1N4NA

Structure of the plant defensin phd1 from petunia hybrida
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
47
structure length
47
Chain Sequence
ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords floral defensin-like protein 1
publication title Structure of Petunia hybrida defensin 1, a novel plant defensin with five disulfide bonds
pubmed doi rcsb
molecule tags Plant protein
total genus 11
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1n4nA00
1ZVEA 1T0ZA 1P0AA 2LR3A 1ZU3A 1L4VA 1C55A 1C56A 2LJ7A 1ZFUA 2KPYA 1B3CA 1JXCA 1P00A 1ZVGA 1T7AA 1I6FA 2E3GA 2I61A 4AAZA 2B68A 1MYNA 2KYQA 1I6GA 4HHFA 3E7RL 1GPSA 2KBJA 1DJTA 1CN2A 1NH5A 1OMYA 2A7TA 2GL1A 3PSMA 1SNBA 1DQ7A 1ZYVA 2LI7A 2MZ0A 2N69A 2LY5A 1NE5A 1ZYWA 2NY9X 4AB0A 2ASCA 1BCGA 1NRAA 2SN3A 4UJ0A 1BRZA 1B7DA 1SN4A 2KSKA 1PTXA 1T1TA 2NY8X 2KBHA 4V1DC 1VNAA 4AEIA 1MR4A 2LJMA 2BRZA 2LY6A 1SN1A 1JZBA 2KGQA 1I2UA 4CQKA 1JKZA 1WWNA 1ICAA 1OZZA 1VNBA 1PE4A 1AHOA 1CHZA 1LQHA 1NPIA 1JZAA 1T7BA 4KYPA 1KV0A 1LQIA 4HE7A 1NRBA 1BMRA 2ATBA 1N4NA 2KJAA 3E7UX 2N2QA 1BK8A 1PX9A 2KBKA 1WMTA 5KK4A 2N66A 2B3CA 1AYJA 2YC1C 1LQQA 2YEOA 1SEGA 2LKBA 1TI5A 1WT7A 1GPTA 2YBRC 2E3FA 1I2VA 2LT8A 1T7EA 5CY0A 2N2RA 1FH3A 1ZUTA 2E0HA 2M8BB
chains in the Genus database with same CATH superfamily
1ZVEA 5AQRA 1T0ZA 1BA0A 1P0AA 2LR3A 1ZU3A 2QWLA 1L4VA 1C55A 1C56A 2LJ7A 3CW4A 1KAXA 5BPLA 1ZFUA 2KPYA 1B3CA 1JXCA 3FZLA 3QFUA 1NGHA 1S3XA 3D2EB 1P00A 5EX5A 2QWNA 2V7ZA 5F0XA 1ZVGA 5AQJA 5AQNA 5AQZA 5AQTA 3C7NA 3KP1A 4GNIA 5AQYA 2MN5A 5AQMA 1T7AA 2D56A 3KVGA 5AQSA 3QFPA 5AQQA 1I6FA 1ATRA 1BUPA 5AQVA 2E3GA 2I61A 3I33A 3SF4D 4AAZA 3C7NB 1K8BA 5EY4A 3KC6A 5F2RA 2B68A 1MYNA 2KYQA 5F1XA 1I6GA 1XRSB 1POIA 4HHFA 2QXLA 3E7RL 4FL9A 3LDLA 1GPSA 5AQLA 3FZKA 3KHWA 2KBJA 3L56A 1DJTA 2LN8A 5AQGA 5BPNA 2YIPA 3L6QA 5AQFA 2JDQD 1CN2A 1NH5A 1OMYA 1QQNA 2A7TA 2GL1A 3JXUA 3PSMA 3QMLA 1SNBA 3LDPA 3R2VA 1DQ7A 1QQOA 3FZFA 1ZYVA 2LI7A 2G2KA 3KOZA 2MZ0A 1BA1A 2N69A 2LY5A 4H5RA 4IO8A 5AQIA 5AQUA 1NE5A 1NGDA 5BN8A 1ZYWA 5AQKA 1NGBA 3LDOA 2NY9X 3AY9A 2ASCA 1BCGA 1NRAA 2SN3A 4UAFE 4AB0A 4UJ0A 1B7DA 1BRZA 3ATVA 1SN4A 2QW9A 2E88A 2KSKA 1PTXA 1T1TA 3D2FA 1YUWA 2KBHA 2NY8X 4HWIA 3KOYA 4V1DC 1VNAA 4AEIA 1MR4A 2LJMA 2BRZA 