1NH5A

Automatic assignment of nmr data and determination of the protein structure of a new world scorpion neurotoxin using noah/diamod
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
b'KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin 5
publication title Automatic assignment of NOESY Cross peaks and determination of the protein structure of a new world scorpion neurotoxin Using NOAH/DIAMOD
pubmed doi rcsb
molecule tags Toxin
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1nh5A00
2E3GA 2I61A 1P00A 5CY0A 1I6FA 3E7RL 1LQQA 2ASCA 1C56A 1WWNA 2N66A 2LJ7A 1KV0A 2LI7A 2SN3A 4V1DC 1ZU3A 1T7EA 1AHOA 1BCGA 1GPTA 2YEOA 2LJMA 1P0AA 2KYQA 1OZZA 1CHZA 4AB0A 2YC1C 2LY5A 2NY9X 1OMYA 5KK4A 2N2QA 2KBKA 1I6GA 1ZVGA 2LKBA 1DJTA 1LQHA 1ICAA 1SN1A 1ZYWA 2MZ0A 1WT7A 2ATBA 1T1TA 1B7DA 1SEGA 1T0ZA 1I2UA 2N69A 2B68A 4HE7A 1JZAA 1T7AA 4AEIA 1ZFUA 2YBRC 4AAZA 2M8BB 1AYJA 1N4NA 1SNBA 2KBJA 1ZYVA 2A7TA 1BRZA 2N2RA 2LY6A 1SN4A 1BK8A 2E0HA 1NPIA 1DQ7A 1PTXA 1MR4A 1ZVEA 3PSMA 2E3FA 1JXCA 4HHFA 3E7UX 2KJAA 1FH3A 1LQIA 1L4VA 4UJ0A 2BRZA 1GPSA 1WMTA 1VNBA 1PX9A 1JZBA 1MYNA 2B3CA 2KPYA 1NH5A 1T7BA 2KGQA 1I2VA 1PE4A 1JKZA 1VNAA 4CQKA 1NE5A 2NY8X 2GL1A 1BMRA 2LT8A 1CN2A 1NRAA 4KYPA 1ZUTA 1B3CA 1NRBA 2KSKA 2LR3A 1C55A 2KBHA 1TI5A
chains in the Genus database with same CATH superfamily
2E3GA 2I61A 5F1XA 1QQMA 3FE1A 3KOWA 1P00A 5CY0A 1I6FA 2YILA 3FZLA 5FPNA 3E7RL 1DKGD 5BPLA 1LQQA 5BN9A 2ASCA 5AQUA 1C56A 1HX1A 2JDQD 1WWNA 1NGGA 2YIPA 4FL9A 1QQNA 1XRSB 2N66A 1NGFA 5AQIA 2LJ7A 4H5WA 1KV0A 1ATSA 4H5TA 2LI7A 2SN3A 4V1DC 3HSCA 3LDOA 1ZU3A 1T7EA 1AHOA 1NGDA 3ATUA 5FPMA 1BCGA 1GPTA 3I33A 3KVGA 5EY4A 3QFPA 2YEOA 2LJMA 2E88A 5AQOA 1P0AA 5AQVA 2KYQA 1OZZA 1CHZA 5AQWA 3GL1A 4AB0A 2YC1C 5FPDA 2QWOA 2LY5A 2NY9X 3JXUA 1BA1A 5AQGA 1OMYA 5KK4A 2V7ZA 1K8BA 1POIA 3KHWA 2N2QA 2KBKA 5AR0A 4UAEF 3KOZA 1ZVGA 2LKBA 1DJTA 3LDQA 1LQHA 4H5RA 1SN1A 1I6GA 5AQJA 4UADE 5AQRA 3QFUA 1ICAA 3D2EB 1ZYWA 5AQFA 2MZ0A 3CQXA 1WT7A 3FZKA 2QWLA 3KOXA 2ATBA 1T1TA 1B7DA 1SEGA 3LDNA 1KAZA 1S3XA 4GNIA 2G2KA 3L6QA 2QXLA 1T0ZA 1I2UA 2N69A 2B68A 3AY9A 4HE7A 3C7NA 1JZAA 5F2RA 1T7AA 5EXWA 4KBOA 5AQHA 4AEIA 5AQNA 3M3ZA 3L4IA 3LDPA 3A8YA 3D2FB 1ZFUA 4H5VA 4UAFE 2YBRC 4FSVA 3GDQA 3D2EA 4AAZA 2QWPA 5AQZA 