1K8BA

Nmr structure analysis of the n-terminal domain of archaeal translation initiation factor 2 subunit beta
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'EILIEGNRTIIRNFRELAKAVNRDEEFFAKYLLKETGSAGNLEGGRLILQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSLATION INITIATION FACTOR 2 BETA SUBUNIT
publication title Structure of the beta subunit of translation initiation factor 2 from the archaeon Methanococcus jannaschii: a representative of the eIF2beta/eIF5 family of proteins.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.50 Alpha Beta 2-Layer Sandwich Defensin A-like Translation initiation factor 2 beta, aIF2beta, N-terminal domain 1k8bA00
1K8BA 2G2KA
chains in the Genus database with same CATH superfamily
2LI7A 4UAFE 4UADE 1WMTA 2LKBA 3KC6A 3R2VA 4H5NA 1P0AA 1DQ7A 1PTXA 2B68A 1DJTA 2A7TA 3FE1A 3L56A 3KOXA 1L4VA 3IUCA 2YEOA 2MZ0A 3FZMA 1AYJA 1ZUTA 4CQKA 2YBRC 1I6FA 1ATSA 5FPNA 3LDQA 5AQKA 2N2QA 5BPMA 1GPTA 1SEGA 5AQZA 1I2UA 2KHOA 1B3CA 5EX5A 3D2FA 5AQQA 4AB0A 3LDPA 1JZAA 4V1DC 3D2FB 1C55A 4UAEF 2ASCA 3GL1A 5AQHA 2QXLA 4AEIA 1NGEA 2KGQA 5AQUA 3D2EA 2MN5A 1HJOA 2K35A 1KAXA 1VNBA 3C7NB 3CW4A 1JZBA 3QI7A 3QMLA 1BMRA 3FZKA 4KYPA 1I2VA 5AQNA 4GNIA 2D56A 3L4IA 1HX1A 2BUPA 1DKGD 3LDOA 1BK8A 1BCGA 4HHFA 4KBOA 1NGCA 1KAYA 2QWLA 1YUWA 1MYNA 1BA1A 2MBKA 2QWQA 3A8YA 5AQOA 4AAZA 1GPSA 1SN4A 2N66A 3JXUA 5F2RA 1AHOA 1LQIA 5EXWA 2LR3A 3SF4D 1NGGA 3FZFA 3KOZA 5BN9A 4FSVA 3HSCA 3KOYA 4H5WA 1BRZA 1ZYWA 1NRAA 2GMOA 1HPMA 1OZZA 5AQJA 2KYQA 1PE4A 1QQOA 2QWRA 2QWMA 3CQXA 2LJMA 1PX9A 1C56A 2KBKA 3C7NA 5AQLA 5BPLA 1WWNA 5CY0A 5F1XA 3AY9A 5FPDA 3GKUA 3KP0A 1LQQA 2QWNA 3PSMA 1CN2A 5AQWA 3LDLA 2KBHA 5AQSA 2M8BB 3QFPA 1VNAA 2E8AA 3E7RL 1BA0A 1ATRA 1KAZA 1NPIA 1SNBA 2I61A 1NGHA 2KJAA 2NY8X 3E7UX 3FZHA 2N2RA 1ZU3A 4FL9A 1T1TA 4H5TA 5AQVA 1OMYA 2GL1A 1MR4A 2LJ7A 1JKZA 3L6QA 5F0XA 3M3ZA 1T7EA 1CHZA 1SN1A 2LY5A 3KOWA 2SN3A 1I6GA 3ATUA 1NGAA 1QQMA 5AQXA 5AQFA 1UGLA 3BK3C 2E3GA 1XRSB 3I33A 1K8BA 1POIA 1T7BA 5FPMA 5KK4A 3ATVA 1BUPA 3QFUA 2G2KA 3KVGA 5FPEA 5AQGA 5BPNA 1NGFA 5EY4A 1ZFUA 2QW9A 1T7AA 2NY9X 4UJ0A 4HWIA 5AQRA 1LQHA 1ZVGA 1ZYVA 2E3FA 1NE5A 3FZLA 3KHWA 4IO8A 5AQMA 1NGJA 1ICAA 1NGDA 2BRZA 1S3XA 1P00A 1NGBA 1KV0A 5BN8A 2JDQD 2KSKA 2LT8A 4HE7A 1NRBA 3GDQA 2E0HA 2YIOA 2V7ZA 2YIPA 1N4NA 2QWOA 5AQPA 1NH5A 2N69A 2ATBA 2QWPA 1ZVEA 2VY6A 5AQIA 1JXCA 2E2FA 2LY6A 3LDNA 1WT7A 2E88A 2KPYA 4H5RA 3KP1A 1B7DA 5AQTA 2YILA 4H5VA 5AR0A 2YC1C 5EVZA 2KBJA 2LN8A 5AQYA 1TI5A 1T0ZA 1NGIA 1FH3A 3D2EB 1QQNA 2B3CA
chains in the Genus database with same CATH topology
1K8BA 2G2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8B A;  2G2K A; 
#chains in the Genus database with same CATH topology