2LY6A 1SN1A 4FSVA 1JZBA 2GMOA 2KGQA 1I2UA 4CQKA 1NGGA 1KAYA 3BK3C 1WWNA 3FZMA 1JKZA 3D2FB 1OZZA 1ICAA 4H5NA 3HSCA 5FPDA 1VNBA 2K35A 1PE4A 2QWPA 3QI7A 1AHOA 3FZHA 1ATSA 1CHZA 1LQHA 1NPIA 2QWQA 2VY6A 3KOXA 5FPNA 3A8YA 5BPMA 1JZAA 1NGAA 2KHOA 3L4IA 1T7BA 4KYPA 1KV0A 1LQIA 1KAZA 3CQXA 5FPEA 4HE7A 3FE1A 1DKGD 5AQPA 3ATUA 5BN9A 1NRBA 1BMRA 3LDQA 2ATBA 2YIOA 4H5WA 4UADE 1N4NA 2KJAA 3E7UX 3LDNA 2N2QA 4KBOA 1BK8A 1PX9A 1NGCA 2KBKA 1WMTA 5AR0A 2YILA 1HJOA 5KK4A 1UGLA 4UAEF 4H5VA 5FPMA 2N66A 5EXWA 1NGFA 2B3CA 2QWMA 3GDQA 1AYJA 3M3ZA 2YC1C 1NGJA 1LQQA 2YEOA 3GL1A 1SEGA 2LKBA 1TI5A 4H5TA 1WT7A 2E2FA 2MBKA 5AQHA 5AQOA 5AQXA 5AQWA 5EVZA 1GPTA 2YBRC 2E3FA 1NGEA 2QWOA 2BUPA 2E8AA 1I2VA 3KP0A 2LT8A 1T7EA 3IUCA 1HX1A 3KOWA 3D2EA 5CY0A 2N2RA 1QQMA 2QWRA 1HPMA 1FH3A 1ZUTA 1NGIA 3GKUA 2E0HA 2M8BB
chains in the Genus database with same CATH topology
1ZVEA 1T0ZA 1P0AA 2LR3A 1ZU3A 1L4VA 1C55A 1C56A 2LJ7A 1ZFUA 2KPYA 1B3CA 1JXCA 1P00A 1ZVGA 1T7AA 1I6FA 2E3GA 2I61A 4AAZA 2B68A 1MYNA 2KYQA 1I6GA 4HHFA 3E7RL 1GPSA 2KBJA 1DJTA 1CN2A 1NH5A 1OMYA 2A7TA 2GL1A 3PSMA 1SNBA 1DQ7A 1ZYVA 2LI7A 2MZ0A 2N69A 2LY5A 1NE5A 1ZYWA 2NY9X 4AB0A 2ASCA 1BCGA 1NRAA 2SN3A 4UJ0A 1BRZA 1B7DA 1SN4A 2KSKA 1PTXA 1T1TA 2NY8X 2KBHA 4V1DC 1VNAA 4AEIA 1MR4A 2LJMA 2BRZA 2LY6A 1SN1A 1JZBA 2KGQA 1I2UA 4CQKA 1JKZA 1WWNA 1ICAA 1OZZA 1VNBA 1PE4A 1AHOA 1CHZA 1LQHA 1NPIA 1JZAA 1T7BA 4KYPA 1KV0A 1LQIA 4HE7A 1NRBA 1BMRA 2ATBA 1N4NA 2KJAA 3E7UX 2N2QA 1BK8A 1PX9A 2KBKA 1WMTA 5KK4A 2N66A 2B3CA 1AYJA 2YC1C 1LQQA 2YEOA 1SEGA 2LKBA 1TI5A 1WT7A 1GPTA 2YBRC 2E3FA 1I2VA 2LT8A 1T7EA 5CY0A 2N2RA 1FH3A 1ZUTA 2E0HA 2M8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVE A;  1T0Z A;  1P0A A;  2LR3 A;  1ZU3 A;  1L4V A;  1C55 A;  1C56 A;  2LJ7 A;  1ZFU A;  2KPY A;  1B3C A;  1JXC A;  1P00 A;  1ZVG A;  1T7A A;  1I6F A;  2E3G A;  2I61 A;  4AAZ A;  2B68 A;  1MYN A;  2KYQ A;  1I6G A;  4HHF A;  3E7R L;  1GPS A;  2KBJ A;  1DJT A;  1CN2 A;  1NH5 A;  1OMY A;  2A7T A;  2GL1 A;  3PSM A;  1SNB A;  1DQ7 A;  1ZYV A;  2LI7 A;  2MZ0 A;  2N69 A;  2LY5 A;  1NE5 A;  1ZYW A;  2NY9 X;  4AB0 A;  2ASC A;  1BCG A;  1NRA A;  2SN3 A;  4UJ0 A;  1BRZ A;  1B7D A;  1SN4 A;  2KSK A;  1PTX A;  1T1T A;  2NY8 X;  2KBH A;  4V1D C;  1VNA A;  4AEI A;  1MR4 A;  2LJM A;  2BRZ A;  2LY6 A;  1SN1 A;  1JZB A;  2KGQ A;  1I2U A;  4CQK A;  1JKZ A;  1WWN A;  1ICA A;  1OZZ A;  1VNB A;  1PE4 A;  1AHO A;  1CHZ A;  1LQH A;  1NPI A;  1JZA A;  1T7B A;  4KYP A;  1KV0 A;  1LQI A;  4HE7 A;  1NRB A;  1BMR A;  2ATB A;  1N4N A;  2KJA A;  3E7U X;  2N2Q A;  1BK8 A;  1PX9 A;  2KBK A;  1WMT A;  5KK4 A;  2N66 A;  2B3C A;  1AYJ A;  2YC1 C;  1LQQ A;  2YEO A;  1SEG A;  2LKB A;  1TI5 A;  1WT7 A;  1GPT A;  2YBR C;  2E3F A;  1I2V A;  2LT8 A;  1T7E A;  5CY0 A;  2N2R A;  1FH3 A;  1ZUT A;  2E0H A;  2M8B B; 
#chains in the Genus database with same CATH topology
 1ZVE A;  5AQR A;  1T0Z A;  1BA0 A;  1P0A A;  2LR3 A;  1ZU3 A;  2QWL A;  1L4V A;  1C55 A;  1C56 A;  2LJ7 A;  3CW4 A;  1KAX A;  5BPL A;  1ZFU A;  2KPY A;  1B3C A;  1JXC A;  3FZL A;  3QFU A;  1NGH A;  1S3X A;  3D2E B;  1P00 A;  5EX5 A;  2QWN A;  2V7Z A;  5F0X A;  1ZVG A;  5AQJ A;  5AQN A;  5AQZ A;  5AQT A;  3C7N A;  3KP1 A;  4GNI A;  5AQY A;  2MN5 A;  5AQM A;  1T7A A;  2D56 A;  3KVG A;  5AQS A;  3QFP A;  5AQQ A;  1I6F A;  1ATR A;  1BUP A;  5AQV A;  2E3G A;  2I61 A;  3I33 A;  3SF4 D;  4AAZ A;  3C7N B;  1K8B A;  5EY4 A;  3KC6 A;  5F2R A;  2B68 A;  1MYN A;  2KYQ A;  5F1X A;  1I6G A;  1XRS B;  1POI A;  4HHF A;  2QXL A;  3E7R L;  4FL9 A;  3LDL A;  1GPS A;  5AQL A;  3FZK A;  3KHW A;  2KBJ A;  3L56 A;  1DJT A;  2LN8 A;  5AQG A;  5BPN A;  2YIP A;  3L6Q A;  5AQF A;  2JDQ D;  1CN2 A;  1NH5 A;  1OMY A;  1QQN A;  2A7T A;  2GL1 A;  3JXU A;  3PSM A;  3QML A;  1SNB A;  3LDP A;  3R2V A;  1DQ7 A;  1QQO A;  3FZF A;  1ZYV A;  2LI7 A;  2G2K A;  3KOZ A;  2MZ0 A;  1BA1 A;  2N69 A;  2LY5 A;  4H5R A;  4IO8 A;  5AQI A;  5AQU A;  1NE5 A;  1NGD A;  5BN8 A;  1ZYW A;  5AQK A;  1NGB A;  3LDO A;  2NY9 X;  3AY9 A;  2ASC A;  1BCG A;  1NRA A;  2SN3 A;  4UAF E;  4AB0 A;  4UJ0 A;  1B7D A;  1BRZ A;  3ATV A;  1SN4 A;  2QW9 A;  2E88 A;  2KSK A;  1PTX A;  1T1T A;  3D2F A;  1YUW A;  2KBH A;  2NY8 X;  4HWI A;  3KOY A;  4V1D C;  1VNA A;  4AEI A;  1MR4 A;  2LJM A;  2BRZ A;  2LY6 A;  1SN1 A;  4FSV A;  1JZB A;  2GMO A;  2KGQ A;  1I2U A;  4CQK A;  1NGG A;  1KAY A;  3BK3 C;  1WWN A;  3FZM A;  1JKZ A;  3D2F B;  1OZZ A;  1ICA A;  4H5N A;  3HSC A;  5FPD A;  1VNB A;  2K35 A;  1PE4 A;  2QWP