2M8BB 5AQTA 1NGHA 1AYJA 4IO8A 1N4NA 1SNBA 2KBJA 1ZYVA 2A7TA 2LN8A 5BN8A 2VY6A 1BRZA 2N2RA 1QQOA 1YUWA 2LY6A 3KP1A 1NGEA 1SN4A 2E0HA 1BK8A 5AQKA 3FZMA 2YIOA 1HPMA 1NGBA 1NPIA 1DQ7A 1PTXA 1MR4A 2E2FA 1ZVEA 3QI7A 1UGLA 3PSMA 4HWIA 2E3FA 1JXCA 2QWQA 3LDLA 2D56A 4HHFA 3E7UX 2KJAA 1FH3A 2QW9A 1KAXA 3IUCA 3KC6A 3D2FA 1NGIA 1NGAA 1LQIA 2K35A 1L4VA 4UJ0A 5AQQA 4H5NA 2BRZA 2MN5A 3FZHA 1GPSA 3FZFA 5AQSA 1WMTA 1BA0A 1VNBA 3C7NB 1PX9A 1JZBA 1MYNA 3BK3C 2QWRA 2B3CA 3L56A 3QMLA 5EVZA 2KPYA 1NH5A 1T7BA 5AQLA 3GKUA 5FPEA 3KOYA 2KGQA 1I2VA 2E8AA 5BPMA 1PE4A 1JKZA 1VNAA 2KHOA 4CQKA 5EX5A 1NE5A 2NY8X 2GL1A 5AQXA 3ATVA 1BMRA 5AQPA 1NGJA 2LT8A 5AQMA 1CN2A 1KAYA 1HJOA 1NRAA 4KYPA 1ZUTA 5AQYA 1NRBA 1ATRA 1B3CA 2KSKA 5F0XA 2LR3A 2BUPA 1C55A 3SF4D 2KBHA 3KP0A 2GMOA 2MBKA 1TI5A 2QWNA 2QWMA 3R2VA 3CW4A 1NGCA 1BUPA 5BPNA
chains in the Genus database with same CATH topology
2E3GA 2I61A 1P00A 5CY0A 1I6FA 3E7RL 1LQQA 2ASCA 1C56A 1WWNA 2N66A 2LJ7A 1KV0A 2LI7A 2SN3A 4V1DC 1ZU3A 1T7EA 1AHOA 1BCGA 1GPTA 2YEOA 2LJMA 1P0AA 2KYQA 1OZZA 1CHZA 4AB0A 2YC1C 2LY5A 2NY9X 1OMYA 5KK4A 2N2QA 2KBKA 1I6GA 1ZVGA 2LKBA 1DJTA 1LQHA 1ICAA 1SN1A 1ZYWA 2MZ0A 1WT7A 2ATBA 1T1TA 1B7DA 1SEGA 1T0ZA 1I2UA 2N69A 2B68A 4HE7A 1JZAA 1T7AA 4AEIA 1ZFUA 2YBRC 4AAZA 2M8BB 1AYJA 1N4NA 1SNBA 2KBJA 1ZYVA 2A7TA 1BRZA 2N2RA 2LY6A 1SN4A 1BK8A 2E0HA 1NPIA 1DQ7A 1PTXA 1MR4A 1ZVEA 3PSMA 2E3FA 1JXCA 4HHFA 3E7UX 2KJAA 1FH3A 1LQIA 1L4VA 4UJ0A 2BRZA 1GPSA 1WMTA 1VNBA 1PX9A 1JZBA 1MYNA 2B3CA 2KPYA 1NH5A 1T7BA 2KGQA 1I2VA 1PE4A 1JKZA 1VNAA 4CQKA 1NE5A 2NY8X 2GL1A 1BMRA 2LT8A 1CN2A 1NRAA 4KYPA 1ZUTA 1B3CA 1NRBA 2KSKA 2LR3A 1C55A 2KBHA 1TI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3G A;  2I61 A;  1P00 A;  5CY0 A;  1I6F A;  3E7R L;  1LQQ A;  2ASC A;  1C56 A;  1WWN A;  2N66 A;  2LJ7 A;  1KV0 A;  2LI7 A;  2SN3 A;  4V1D C;  1ZU3 A;  1T7E A;  1AHO A;  1BCG A;  1GPT A;  2YEO A;  2LJM A;  1P0A A;  2KYQ A;  1OZZ A;  1CHZ A;  4AB0 A;  2YC1 C;  2LY5 A;  2NY9 X;  1OMY A;  5KK4 A;  2N2Q A;  2KBK A;  1I6G A;  1ZVG A;  2LKB A;  1DJT A;  1LQH A;  1ICA A;  1SN1 A;  1ZYW A;  2MZ0 A;  1WT7 A;  2ATB A;  1T1T A;  1B7D A;  1SEG A;  1T0Z A;  1I2U A;  2N69 A;  2B68 A;  4HE7 A;  1JZA A;  1T7A A;  4AEI A;  1ZFU A;  2YBR C;  4AAZ A;  2M8B B;  1AYJ A;  1N4N A;  1SNB A;  2KBJ A;  1ZYV A;  2A7T A;  1BRZ A;  2N2R A;  2LY6 A;  1SN4 A;  1BK8 A;  2E0H A;  1NPI A;  1DQ7 A;  1PTX A;  1MR4 A;  1ZVE A;  3PSM A;  2E3F A;  1JXC A;  4HHF A;  3E7U X;  2KJA A;  1FH3 A;  1LQI A;  1L4V A;  4UJ0 A;  2BRZ A;  1GPS A;  1WMT A;  1VNB A;  1PX9 A;  1JZB A;  1MYN A;  2B3C A;  2KPY A;  1NH5 A;  1T7B A;  2KGQ A;  1I2V A;  1PE4 A;  1JKZ A;  1VNA A;  4CQK A;  1NE5 A;  2NY8 X;  2GL1 A;  1BMR A;  2LT8 A;  1CN2 A;  1NRA A;  4KYP A;  1ZUT A;  1B3C A;  1NRB A;  2KSK A;  2LR3 A;  1C55 A;  2KBH A;  1TI5 A; 
#chains in the Genus database with same CATH topology
 2E3G A;  2I61 A;  5F1X A;  1QQM A;  3FE1 A;  3KOW A;  1P00 A;  5CY0 A;  1I6F A;  2YIL A;  3FZL A;  5FPN A;  3E7R L;  1DKG D;  5BPL A;  1LQQ A;  5BN9 A;  2ASC A;  5AQU A;  1C56 A;  1HX1 A;  2JDQ D;  1WWN A;  1NGG A;  2YIP A;  4FL9 A;  1QQN A;  1XRS B;  2N66 A;  1NGF A;  5AQI A;  2LJ7 A;  4H5W A;  1KV0 A;  1ATS A;  4H5T A;  2LI7 A;  2SN3 A;  4V1D C;  3HSC A;  3LDO A;  1ZU3 A;  1T7E A;  1AHO A;  1NGD A;  3ATU A;  5FPM A;  1BCG A;  1GPT A;  3I33 A;  3KVG A;  5EY4 A;  3QFP A;  2YEO A;  2LJM A;  2E88 A;  5AQO A;  1P0A A;  5AQV A;  2KYQ A;  1OZZ A;  1CHZ A;  5AQW A;  3GL1 A;  4AB0 A;  2YC1 C;  5FPD A;  2QWO A;  2LY5 A;  2NY9 X;  3JXU A;  1BA1 A;  5AQG A;  1OMY A;  5KK4 A;  2V7Z A;  1K8B A;  1POI A;  3KHW A;  2N2Q A;  2KBK A;  5AR0 A;  4UAE F;  3KOZ A;  1ZVG A;  2LKB A;  1DJT A;  3LDQ A;  1LQH A;  4H5R A;  1SN1 A;  1I6G A;  5AQJ A;  4UAD E;  5AQR A;  3QFU A;  1ICA A;  3D2E B;  1ZYW A;  5AQF A;  2MZ0 A;  3CQX A;  1WT7 A;  3FZK A;  2QWL A;  3KOX A;  2ATB A;  1T1T A;  1B7D A;  1SEG A;  3LDN A;  1KAZ A;  1S3X A;  4GNI A;  2G2K A;  3L6Q A;  2QXL A;  1T0Z A;  1I2U A;  2N69 A;  2B68 A;  3AY9 A;  4HE7 A;  3C7N A;  1JZA A;  5F2R A;  1T7A A;  5EXW A;  4KBO A;  5AQH A;  4AEI A;  5AQN A;  3M3Z A;  3L4I A;  3LDP A;  3A8Y A;  3D2F B;  1ZFU A;  4H5V A;  4UAF E;  2YBR C;  4FSV A;  3GDQ A;  3D2E A;  4AAZ A;  2QWP A;  5AQZ A;  2M8B B;  5AQT A;  1NGH A;  1AYJ A;  4IO8 A;  1N4N A;  1SNB A;  2KBJ A;  1ZYV A;  2A7T A;  2LN8 A;  5BN8 A;  2VY6 A;  1BRZ A;  2N2R A;  1QQO A;  1YUW A;  2LY6 A;  3KP1 A;  1NGE A;  1SN4 A;  2E0H A;  1BK8 A;  5AQK A;  3FZM A;  2YIO A;  