1N4NA

Structure of the plant defensin phd1 from petunia hybrida
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
47
structure length
47
Chain Sequence
b'ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords floral defensin-like protein 1
publication title Structure of Petunia hybrida defensin 1, a novel plant defensin with five disulfide bonds
pubmed doi rcsb
molecule tags Plant protein
total genus 11
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1n4nA00
1I2UA 1PTXA 1VNBA 1I6FA 1PX9A 1BMRA 1ZYVA 2I61A 4UJ0A 2BRZA 2KJAA 1ZYWA 4HHFA 2N2QA 1NE5A 1AYJA 2YEOA 1T7EA 1AHOA 1C56A 1MR4A 5CY0A 4AB0A 2KGQA 2N2RA 1SN4A 1P00A 1JKZA 2KSKA 2NY8X 1DJTA 2N69A 2SN3A 2LI7A 2MZ0A 2KPYA 1T7AA 1WT7A 1ZUTA 2LY5A 1TI5A 1JZAA 1WWNA 1JXCA 1GPSA 2YBRC 2LY6A 1PE4A 2ASCA 1CN2A 2YC1C 2KYQA 1MYNA 1NH5A 2NY9X 4CQKA 2N66A 1SEGA 1JZBA 2KBKA 1WMTA 1CHZA 1T0ZA 2LKBA 1LQIA 2LJ7A 4V1DC 2B68A 1NRAA 4HE7A 5KK4A 1OMYA 2LJMA 1VNAA 1ZVGA 1ZFUA 1SN1A 1I6GA 2ATBA 1SNBA 1B7DA 1B3CA 1BK8A 2A7TA 1N4NA 4AEIA 2M8BB 1P0AA 2KBJA 3E7UX 1GPTA 1BRZA 4AAZA 1C55A 1OZZA 1ZVEA 1ZU3A 3PSMA 1DQ7A 1KV0A 2GL1A 2B3CA 2E3FA 1FH3A 1T7BA 1T1TA 1ICAA 1NRBA 1I2VA 1BCGA 2KBHA 1LQHA 2E3GA 3E7RL 2LR3A 1L4VA 4KYPA 2E0HA 1NPIA 2LT8A 1LQQA
chains in the Genus database with same CATH superfamily
3LDQA 5AQMA 5FPMA 1I2UA 1HPMA 1PTXA 2JDQD 1ATRA 3D2FB 1VNBA 5EY4A 1I6FA 1PX9A 3BK3C 1NGDA 5AQKA 1BMRA 1ZYVA 2I61A 2QWOA 4UJ0A 1NGHA 5F0XA 2BRZA 2KJAA 1ZYWA 3L6QA 3C7NB 2MN5A 3LDNA 2N2QA 4HHFA 5AQXA 1YUWA 1NE5A 2YIPA 5AQPA 1AYJA 2YEOA 4GNIA 2YILA 1T7EA 3KOYA 1NGIA 3KP0A 5AR0A 3FZHA 2QWRA 5AQHA 1AHOA 1HX1A 1C56A 2QWLA 1MR4A 1NGCA 3R2VA 5F2RA 1NGEA 3A8YA 1QQNA 5CY0A 4AB0A 2KGQA 2N2RA 1SN4A 3HSCA 1P00A 1NGAA 3SF4D 3GL1A 1XRSB 3ATVA 1JKZA 3C7NA 5AQIA 5AQTA 2KSKA 3QI7A 4KBOA 2NY8X 4UAFE 1DJTA 2N69A 2SN3A 2LI7A 3KP1A 2MZ0A 2KPYA 1T7AA 1UGLA 1WT7A 1ZUTA 2K35A 3GDQA 2LY5A 3CQXA 3FZMA 5EX5A 1TI5A 1ATSA 2QWPA 1JZAA 1WWNA 1JXCA 1GPSA 3L4IA 5F1XA 1QQMA 2YBRC 2LY6A 1DKGD 1PE4A 2ASCA 2QXLA 3FZLA 1BA0A 3LDPA 1CN2A 3FE1A 2QWMA 2YC1C 3CW4A 5FPNA 2KYQA 5BN9A 2MBKA 1MYNA 3JXUA 1NH5A 3D2FA 2KHOA 3KOWA 1KAXA 2NY9X 4CQKA 2QWNA 4H5TA 2N66A 1SEGA 4FSVA 1JZBA 2KBKA 1WMTA 3D2EB 3QMLA 5EXWA 5AQOA 1CHZA 1S3XA 1T0ZA 