2ASCA

Scorpion toxin lqh-alpha-it
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords neurotoxin alpha-IT
publication title X-ray structures of Lqh-alpha-IT and Lqh-alpha-IT8D9D10V mutant
rcsb
source organism Leiurus quinquestriatus
molecule tags Toxin
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2ascA00
1JZBA 1PTXA 1B7DA 2GL1A 1ICAA 2NY8X 2N69A 4AEIA 2N66A 2LY5A 1FH3A 2M8BB 2E0HA 4CQKA 2KSKA 1MYNA 1BK8A 1DJTA 1ZUTA 1AYJA 1GPTA 1C55A 1ZYVA 1BRZA 1LQQA 1L4VA 4V1DC 1ZYWA 1B3CA 2BRZA 1I2UA 2LKBA 1I6FA 1P0AA 1T7BA 1KV0A 4HE7A 1N4NA 1PE4A 1SN4A 1CN2A 1T7AA 2MZ0A 1I6GA 2YEOA 1DQ7A 1JKZA 4HHFA 2LI7A 1NRBA 2LJ7A 2B3CA 2ATBA 1SEGA 1ZVEA 3E7RL 2N2QA 2KBHA 1NE5A 2E3FA 1PX9A 1VNBA 1OZZA 4KYPA 2LR3A 4AB0A 1BMRA 1SNBA 2NY9X 1BCGA 2LY6A 5CY0A 2LT8A 4UJ0A 1LQIA 1T0ZA 1C56A 1WWNA 1AHOA 2A7TA 2KJAA 2KBJA 2I61A 1ZVGA 4AAZA 1ZU3A 1T7EA 2B68A 3PSMA 3E7UX 1OMYA 1SN1A 1NH5A 1WMTA 2KGQA 2N2RA 2SN3A 1JZAA 2E3GA 1MR4A 2YC1C 5KK4A 1CHZA 1I2VA 1ZFUA 1WT7A 2LJMA 1JXCA 1VNAA 1T1TA 1LQHA 1TI5A 1P00A 2KBKA 2YBRC 2ASCA 1GPSA 1NPIA 2KYQA 1NRAA 2KPYA
chains in the Genus database with same CATH superfamily
1JZBA 1PTXA 1B7DA 5AQIA 5AQQA 2GL1A 3KC6A 1ICAA 3LDLA 3ATUA 2NY8X 5AQRA 1NGAA 5FPMA 2N69A 4AEIA 5AQGA 2N66A 2LY5A 2YILA 1FH3A 3C7NA 2M8BB 2E0HA 2KPYA 2QWRA 2KSKA 5AQHA 4CQKA 2GMOA 4GNIA 1MYNA 2V7ZA 1BK8A 1DJTA 4H5WA 1ZUTA 1AYJA 3A8YA 1QQMA 3JXUA 3GL1A 3R2VA 5AQZA 3KOZA 1C55A 1ZYVA 2QWMA 1GPTA 5AQXA 1BRZA 4UAFE 2K35A 1LQQA 4H5NA 1L4VA 1NGJA 5FPNA 3IUCA 3CW4A 3SF4D 2MN5A 4V1DC 1ZYWA 1POIA 3FZFA 5BN8A 2VY6A 3FZLA 4UAEF 1B3CA 3C7NB 2BRZA 2QWQA 2QW9A 1I2UA 2LKBA 1BA1A 4H5TA 5BN9A 3ATVA 1I6FA 1P0AA 1T7BA 2E8AA 2QWLA 1KV0A 3KOYA 4HE7A 5AQTA 1N4NA 1NGGA 1KAZA 1PE4A 3D2EA 1SN4A 1CN2A 1K8BA 1T7AA 2MZ0A 1I6GA 2YEOA 3LDNA 5AQOA 1DQ7A 1HJOA 2LN8A 1NGIA 2LI7A 1NGBA 1NRBA 1NGHA 3CQXA 3KHWA 3QI7A 4HHFA 2LJ7A 2B3CA 5F0XA 2ATBA 5AQJA 4H5RA 1SEGA 1ZVEA 1HPMA 1UGLA 3E7RL 2N2QA 4IO8A 3LDOA 1NGEA 2KBHA 5BPNA 2E2FA 1NE5A 3I33A 5F1XA 3FZKA 5AQUA 2YIPA 3L56A 3FE1A 1S3XA 1DKGD 3QFUA 5FPDA 5F2RA 1JKZA 2E3FA 1ATSA 1XRSB 3D2EB 1PX9A 5BPMA 5EVZA 1VNBA 1OZZA 4KYPA 2LR3A 4UADE 4FL9A 4AB0A 3GKUA 3KVGA 2BUPA 1BMRA 1SNBA 2NY9X 2QWOA 1BCGA 