4AEIA

Crystal structure of the aahii-fab4c1 complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-MAMMAL TOXIN AAH2
publication title Structural Insights Into Antibody Sequestering and Neutralizing of Na+-Channel & [Alpha]-Type Modulator from Old-World Scorpion Venom
pubmed doi rcsb
molecule tags Immune system/toxin
total genus 19
structure length 64
sequence length 64
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4aeiA00
1WWNA 2N2RA 1LQIA 1ZU3A 4AEIA 2ATBA 4V1DC 1CN2A 1AYJA 4AAZA 1FH3A 1T1TA 2N2QA 1MYNA 1I2UA 1NPIA 1JZAA 1P0AA 1C56A 1ZYVA 1N4NA 1DQ7A 1ICAA 2LKBA 1GPSA 2YEOA 2M8BB 1DJTA 1I6FA 2LJMA 2E0HA 1AHOA 2N66A 1ZVEA 1PX9A 1BMRA 1T0ZA 1CHZA 1ZUTA 1SN1A 2BRZA 1BRZA 1B3CA 2KBHA 4UJ0A 3E7UX 1NRAA 2B68A 2MZ0A 1BK8A 2ASCA 1LQHA 2LY6A 1GPTA 1SEGA 1NRBA 2I61A 2KBJA 1SN4A 2A7TA 1NH5A 1LQQA 2NY9X 1WT7A 2NY8X 1OMYA 1T7AA 1JXCA 1TI5A 1NE5A 2LY5A 2N69A 4CQKA 1I6GA 1ZFUA 2LI7A 3E7RL 1T7BA 4AB0A 2GL1A 2E3GA 4HHFA 2KJAA 2KSKA 1JZBA 1KV0A 2SN3A 1JKZA 1WMTA 1P00A 1PTXA 1ZVGA 1T7EA 1OZZA 1PE4A 2KGQA 4HE7A 1VNAA 1C55A 1ZYWA 2B3CA 1B7DA 5CY0A 2LR3A 2KYQA 1BCGA 2E3FA 2KPYA 5KK4A 1I2VA 2LT8A 1SNBA 2YBRC 3PSMA 2YC1C 2KBKA 1VNBA 1L4VA 4KYPA 2LJ7A 1MR4A
chains in the Genus database with same CATH superfamily
3ATVA 4KBOA 1WWNA 5AQOA 2N2RA 1LQIA 5FPDA 3C7NA 1ZU3A 5EX5A 4AEIA 2ATBA 1HX1A 1ATSA 4V1DC 1CN2A 1AYJA 3CW4A 4AAZA 4FL9A 3FZMA 1KAYA 4H5WA 5AQNA 5BPLA 1T1TA 1FH3A 2N2QA 1MYNA 1I2UA 3SF4D 1NPIA 4H5TA 1JZAA 2QWQA 1P0AA 1C56A 1ZYVA 3D2EA 3KOZA 3QMLA 1N4NA 1NGCA 4H5VA 1DQ7A 3JXUA 5AQJA 1ICAA 2LKBA 2LN8A 5AQLA 1GPSA 3L4IA 2YEOA 5BPMA 4FSVA 2M8BB 2G2KA 3FZLA 1DJTA 1POIA 1I6FA 1NGEA 2GMOA 1XRSB 3FZHA 5AQMA 2LJMA 2E0HA 1AHOA 5AQQA 3A8YA 2N66A 3C7NB 2VY6A 1ZVEA 5AQZA 5AQUA 3LDOA 5AQPA 5AQKA 3KC6A 5AQTA 5AQRA 1PX9A 1BMRA 1KAXA 1CHZA 1KAZA 1T0ZA 1HPMA 1ZUTA 3CQXA 5F2RA 1SN1A 2BRZA 2YIOA 1BRZA 1B3CA 5FPMA 4H5NA 2QWMA 2KBHA 2E88A 5AQHA 3E7UX 4UJ0A 3QFUA 1NRAA 2B68A 3D2EB 3KHWA 3L56A 1I6GA 2E2FA 2MZ0A 1BK8A 2ASCA 1LQHA 2LY6A 5AQGA 5BPNA 1GPTA 1K8BA 3KP1A 1SEGA 1NRBA 2I61A 2KBJA 1SN4A 3KOXA 3GDQA 2A7TA 1NGAA 1NH5A 1NGIA 4UAEF 5AQSA 1LQQA 3ATUA 2E8AA 5AR0A 2NY9X 1WT7A 2NY8X 5EVZA 2MBKA 5FPNA 5AQWA 4HWIA 1OMYA 5AQYA 1ATRA 1BA1A 1JXCA 