2LKBA 1K8BA 1LQIA 2LJ7A 3AY9A 2YIOA 5BPNA 4UAEF 2GMOA 2B68A 1NRAA 4V1DC 4UADE 4HE7A 5KK4A 1HJOA 1OMYA 3IUCA 1POIA 2G2KA 2LJMA 1VNAA 5BN8A 2D56A 1ZVGA 1ZFUA 3KVGA 3LDLA 1SN1A 3ATUA 3FZKA 4FL9A 3QFUA 3D2EA 1I6GA 1NGGA 2ATBA 2QWQA 3LDOA 1NGJA 1SNBA 1B7DA 5AQUA 1B3CA 1BK8A 2A7TA 1N4NA 4AEIA 3KOXA 2M8BB 1P0AA 2E8AA 2KBJA 3QFPA 5AQJA 5AQZA 3E7UX 4H5WA 5AQFA 5AQRA 2VY6A 5FPEA 3M3ZA 5AQYA 1BUPA 1GPTA 1KAZA 1BRZA 5AQLA 5BPLA 1NGBA 4H5RA 4AAZA 1C55A 1OZZA 1ZVEA 2E88A 5AQNA 1ZU3A 2BUPA 3KHWA 3I33A 3PSMA 1DQ7A 5AQSA 1KV0A 4H5VA 3GKUA 4IO8A 2GL1A 2B3CA 2E3FA 1FH3A 1T7BA 1T1TA 1ICAA 1NRBA 3KC6A 4HWIA 4H5NA 3KOZA 1I2VA 1BCGA 1QQOA 2KBHA 1LQHA 2E3GA 5AQGA 3E7RL 5FPDA 2LR3A 1L4VA 2QW9A 2E0HA 4KYPA 5AQVA 5AQWA 3FZFA 1NPIA 2LT8A 3L56A 5AQQA 2E2FA 5EVZA 1LQQA 1KAYA 1NGFA 5BPMA 1BA1A 2LN8A 2V7ZA
chains in the Genus database with same CATH topology
1I2UA 1PTXA 1VNBA 1I6FA 1PX9A 1BMRA 1ZYVA 2I61A 4UJ0A 2BRZA 2KJAA 1ZYWA 4HHFA 2N2QA 1NE5A 1AYJA 2YEOA 1T7EA 1AHOA 1C56A 1MR4A 5CY0A 4AB0A 2KGQA 2N2RA 1SN4A 1P00A 1JKZA 2KSKA 2NY8X 1DJTA 2N69A 2SN3A 2LI7A 2MZ0A 2KPYA 1T7AA 1WT7A 1ZUTA 2LY5A 1TI5A 1JZAA 1WWNA 1JXCA 1GPSA 2YBRC 2LY6A 1PE4A 2ASCA 1CN2A 2YC1C 2KYQA 1MYNA 1NH5A 2NY9X 4CQKA 2N66A 1SEGA 1JZBA 2KBKA 1WMTA 1CHZA 1T0ZA 2LKBA 1LQIA 2LJ7A 4V1DC 2B68A 1NRAA 4HE7A 5KK4A 1OMYA 2LJMA 1VNAA 1ZVGA 1ZFUA 1SN1A 1I6GA 2ATBA 1SNBA 1B7DA 1B3CA 1BK8A 2A7TA 1N4NA 4AEIA 2M8BB 1P0AA 2KBJA 3E7UX 1GPTA 1BRZA 4AAZA 1C55A 1OZZA 1ZVEA 1ZU3A 3PSMA 1DQ7A 1KV0A 2GL1A 2B3CA 2E3FA 1FH3A 1T7BA 1T1TA 1ICAA 1NRBA 1I2VA 1BCGA 2KBHA 1LQHA 2E3GA 3E7RL 2LR3A 1L4VA 4KYPA 2E0HA 1NPIA 2LT8A 1LQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2U A;  1PTX A;  1VNB A;  1I6F A;  1PX9 A;  1BMR A;  1ZYV A;  2I61 A;  4UJ0 A;  2BRZ A;  2KJA A;  1ZYW A;  4HHF A;  2N2Q A;  1NE5 A;  1AYJ A;  2YEO A;  1T7E A;  1AHO A;  1C56 A;  1MR4 A;  5CY0 A;  4AB0 A;  2KGQ A;  2N2R A;  1SN4 A;  1P00 A;  1JKZ A;  2KSK A;  2NY8 X;  1DJT A;  2N69 A;  2SN3 A;  2LI7 A;  2MZ0 A;  2KPY A;  1T7A A;  1WT7 A;  1ZUT A;  2LY5 A;  1TI5 A;  1JZA A;  1WWN A;  1JXC A;  1GPS A;  2YBR C;  2LY6 A;  1PE4 A;  2ASC A;  1CN2 A;  2YC1 C;  2KYQ A;  1MYN A;  1NH5 A;  2NY9 X;  4CQK A;  2N66 A;  1SEG A;  1JZB A;  2KBK A;  1WMT A;  