3L6QA 2QXLA 3QFPA 2LY6A 5FPEA 3D2FA 5CY0A 2LT8A 1YUWA 4UJ0A 3KOWA 4FSVA 1NGFA 1LQIA 3BK3C 2YIOA 5AQYA 5AQNA 1T0ZA 5AQFA 5AQLA 3FZHA 1C56A 1QQOA 1KAYA 1WWNA 1AHOA 2QWPA 5BPLA 2A7TA 3KOXA 3LDPA 3L4IA 1NGDA 2KJAA 2KBJA 2I61A 1ZVGA 4AAZA 3QMLA 1ZU3A 2G2KA 5AQMA 1T7EA 2B68A 3PSMA 2JDQD 3E7UX 1OMYA 1SN1A 5AQSA 1NH5A 3M3ZA 3D2FB 1WMTA 2KGQA 4HWIA 1BA0A 2N2RA 3FZMA 1BUPA 5AQPA 2SN3A 1JZAA 2E3GA 3AY9A 1MR4A 2YC1C 5EXWA 5KK4A 1CHZA 4KBOA 1ZFUA 1I2VA 3GDQA 1WT7A 1NGCA 2LJMA 1JXCA 1ATRA 1VNAA 3KP0A 1T1TA 2E88A 1QQNA 1LQHA 4H5VA 1KAXA 1TI5A 2QWNA 3KP1A 3LDQA 2KHOA 5EX5A 1P00A 2KBKA 3HSCA 2YBRC 2ASCA 5AQKA 5AQVA 5AR0A 1NPIA 2KYQA 1NRAA 5EY4A 1GPSA 2D56A 2MBKA 5AQWA 1HX1A
chains in the Genus database with same CATH topology
1JZBA 1PTXA 1B7DA 2GL1A 1ICAA 2NY8X 2N69A 4AEIA 2N66A 2LY5A 1FH3A 2M8BB 2E0HA 4CQKA 2KSKA 1MYNA 1BK8A 1DJTA 1ZUTA 1AYJA 1GPTA 1C55A 1ZYVA 1BRZA 1LQQA 1L4VA 4V1DC 1ZYWA 1B3CA 2BRZA 1I2UA 2LKBA 1I6FA 1P0AA 1T7BA 1KV0A 4HE7A 1N4NA 1PE4A 1SN4A 1CN2A 1T7AA 2MZ0A 1I6GA 2YEOA 1DQ7A 1JKZA 4HHFA 2LI7A 1NRBA 2LJ7A 2B3CA 2ATBA 1SEGA 1ZVEA 3E7RL 2N2QA 2KBHA 1NE5A 2E3FA 1PX9A 1VNBA 1OZZA 4KYPA 2LR3A 4AB0A 1BMRA 1SNBA 2NY9X 1BCGA 2LY6A 5CY0A 2LT8A 4UJ0A 1LQIA 1T0ZA 1C56A 1WWNA 1AHOA 2A7TA 2KJAA 2KBJA 2I61A 1ZVGA 4AAZA 1ZU3A 1T7EA 2B68A 3PSMA 3E7UX 1OMYA 1SN1A 1NH5A 1WMTA 2KGQA 2N2RA 2SN3A 1JZAA 2E3GA 1MR4A 2YC1C 5KK4A 1CHZA 1I2VA 1ZFUA 1WT7A 2LJMA 1JXCA 1VNAA 1T1TA 1LQHA 1TI5A 1P00A 2KBKA 2YBRC 2ASCA 1GPSA 1NPIA 2KYQA 1NRAA 2KPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZB A;  1PTX A;  1B7D A;  2GL1 A;  1ICA A;  2NY8 X;  2N69 A;  4AEI A;  2N66 A;  2LY5 A;  1FH3 A;  2M8B B;  2E0H A;  4CQK A;  2KSK A;  1MYN A;  1BK8 A;  1DJT A;  1ZUT A;  1AYJ A;  1GPT A;  1C55 A;  1ZYV A;  1BRZ A;  1LQQ A;  1L4V A;  4V1D C;  1ZYW A;  1B3C A;  2BRZ A;  1I2U A;  2LKB A;  1I6F A;  1P0A A;  1T7B A;  1KV0 A;  4HE7 A;  1N4N A;  1PE4 A;  1SN4 A;  1CN2 A;  1T7A A;  2MZ0 A;  1I6G A;  2YEO A;  1DQ7 A;  1JKZ A;  4HHF A;  2LI7 A;  1NRB A;  2LJ7 A;  2B3C A;  2ATB A;  1SEG A;  1ZVE A;  3E7R L;  2N2Q A;  2KBH A;  1NE5 A;  2E3F A;  1PX9 A;  1VNB A;  1OZZ A;  4KYP A;  2LR3 A;  4AB0 A;  1BMR A;  1SNB A;  2NY9 X;  1BCG