1HPM A;  1NGB A;  1NPI A;  1DQ7 A;  1PTX A;  1MR4 A;  2E2F A;  1ZVE A;  3QI7 A;  1UGL A;  3PSM A;  4HWI A;  2E3F A;  1JXC A;  2QWQ A;  3LDL A;  2D56 A;  4HHF A;  3E7U X;  2KJA A;  1FH3 A;  2QW9 A;  1KAX A;  3IUC A;  3KC6 A;  3D2F A;  1NGI A;  1NGA A;  1LQI A;  2K35 A;  1L4V A;  4UJ0 A;  5AQQ A;  4H5N A;  2BRZ A;  2MN5 A;  3FZH A;  1GPS A;  3FZF A;  5AQS A;  1WMT A;  1BA0 A;  1VNB A;  3C7N B;  1PX9 A;  1JZB A;  1MYN A;  3BK3 C;  2QWR A;  2B3C A;  3L56 A;  3QML A;  5EVZ A;  2KPY A;  1NH5 A;  1T7B A;  5AQL A;  3GKU A;  5FPE A;  3KOY A;  2KGQ A;  1I2V A;  2E8A A;  5BPM A;  1PE4 A;  1JKZ A;  1VNA A;  2KHO A;  4CQK A;  5EX5 A;  1NE5 A;  2NY8 X;  2GL1 A;  5AQX A;  3ATV A;  1BMR A;  5AQP A;  1NGJ A;  2LT8 A;  5AQM A;  1CN2 A;  1KAY A;  1HJO A;  1NRA A;  4KYP A;  1ZUT A;  5AQY A;  1NRB A;  1ATR A;  1B3C A;  2KSK A;  5F0X A;  2LR3 A;  2BUP A;  1C55 A;  3SF4 D;  2KBH A;  3KP0 A;  2GMO A;  2MBK A;  1TI5 A;  2QWN A;  2QWM A;  3R2V A;  3CW4 A;  1NGC A;  1BUP A;  5BPN A; 
#chains in the Genus database with same CATH homology
 2E3G A;  2I61 A;  1P00 A;  5CY0 A;  1I6F A;  3E7R L;  1LQQ A;  2ASC A;  1C56 A;  1WWN A;  2N66 A;  2LJ7 A;  1KV0 A;  2LI7 A;  2SN3 A;  4V1D C;  1ZU3 A;  1T7E A;  1AHO A;  1BCG A;  1GPT A;  2YEO A;  2LJM A;  1P0A A;  2KYQ A;  1OZZ A;  1CHZ A;  4AB0 A;  2YC1 C;  2LY5 A;  2NY9 X;  1OMY A;  5KK4 A;  2N2Q A;  2KBK A;  1I6G A;  1ZVG A;  2LKB A;  1DJT A;  1LQH A;  1ICA A;  1SN1 A;  1ZYW A;  2MZ0 A;  1WT7 A;  2ATB A;  1T1T A;  1B7D A;  1SEG A;  1T0Z A;  1I2U A;  2N69 A;  2B68 A;  4HE7 A;  1JZA A;  1T7A A;  4AEI A;  1ZFU A;  2YBR C;  4AAZ A;  2M8B B;  1AYJ A;  1N4N A;  1SNB A;  2KBJ A;  1ZYV A;  2A7T A;  1BRZ A;  2N2R A;  2LY6 A;  1SN4 A;  1BK8 A;  2E0H A;  1NPI A;  1DQ7 A;  1PTX A;  1MR4 A;  1ZVE A;  3PSM A;  2E3F A;  1JXC A;  4HHF A;  3E7U X;  2KJA A;  1FH3 A;  1LQI A;  1L4V A;  4UJ0 A;  2BRZ A;  1GPS A;  1WMT A;  1VNB A;  1PX9 A;  1JZB A;  1MYN A;  2B3C A;  2KPY A;  1NH5 A;  1T7B A;  2KGQ A;  1I2V A;  1PE4 A;  1JKZ A;  1VNA A;  4CQK A;  1NE5 A;  2NY8 X;  2GL1 A;  1BMR A;  2LT8 A;  1CN2 A;  1NRA A;  4KYP A;  1ZUT A;  1B3C A;  1NRB A;  2KSK A;  2LR3 A;  1C55 A;  2KBH A;  1TI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...