1T7AA 1TI5A 2V7ZA 1NE5A 2LY5A 2N69A 5BN9A 4CQKA 4UADE 2K35A 1ZFUA 1NGHA 1NGBA 3KP0A 2BUPA 2LI7A 3E7RL 3KOWA 3QI7A 5F0XA 1NGJA 2QWNA 3D2FA 1T7BA 5AQVA 2QWLA 5EY4A 4AB0A 2GL1A 2E3GA 3M3ZA 4HHFA 2KJAA 2KSKA 1JZBA 1KV0A 2SN3A 4GNIA 2QWOA 2YILA 4UAFE 5F1XA 1JKZA 3GKUA 1WMTA 3I33A 3FE1A 1HJOA 3L6QA 1P00A 1PTXA 1ZVGA 4IO8A 2JDQD 1T7EA 3GL1A 5AQFA 3KVGA 1OZZA 1UGLA 1S3XA 3LDNA 1PE4A 2KGQA 3KOYA 4HE7A 1VNAA 1NGFA 2QWRA 5AQIA 1C55A 1QQOA 2MN5A 3R2VA 2QXLA 3IUCA 1ZYWA 2B3CA 1B7DA 5CY0A 1YUWA 5FPEA 3LDLA 5EXWA 1BA0A 2KYQA 2LR3A 2KHOA 3BK3C 1BCGA 2E3FA 2QWPA 3HSCA 2KPYA 4H5RA 5KK4A 1I2VA 2LT8A 5AQXA 2YIPA 3AY9A 1NGGA 3D2FB 1SNBA 3LDPA 2YBRC 3FZFA 5BN8A 3PSMA 1QQMA 2YC1C 2KBKA 1DKGD 1VNBA 1L4VA 4KYPA 3FZKA 2QW9A 3QFPA 2LJ7A 1MR4A 1QQNA 1NGDA 3LDQA 2D56A 1BUPA
chains in the Genus database with same CATH topology
1WWNA 2N2RA 1LQIA 1ZU3A 4AEIA 2ATBA 4V1DC 1CN2A 1AYJA 4AAZA 1FH3A 1T1TA 2N2QA 1MYNA 1I2UA 1NPIA 1JZAA 1P0AA 1C56A 1ZYVA 1N4NA 1DQ7A 1ICAA 2LKBA 1GPSA 2YEOA 2M8BB 1DJTA 1I6FA 2LJMA 2E0HA 1AHOA 2N66A 1ZVEA 1PX9A 1BMRA 1T0ZA 1CHZA 1ZUTA 1SN1A 2BRZA 1BRZA 1B3CA 2KBHA 4UJ0A 3E7UX 1NRAA 2B68A 2MZ0A 1BK8A 2ASCA 1LQHA 2LY6A 1GPTA 1SEGA 1NRBA 2I61A 2KBJA 1SN4A 2A7TA 1NH5A 1LQQA 2NY9X 1WT7A 2NY8X 1OMYA 1T7AA 1JXCA 1TI5A 1NE5A 2LY5A 2N69A 4CQKA 1I6GA 1ZFUA 2LI7A 3E7RL 1T7BA 4AB0A 2GL1A 2E3GA 4HHFA 2KJAA 2KSKA 1JZBA 1KV0A 2SN3A 1JKZA 1WMTA 1P00A 1PTXA 1ZVGA 1T7EA 1OZZA 1PE4A 2KGQA 4HE7A 1VNAA 1C55A 1ZYWA 2B3CA 1B7DA 5CY0A 2LR3A 2KYQA 1BCGA 2E3FA 2KPYA 5KK4A 1I2VA 2LT8A 1SNBA 2YBRC 3PSMA 2YC1C 2KBKA 1VNBA 1L4VA 4KYPA 2LJ7A 1MR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWN A;  2N2R A;  1LQI A;  1ZU3 A;  4AEI A;  2ATB A;  4V1D C;  1CN2 A;  1AYJ A;  4AAZ A;  1FH3 A;  1T1T A;  2N2Q A;  1MYN A;  1I2U A;  1NPI A;  1JZA A;  1P0A A;  1C56 A;  1ZYV A;  1N4N A;  1DQ7 A;  1ICA A;  2LKB A;  1GPS A;  2YEO A;  2M8B B;  1DJT A;  1I6F A;  2LJM A;  2E0H A;  1AHO A;  2N66 A;  1ZVE A;  1PX9 A;  1BMR A;  1T0Z A;  1CHZ A;  1ZUT A;  1SN1 A;  2BRZ A;  1BRZ A;  1B3C A;  2KBH A;  4UJ0 A;  3E7U X;  1NRA A;  2B68 A;  2MZ0 A;  1BK8 A;  2ASC A;  1LQH A;  2LY6 A;  1GPT A;  1SEG A;  1NRB A;  2I61 A;  2KBJ A;  1SN4 A;  2A7T A;  1NH5 A;  1LQQ A;  2NY9 X;  