A;  2LY6 A;  5CY0 A;  2LT8 A;  4UJ0 A;  1LQI A;  1T0Z A;  1C56 A;  1WWN A;  1AHO A;  2A7T A;  2KJA A;  2KBJ A;  2I61 A;  1ZVG A;  4AAZ A;  1ZU3 A;  1T7E A;  2B68 A;  3PSM A;  3E7U X;  1OMY A;  1SN1 A;  1NH5 A;  1WMT A;  2KGQ A;  2N2R A;  2SN3 A;  1JZA A;  2E3G A;  1MR4 A;  2YC1 C;  5KK4 A;  1CHZ A;  1I2V A;  1ZFU A;  1WT7 A;  2LJM A;  1JXC A;  1VNA A;  1T1T A;  1LQH A;  1TI5 A;  1P00 A;  2KBK A;  2YBR C;  2ASC A;  1GPS A;  1NPI A;  2KYQ A;  1NRA A;  2KPY A; 
#chains in the Genus database with same CATH topology
 1JZB A;  1PTX A;  1B7D A;  5AQI A;  5AQQ A;  2GL1 A;  3KC6 A;  1ICA A;  3LDL A;  3ATU A;  2NY8 X;  5AQR A;  1NGA A;  5FPM A;  2N69 A;  4AEI A;  5AQG A;  2N66 A;  2LY5 A;  2YIL A;  1FH3 A;  3C7N A;  2M8B B;  2E0H A;  2KPY A;  2QWR A;  2KSK A;  5AQH A;  4CQK A;  2GMO A;  4GNI A;  1MYN A;  2V7Z A;  1BK8 A;  1DJT A;  4H5W A;  1ZUT A;  1AYJ A;  3A8Y A;  1QQM A;  3JXU A;  3GL1 A;  3R2V A;  5AQZ A;  3KOZ A;  1C55 A;  1ZYV A;  2QWM A;  1GPT A;  5AQX A;  1BRZ A;  4UAF E;  2K35 A;  1LQQ A;  4H5N A;  1L4V A;  1NGJ A;  5FPN A;  3IUC A;  3CW4 A;  3SF4 D;  2MN5 A;  4V1D C;  1ZYW A;  1POI A;  3FZF A;  5BN8 A;  2VY6 A;  3FZL A;  4UAE F;  1B3C A;  3C7N B;  2BRZ A;  2QWQ A;  2QW9 A;  1I2U A;  2LKB A;  1BA1 A;  4H5T A;  5BN9 A;  3ATV A;  1I6F A;  1P0A A;  1T7B A;  2E8A A;  2QWL A;  1KV0 A;  3KOY A;  4HE7 A;  5AQT A;  1N4N A;  1NGG A;  1KAZ A;  1PE4 A;  3D2E A;  1SN4 A;  1CN2 A;  1K8B A;  1T7A A;  2MZ0 A;  1I6G A;  2YEO A;  3LDN A;  5AQO A;  1DQ7 A;  1HJO A;  2LN8 A;  1NGI A;  2LI7 A;  1NGB A;  1NRB A;  1NGH A;  3CQX A;  3KHW A;  3QI7 A;  4HHF A;  2LJ7 A;  2B3C A;  5F0X A;  2ATB A;  5AQJ A;  4H5R A;  1SEG A;  1ZVE A;  1HPM A;  1UGL A;  3E7R L;  2N2Q A;  4IO8 A;  3LDO A;  1NGE A;  2KBH A;  5BPN A;  2E2F A;  1NE5 A;  3I33 A;  5F1X A;  3FZK A;  5AQU A;  2YIP A;  3L56 A;  3FE1 A;  1S3X A;  1DKG D;  3QFU A;  5FPD A;  5F2R A;  1JKZ A;  2E3F A;  1ATS A;  1XRS B;  3D2E B;  1PX9 A;  5BPM A;  5EVZ A;  1VNB A;  1OZZ A;  4KYP A;  2LR3 A;  4UAD E;  4FL9 A;  4AB0 A;  3GKU A;  3KVG A;  2BUP A;  1BMR A;  1SNB A;  2NY9 X;  2QWO A;  1BCG A;  3L6Q A;  2QXL A;  3QFP A;  2LY6 A;  5FPE A;  3D2F A;  5CY0 A;  2LT8 A;  