 2LI7 A;  4UAF E;  4UAD E;  1WMT A;  2LKB A;  3KC6 A;  3R2V A;  4H5N A;  1P0A A;  1DQ7 A;  1PTX A;  2B68 A;  1DJT A;  2A7T A;  3FE1 A;  3L56 A;  3KOX A;  1L4V A;  3IUC A;  2YEO A;  2MZ0 A;  3FZM A;  1AYJ A;  1ZUT A;  4CQK A;  2YBR C;  1I6F A;  1ATS A;  5FPN A;  3LDQ A;  5AQK A;  2N2Q A;  5BPM A;  1GPT A;  1SEG A;  5AQZ A;  1I2U A;  2KHO A;  1B3C A;  5EX5 A;  3D2F A;  5AQQ A;  4AB0 A;  3LDP A;  1JZA A;  4V1D C;  3D2F B;  1C55 A;  4UAE F;  2ASC A;  3GL1 A;  5AQH A;  2QXL A;  4AEI A;  1NGE A;  2KGQ A;  5AQU A;  3D2E A;  2MN5 A;  1HJO A;  2K35 A;  1KAX A;  1VNB A;  3C7N B;  3CW4 A;  1JZB A;  3QI7 A;  3QML A;  1BMR A;  3FZK A;  4KYP A;  1I2V A;  5AQN A;  4GNI A;  2D56 A;  3L4I A;  1HX1 A;  2BUP A;  1DKG D;  3LDO A;  1BK8 A;  1BCG A;  4HHF A;  4KBO A;  1NGC A;  1KAY A;  2QWL A;  1YUW A;  1MYN A;  1BA1 A;  2MBK A;  2QWQ A;  3A8Y A;  5AQO A;  4AAZ A;  1GPS A;  1SN4 A;  2N66 A;  3JXU A;  5F2R A;  1AHO A;  1LQI A;  5EXW A;  2LR3 A;  3SF4 D;  1NGG A;  3FZF A;  3KOZ A;  5BN9 A;  4FSV A;  3HSC A;  3KOY A;  4H5W A;  1BRZ A;  1ZYW A;  1NRA A;  2GMO A;  1HPM A;  1OZZ A;  5AQJ A;  2KYQ A;  1PE4 A;  1QQO A;  2QWR A;  2QWM A;  3CQX A;  2LJM A;  1PX9 A;  1C56 A;  2KBK A;  3C7N A;  5AQL A;  5BPL A;  1WWN A;  5CY0 A;  5F1X A;  3AY9 A;  5FPD A;  3GKU A;  3KP0 A;  1LQQ A;  2QWN A;  3PSM A;  1CN2 A;  5AQW A;  3LDL A;  2KBH A;  5AQS A;  2M8B B;  3QFP A;  1VNA A;  2E8A A;  3E7R L;  1BA0 A;  1ATR A;  1KAZ A;  1NPI A;  1SNB A;  2I61 A;  1NGH A;  2KJA A;  2NY8 X;  3E7U X;  3FZH A;  2N2R A;  1ZU3 A;  4FL9 A;  1T1T A;  4H5T A;  5AQV A;  1OMY A;  2GL1 A;  1MR4 A;  2LJ7 A;  1JKZ A;  3L6Q A;  5F0X A;  3M3Z A;  1T7E A;  1CHZ A;  1SN1 A;  2LY5 A;  3KOW A;  2SN3 A;  1I6G A;  3ATU A;  1NGA A;  1QQM A;  5AQX A;  5AQF A;  1UGL A;  3BK3 C;  2E3G A;  1XRS B;  3I33 A;  1K8B A;  1POI A;  1T7B A;  5FPM A;  5KK4 A;  3ATV A;  1BUP A;  3QFU A;  2G2K A;  3KVG A;  5FPE A;  5AQG A;  5BPN A;  1NGF A;  5EY4 A;  1ZFU A;  2QW9 A;  1T7A A;  2NY9 X;  4UJ0 A;  4HWI A;  5AQR A;  1LQH A;  1ZVG A;  1ZYV A;  2E3F A;  1NE5 A;  3FZL A;  3KHW A;  4IO8 A;  5AQM A;  1NGJ A;  1ICA A;  1NGD A;  2BRZ A;  1S3X A;  1P00 A;  1NGB A;  1KV0 A;  5BN8 A;  2JDQ D;  2KSK A;  2LT8 A;  4HE7 A;  1NRB A;  3GDQ A;  2E0H A;  2YIO A;  2V7Z A;  2YIP A;  1N4N A;  2QWO A;  5AQP A;  1NH5 A;  2N69 A;  2ATB A;  2QWP A;  1ZVE A;  2VY6 A;  5AQI A;  1JXC A;  2E2F A;  2LY6 A;  3LDN A;  1WT7 A;  2E88 A;  2KPY A;  4H5R A;  3KP1 A;  1B7D A;  5AQT A;  2YIL A;  4H5V A;  5AR0 A;  2YC1 C;  5EVZ A;  2KBJ A;  2LN8 A;  5AQY A;  1TI5 A;  1T0Z A;  1NGI A;  1FH3 A;  3D2E B;  1QQN A;  2B3C A; 
#chains in the Genus database with same CATH homology
 1K8B A;  2G2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...