1WT7 A;  2NY8 X;  1OMY A;  1T7A A;  1JXC A;  1TI5 A;  1NE5 A;  2LY5 A;  2N69 A;  4CQK A;  1I6G A;  1ZFU A;  2LI7 A;  3E7R L;  1T7B A;  4AB0 A;  2GL1 A;  2E3G A;  4HHF A;  2KJA A;  2KSK A;  1JZB A;  1KV0 A;  2SN3 A;  1JKZ A;  1WMT A;  1P00 A;  1PTX A;  1ZVG A;  1T7E A;  1OZZ A;  1PE4 A;  2KGQ A;  4HE7 A;  1VNA A;  1C55 A;  1ZYW A;  2B3C A;  1B7D A;  5CY0 A;  2LR3 A;  2KYQ A;  1BCG A;  2E3F A;  2KPY A;  5KK4 A;  1I2V A;  2LT8 A;  1SNB A;  2YBR C;  3PSM A;  2YC1 C;  2KBK A;  1VNB A;  1L4V A;  4KYP A;  2LJ7 A;  1MR4 A; 
#chains in the Genus database with same CATH topology
 3ATV A;  4KBO A;  1WWN A;  5AQO A;  2N2R A;  1LQI A;  5FPD A;  3C7N A;  1ZU3 A;  5EX5 A;  4AEI A;  2ATB A;  1HX1 A;  1ATS A;  4V1D C;  1CN2 A;  1AYJ A;  3CW4 A;  4AAZ A;  4FL9 A;  3FZM A;  1KAY A;  4H5W A;  5AQN A;  5BPL A;  1T1T A;  1FH3 A;  2N2Q A;  1MYN A;  1I2U A;  3SF4 D;  1NPI A;  4H5T A;  1JZA A;  2QWQ A;  1P0A A;  1C56 A;  1ZYV A;  3D2E A;  3KOZ A;  3QML A;  1N4N A;  1NGC A;  4H5V A;  1DQ7 A;  3JXU A;  5AQJ A;  1ICA A;  2LKB A;  2LN8 A;  5AQL A;  1GPS A;  3L4I A;  2YEO A;  5BPM A;  4FSV A;  2M8B B;  2G2K A;  3FZL A;  1DJT A;  1POI A;  1I6F A;  1NGE A;  2GMO A;  1XRS B;  3FZH A;  5AQM A;  2LJM A;  2E0H A;  1AHO A;  5AQQ A;  3A8Y A;  2N66 A;  3C7N B;  2VY6 A;  1ZVE A;  5AQZ A;  5AQU A;  3LDO A;  5AQP A;  5AQK A;  3KC6 A;  5AQT A;  5AQR A;  1PX9 A;  1BMR A;  1KAX A;  1CHZ A;  1KAZ A;  1T0Z A;  1HPM A;  1ZUT A;  3CQX A;  5F2R A;  1SN1 A;  2BRZ A;  2YIO A;  1BRZ A;  1B3C A;  5FPM A;  4H5N A;  2QWM A;  2KBH A;  2E88 A;  5AQH A;  3E7U X;  4UJ0 A;  3QFU A;  1NRA A;  2B68 A;  3D2E B;  3KHW A;  3L56 A;  1I6G A;  2E2F A;  2MZ0 A;  1BK8 A;  2ASC A;  1LQH A;  2LY6 A;  5AQG A;  5BPN A;  1GPT A;  1K8B A;  3KP1 A;  1SEG A;  1NRB A;  2I61 A;  2KBJ A;  1SN4 A;  3KOX A;  3GDQ A;  2A7T A;  1NGA A;  1NH5 A;  1NGI A;  4UAE F;  5AQS A;  1LQQ A;  3ATU A;  2E8A A;  5AR0 A;  2NY9 X;  1WT7 A;  2NY8 X;  5EVZ A;  2MBK A;  5FPN A;  5AQW A;  4HWI A;  1OMY A;  5AQY A;  1ATR A;  1BA1 A;  1JXC A;  1T7A A;  1TI5 A;  2V7Z A;  1NE5 A;  2LY5 A;  2N69 A;  5BN9 A;  4CQK A;  4UAD E;  2K35 A;  1ZFU A;  1NGH A;  1NGB A;  3KP0 A;  2BUP A;  2LI7 A;  3E7R L;  3KOW A;  3QI7 A;  5F0X