1YUW A;  4UJ0 A;  3KOW A;  4FSV A;  1NGF A;  1LQI A;  3BK3 C;  2YIO A;  5AQY A;  5AQN A;  1T0Z A;  5AQF A;  5AQL A;  3FZH A;  1C56 A;  1QQO A;  1KAY A;  1WWN A;  1AHO A;  2QWP A;  5BPL A;  2A7T A;  3KOX A;  3LDP A;  3L4I A;  1NGD A;  2KJA A;  2KBJ A;  2I61 A;  1ZVG A;  4AAZ A;  3QML A;  1ZU3 A;  2G2K A;  5AQM A;  1T7E A;  2B68 A;  3PSM A;  2JDQ D;  3E7U X;  1OMY A;  1SN1 A;  5AQS A;  1NH5 A;  3M3Z A;  3D2F B;  1WMT A;  2KGQ A;  4HWI A;  1BA0 A;  2N2R A;  3FZM A;  1BUP A;  5AQP A;  2SN3 A;  1JZA A;  2E3G A;  3AY9 A;  1MR4 A;  2YC1 C;  5EXW A;  5KK4 A;  1CHZ A;  4KBO A;  1ZFU A;  1I2V A;  3GDQ A;  1WT7 A;  1NGC A;  2LJM A;  1JXC A;  1ATR A;  1VNA A;  3KP0 A;  1T1T A;  2E88 A;  1QQN A;  1LQH A;  4H5V A;  1KAX A;  1TI5 A;  2QWN A;  3KP1 A;  3LDQ A;  2KHO A;  5EX5 A;  1P00 A;  2KBK A;  3HSC A;  2YBR C;  2ASC A;  5AQK A;  5AQV A;  5AR0 A;  1NPI A;  2KYQ A;  1NRA A;  5EY4 A;  1GPS A;  2D56 A;  2MBK A;  5AQW A;  1HX1 A; 
#chains in the Genus database with same CATH homology
 1JZB A;  1PTX A;  1B7D A;  2GL1 A;  1ICA A;  2NY8 X;  2N69 A;  4AEI A;  2N66 A;  2LY5 A;  1FH3 A;  2M8B B;  2E0H A;  4CQK A;  2KSK A;  1MYN A;  1BK8 A;  1DJT A;  1ZUT A;  1AYJ A;  1GPT A;  1C55 A;  1ZYV A;  1BRZ A;  1LQQ A;  1L4V A;  4V1D C;  1ZYW A;  1B3C A;  2BRZ A;  1I2U A;  2LKB A;  1I6F A;  1P0A A;  1T7B A;  1KV0 A;  4HE7 A;  1N4N A;  1PE4 A;  1SN4 A;  1CN2 A;  1T7A A;  2MZ0 A;  1I6G A;  2YEO A;  1DQ7 A;  1JKZ A;  4HHF A;  2LI7 A;  1NRB A;  2LJ7 A;  2B3C A;  2ATB A;  1SEG A;  1ZVE A;  3E7R L;  2N2Q A;  2KBH A;  1NE5 A;  2E3F A;  1PX9 A;  1VNB A;  1OZZ A;  4KYP A;  2LR3 A;  4AB0 A;  1BMR A;  1SNB A;  2NY9 X;  1BCG A;  2LY6 A;  5CY0 A;  2LT8 A;  4UJ0 A;  1LQI A;  1T0Z A;  1C56 A;  1WWN A;  1AHO A;  2A7T A;  2KJA A;  2KBJ A;  2I61 A;  1ZVG A;  4AAZ A;  1ZU3 A;  1T7E A;  2B68 A;  3PSM A;  3E7U X;  1OMY A;  1SN1 A;  1NH5 A;  1WMT A;  2KGQ A;  2N2R A;  2SN3 A;  1JZA A;  2E3G A;  1MR4 A;  2YC1 C;  5KK4 A;  1CHZ A;  1I2V A;  1ZFU A;  1WT7 A;  2LJM A;  1JXC A;  1VNA A;  1T1T A;  1LQH A;  1TI5 A;  1P00 A;  2KBK A;  2YBR C;  2ASC A;  1GPS A;  1NPI A;  2KYQ A;  1NRA A;  2KPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...