1CHZ A;  1T0Z A;  2LKB A;  1LQI A;  2LJ7 A;  4V1D C;  2B68 A;  1NRA A;  4HE7 A;  5KK4 A;  1OMY A;  2LJM A;  1VNA A;  1ZVG A;  1ZFU A;  1SN1 A;  1I6G A;  2ATB A;  1SNB A;  1B7D A;  1B3C A;  1BK8 A;  2A7T A;  1N4N A;  4AEI A;  2M8B B;  1P0A A;  2KBJ A;  3E7U X;  1GPT A;  1BRZ A;  4AAZ A;  1C55 A;  1OZZ A;  1ZVE A;  1ZU3 A;  3PSM A;  1DQ7 A;  1KV0 A;  2GL1 A;  2B3C A;  2E3F A;  1FH3 A;  1T7B A;  1T1T A;  1ICA A;  1NRB A;  1I2V A;  1BCG A;  2KBH A;  1LQH A;  2E3G A;  3E7R L;  2LR3 A;  1L4V A;  4KYP A;  2E0H A;  1NPI A;  2LT8 A;  1LQQ A; 
#chains in the Genus database with same CATH topology
 3LDQ A;  5AQM A;  5FPM A;  1I2U A;  1HPM A;  1PTX A;  2JDQ D;  1ATR A;  3D2F B;  1VNB A;  5EY4 A;  1I6F A;  1PX9 A;  3BK3 C;  1NGD A;  5AQK A;  1BMR A;  1ZYV A;  2I61 A;  2QWO A;  4UJ0 A;  1NGH A;  5F0X A;  2BRZ A;  2KJA A;  1ZYW A;  3L6Q A;  3C7N B;  2MN5 A;  3LDN A;  2N2Q A;  4HHF A;  5AQX A;  1YUW A;  1NE5 A;  2YIP A;  5AQP A;  1AYJ A;  2YEO A;  4GNI A;  2YIL A;  1T7E A;  3KOY A;  1NGI A;  3KP0 A;  5AR0 A;  3FZH A;  2QWR A;  5AQH A;  1AHO A;  1HX1 A;  1C56 A;  2QWL A;  1MR4 A;  1NGC A;  3R2V A;  5F2R A;  1NGE A;  3A8Y A;  1QQN A;  5CY0 A;  4AB0 A;  2KGQ A;  2N2R A;  1SN4 A;  3HSC A;  1P00 A;  1NGA A;  3SF4 D;  3GL1 A;  1XRS B;  3ATV A;  1JKZ A;  3C7N A;  5AQI A;  5AQT A;  2KSK A;  3QI7 A;  4KBO A;  2NY8 X;  4UAF E;  1DJT A;  2N69 A;  2SN3 A;  2LI7 A;  3KP1 A;  2MZ0 A;  2KPY A;  1T7A A;  1UGL A;  1WT7 A;  1ZUT A;  2K35 A;  3GDQ A;  2LY5 A;  3CQX A;  3FZM A;  5EX5 A;  1TI5 A;  1ATS A;  2QWP A;  1JZA A;  1WWN A;  1JXC A;  1GPS A;  3L4I A;  5F1X A;  1QQM A;  2YBR C;  2LY6 A;  1DKG D;  1PE4 A;  2ASC A;  2QXL A;  3FZL A;  1BA0 A;  3LDP A;  1CN2 A;  3FE1 A;  2QWM A;  2YC1 C;  3CW4 A;  5FPN A;  2KYQ A;  5BN9 A;  2MBK A;  1MYN A;  3JXU A;  1NH5 A;  3D2F A;  2KHO A;  3KOW A;  1KAX A;  2NY9 X;  4CQK A;  2QWN A;  4H5T A;  2N66 A;  1SEG A;  4FSV A;  1JZB A;  2KBK A;  1WMT A;  3D2E B;  3QML A;  5EXW A;  5AQO A;  1CHZ A;  1S3X A;  1T0Z A;  2LKB A;  1K8B A;  1LQI A;  2LJ7 A;  3AY9 A;  2YIO A;  5BPN A;  4UAE F;  2GMO A;  2B68 A;  1NRA A;  4V1D C;  4UAD E;  4HE7 A;  5KK4 A;  1HJO A;  1OMY A;  3IUC A;  1POI A;  2G2K A;  2LJM A;  1VNA A;  5BN8 A;  2D56 