A;  1NGJ A;  2QWN A;  3D2F A;  1T7B A;  5AQV A;  2QWL A;  5EY4 A;  4AB0 A;  2GL1 A;  2E3G A;  3M3Z A;  4HHF A;  2KJA A;  2KSK A;  1JZB A;  1KV0 A;  2SN3 A;  4GNI A;  2QWO A;  2YIL A;  4UAF E;  5F1X A;  1JKZ A;  3GKU A;  1WMT A;  3I33 A;  3FE1 A;  1HJO A;  3L6Q A;  1P00 A;  1PTX A;  1ZVG A;  4IO8 A;  2JDQ D;  1T7E A;  3GL1 A;  5AQF A;  3KVG A;  1OZZ A;  1UGL A;  1S3X A;  3LDN A;  1PE4 A;  2KGQ A;  3KOY A;  4HE7 A;  1VNA A;  1NGF A;  2QWR A;  5AQI A;  1C55 A;  1QQO A;  2MN5 A;  3R2V A;  2QXL A;  3IUC A;  1ZYW A;  2B3C A;  1B7D A;  5CY0 A;  1YUW A;  5FPE A;  3LDL A;  5EXW A;  1BA0 A;  2KYQ A;  2LR3 A;  2KHO A;  3BK3 C;  1BCG A;  2E3F A;  2QWP A;  3HSC A;  2KPY A;  4H5R A;  5KK4 A;  1I2V A;  2LT8 A;  5AQX A;  2YIP A;  3AY9 A;  1NGG A;  3D2F B;  1SNB A;  3LDP A;  2YBR C;  3FZF A;  5BN8 A;  3PSM A;  1QQM A;  2YC1 C;  2KBK A;  1DKG D;  1VNB A;  1L4V A;  4KYP A;  3FZK A;  2QW9 A;  3QFP A;  2LJ7 A;  1MR4 A;  1QQN A;  1NGD A;  3LDQ A;  2D56 A;  1BUP A; 
#chains in the Genus database with same CATH homology
 1WWN A;  2N2R A;  1LQI A;  1ZU3 A;  4AEI A;  2ATB A;  4V1D C;  1CN2 A;  1AYJ A;  4AAZ A;  1FH3 A;  1T1T A;  2N2Q A;  1MYN A;  1I2U A;  1NPI A;  1JZA A;  1P0A A;  1C56 A;  1ZYV A;  1N4N A;  1DQ7 A;  1ICA A;  2LKB A;  1GPS A;  2YEO A;  2M8B B;  1DJT A;  1I6F A;  2LJM A;  2E0H A;  1AHO A;  2N66 A;  1ZVE A;  1PX9 A;  1BMR A;  1T0Z A;  1CHZ A;  1ZUT A;  1SN1 A;  2BRZ A;  1BRZ A;  1B3C A;  2KBH A;  4UJ0 A;  3E7U X;  1NRA A;  2B68 A;  2MZ0 A;  1BK8 A;  2ASC A;  1LQH A;  2LY6 A;  1GPT A;  1SEG A;  1NRB A;  2I61 A;  2KBJ A;  1SN4 A;  2A7T A;  1NH5 A;  1LQQ A;  2NY9 X;  1WT7 A;  2NY8 X;  1OMY A;  1T7A A;  1JXC A;  1TI5 A;  1NE5 A;  2LY5 A;  2N69 A;  4CQK A;  1I6G A;  1ZFU A;  2LI7 A;  3E7R L;  1T7B A;  4AB0 A;  2GL1 A;  2E3G A;  4HHF A;  2KJA A;  2KSK A;  1JZB A;  1KV0 A;  2SN3 A;  1JKZ A;  1WMT A;  1P00 A;  1PTX A;  1ZVG A;  1T7E A;  1OZZ A;  1PE4 A;  2KGQ A;  4HE7 A;  1VNA A;  1C55 A;  1ZYW A;  2B3C A;  1B7D A;  5CY0 A;  2LR3 A;  2KYQ A;  1BCG A;  2E3F A;  2KPY A;  5KK4 A;  1I2V A;  2LT8 A;  1SNB A;  2YBR C;  3PSM A;  2YC1 C;  2KBK A;  1VNB A;  1L4V A;  4KYP A;  2LJ7 A;  1MR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...