A;  3QI7 A;  1AHO A;  3FZH A;  1ATS A;  1CHZ A;  1LQH A;  1NPI A;  2QWQ A;  2VY6 A;  3KOX A;  5FPN A;  3A8Y A;  5BPM A;  1JZA A;  1NGA A;  2KHO A;  3L4I A;  1T7B A;  4KYP A;  1KV0 A;  1LQI A;  1KAZ A;  3CQX A;  5FPE A;  4HE7 A;  3FE1 A;  1DKG D;  5AQP A;  3ATU A;  5BN9 A;  1NRB A;  1BMR A;  3LDQ A;  2ATB A;  2YIO A;  4H5W A;  4UAD E;  1N4N A;  2KJA A;  3E7U X;  3LDN A;  2N2Q A;  4KBO A;  1BK8 A;  1PX9 A;  1NGC A;  2KBK A;  1WMT A;  5AR0 A;  2YIL A;  1HJO A;  5KK4 A;  1UGL A;  4UAE F;  4H5V A;  5FPM A;  2N66 A;  5EXW A;  1NGF A;  2B3C A;  2QWM A;  3GDQ A;  1AYJ A;  3M3Z A;  2YC1 C;  1NGJ A;  1LQQ A;  2YEO A;  3GL1 A;  1SEG A;  2LKB A;  1TI5 A;  4H5T A;  1WT7 A;  2E2F A;  2MBK A;  5AQH A;  5AQO A;  5AQX A;  5AQW A;  5EVZ A;  1GPT A;  2YBR C;  2E3F A;  1NGE A;  2QWO A;  2BUP A;  2E8A A;  1I2V A;  3KP0 A;  2LT8 A;  1T7E A;  3IUC A;  1HX1 A;  3KOW A;  3D2E A;  5CY0 A;  2N2R A;  1QQM A;  2QWR A;  1HPM A;  1FH3 A;  1ZUT A;  1NGI A;  3GKU A;  2E0H A;  2M8B B; 
#chains in the Genus database with same CATH homology
 1ZVE A;  1T0Z A;  1P0A A;  2LR3 A;  1ZU3 A;  1L4V A;  1C55 A;  1C56 A;  2LJ7 A;  1ZFU A;  2KPY A;  1B3C A;  1JXC A;  1P00 A;  1ZVG A;  1T7A A;  1I6F A;  2E3G A;  2I61 A;  4AAZ A;  2B68 A;  1MYN A;  2KYQ A;  1I6G A;  4HHF A;  3E7R L;  1GPS A;  2KBJ A;  1DJT A;  1CN2 A;  1NH5 A;  1OMY A;  2A7T A;  2GL1 A;  3PSM A;  1SNB A;  1DQ7 A;  1ZYV A;  2LI7 A;  2MZ0 A;  2N69 A;  2LY5 A;  1NE5 A;  1ZYW A;  2NY9 X;  4AB0 A;  2ASC A;  1BCG A;  1NRA A;  2SN3 A;  4UJ0 A;  1BRZ A;  1B7D A;  1SN4 A;  2KSK A;  1PTX A;  1T1T A;  2NY8 X;  2KBH A;  4V1D C;  1VNA A;  4AEI A;  1MR4 A;  2LJM A;  2BRZ A;  2LY6 A;  1SN1 A;  1JZB A;  2KGQ A;  1I2U A;  4CQK A;  1JKZ A;  1WWN A;  1ICA A;  1OZZ A;  1VNB A;  1PE4 A;  1AHO A;  1CHZ A;  1LQH A;  1NPI A;  1JZA A;  1T7B A;  4KYP A;  1KV0 A;  1LQI A;  4HE7 A;  1NRB A;  1BMR A;  2ATB A;  1N4N A;  2KJA A;  3E7U X;  2N2Q A;  1BK8 A;  1PX9 A;  2KBK A;  1WMT A;  5KK4 A;  2N66 A;  2B3C A;  1AYJ A;  2YC1 C;  1LQQ A;  2YEO A;  1SEG A;  2LKB A;  1TI5 A;  1WT7 A;  1GPT A;  2YBR C;  2E3F A;  1I2V A;  2LT8 A;  1T7E A;  5CY0 A;  2N2R A;  1FH3 A;  1ZUT A;  2E0H A;  2M8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...