A;  1ZVG A;  1ZFU A;  3KVG A;  3LDL A;  1SN1 A;  3ATU A;  3FZK A;  4FL9 A;  3QFU A;  3D2E A;  1I6G A;  1NGG A;  2ATB A;  2QWQ A;  3LDO A;  1NGJ A;  1SNB A;  1B7D A;  5AQU A;  1B3C A;  1BK8 A;  2A7T A;  1N4N A;  4AEI A;  3KOX A;  2M8B B;  1P0A A;  2E8A A;  2KBJ A;  3QFP A;  5AQJ A;  5AQZ A;  3E7U X;  4H5W A;  5AQF A;  5AQR A;  2VY6 A;  5FPE A;  3M3Z A;  5AQY A;  1BUP A;  1GPT A;  1KAZ A;  1BRZ A;  5AQL A;  5BPL A;  1NGB A;  4H5R A;  4AAZ A;  1C55 A;  1OZZ A;  1ZVE A;  2E88 A;  5AQN A;  1ZU3 A;  2BUP A;  3KHW A;  3I33 A;  3PSM A;  1DQ7 A;  5AQS A;  1KV0 A;  4H5V A;  3GKU A;  4IO8 A;  2GL1 A;  2B3C A;  2E3F A;  1FH3 A;  1T7B A;  1T1T A;  1ICA A;  1NRB A;  3KC6 A;  4HWI A;  4H5N A;  3KOZ A;  1I2V A;  1BCG A;  1QQO A;  2KBH A;  1LQH A;  2E3G A;  5AQG A;  3E7R L;  5FPD A;  2LR3 A;  1L4V A;  2QW9 A;  2E0H A;  4KYP A;  5AQV A;  5AQW A;  3FZF A;  1NPI A;  2LT8 A;  3L56 A;  5AQQ A;  2E2F A;  5EVZ A;  1LQQ A;  1KAY A;  1NGF A;  5BPM A;  1BA1 A;  2LN8 A;  2V7Z A; 
#chains in the Genus database with same CATH homology
 1I2U A;  1PTX A;  1VNB A;  1I6F A;  1PX9 A;  1BMR A;  1ZYV A;  2I61 A;  4UJ0 A;  2BRZ A;  2KJA A;  1ZYW A;  4HHF A;  2N2Q A;  1NE5 A;  1AYJ A;  2YEO A;  1T7E A;  1AHO A;  1C56 A;  1MR4 A;  5CY0 A;  4AB0 A;  2KGQ A;  2N2R A;  1SN4 A;  1P00 A;  1JKZ A;  2KSK A;  2NY8 X;  1DJT A;  2N69 A;  2SN3 A;  2LI7 A;  2MZ0 A;  2KPY A;  1T7A A;  1WT7 A;  1ZUT A;  2LY5 A;  1TI5 A;  1JZA A;  1WWN A;  1JXC A;  1GPS A;  2YBR C;  2LY6 A;  1PE4 A;  2ASC A;  1CN2 A;  2YC1 C;  2KYQ A;  1MYN A;  1NH5 A;  2NY9 X;  4CQK A;  2N66 A;  1SEG A;  1JZB A;  2KBK A;  1WMT A;  1CHZ A;  1T0Z A;  2LKB A;  1LQI A;  2LJ7 A;  4V1D C;  2B68 A;  1NRA A;  4HE7 A;  5KK4 A;  1OMY A;  2LJM A;  1VNA A;  1ZVG A;  1ZFU A;  1SN1 A;  1I6G A;  2ATB A;  1SNB A;  1B7D A;  1B3C A;  1BK8 A;  2A7T A;  1N4N A;  4AEI A;  2M8B B;  1P0A A;  2KBJ A;  3E7U X;  1GPT A;  1BRZ A;  4AAZ A;  1C55 A;  1OZZ A;  1ZVE A;  1ZU3 A;  3PSM A;  1DQ7 A;  1KV0 A;  2GL1 A;  2B3C A;  2E3F A;  1FH3 A;  1T7B A;  1T1T A;  1ICA A;  1NRB A;  1I2V A;  1BCG A;  2KBH A;  1LQH A;  2E3G A;  3E7R L;  2LR3 A;  1L4V A;  4KYP A;  2E0H A;  1NPI A;  2LT8 A;  1LQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...