZ A;  1OZZ A;  5AQP A;  1C56 A;  1NH5 A;  3FZK A;  2BUP A;  3LDQ A;  2MZ0 A;  1WWN A;  2E0H A;  4HWI A;  3GL1 A;  3QFU A;  4FSV A;  4UAE F;  1BRZ A;  2E88 A;  2QWQ A;  1GPS A;  3R2V A;  1WT7 A;  3FZL A;  4CQK A;  1CHZ A;  1NGI A;  2YEO A;  3D2F A;  1B7D A;  5AQU A;  1JZA A;  1GPT A;  1I6F A;  5EY4 A;  1L4V A;  1NGB A;  2N69 A;  1T7B A;  3KP0 A;  3L4I A;  2E8A A;  3SF4 D;  1I2V A;  1NGG A;  1POI A;  1JZB A;  5AQN A;  2YBR C;  4AEI A;  2KBH A;  3ATV A;  5KK4 A;  4H5N A;  1C55 A;  1VNA A;  2D56 A;  1FH3 A;  1PTX A;  1B3C A;  3A8Y A;  1WMT A;  1NGC A;  2SN3 A;  5AQT A;  5BN8 A;  1I6G A;  2YIP A;  5BPN A;  1CN2 A;  5AQS A;  5AQG A;  2QWR A;  3BK3 C;  1VNB A;  5F1X A;  1DQ7 A;  3CQX A;  1T0Z A;  1BA0 A;  2B3C A;  2G2K A;  3LDL A;  3FE1 A;  4IO8 A;  1NRB A;  4AB0 A;  2V7Z A;  2LR3 A;  5AQX A;  1PX9 A;  1PE4 A;  4KBO A;  2KYQ A;  5AQV A;  1K8B A;  2BRZ A;  5EX5 A;  2KBJ A;  1XRS B;  4V1D C;  2KPY A;  4UAF E;  5AQZ A;  5EVZ A;  1BA1 A;  1BCG A;  1KV0 A;  4AAZ A;  5EXW A;  2QWO A;  2GL1 A;  4H5W A;  5AQF A;  2LN8 A;  5AQL A;  2LY6 A;  1ATS A;  2E3F A;  3E7R L;  2KHO A;  1P0A A;  2LT8 A;  3C7N B;  3KOW A;  1ATR A;  2QWP A;  3QFP A;  2LY5 A;  1T7E A;  4GNI A;  1NE5 A;  4HE7 A;  3KOZ A;  5AQQ A;  1BUP A;  1S3X A;  3QML A;  1ZUT A;  2ATB A;  3D2E B;  1LQQ A;  3KVG A;  1NPI A;  1JXC A;  5AQJ A;  1NGF A;  2GMO A;  1LQI A;  2QW9 A;  1NRA A;  2KBK A;  5F0X A;  1SEG A;  2KGQ A;  2M8B B;  2N2R A;  3KOY A;  1AHO A;  1ZVG A;  1ICA A;  1NGE A;  1YUW A;  1N4N A;  2LJ7 A;  3E7U X;  3JXU A;  1SN1 A;  3KHW A;  3GDQ A;  3KOX A;  2E3G A;  3AY9 A;  4FL9 A;  1HX1 A;  2N2Q A;  2JDQ D;  2KSK A;  2KJA A;  2MBK A;  5FPM A;  3LDO A; 
#chains in the Genus database with same CATH homology
 2G2K A;  1K8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...