1NH5A

Automatic assignment of nmr data and determination of the protein structure of a new world scorpion neurotoxin using noah/diamod
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
60
structure length
60
Chain Sequence
KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin 5
publication title Automatic assignment of NOESY Cross peaks and determination of the protein structure of a new world scorpion neurotoxin Using NOAH/DIAMOD
pubmed doi rcsb
molecule tags Toxin
total genus 8
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1nh5A00
1C55A 1JKZA 1ZFUA 1ZUTA 1SEGA 2KBJA 4HE7A 2YC1C 1P0AA 2NY8X 2E0HA 2N2RA 2KBKA 2LKBA 1WT7A 1BRZA 1KV0A 1P00A 2LR3A 1BMRA 1PTXA 4AB0A 2B68A 1T1TA 2M8BB 2ATBA 2LI7A 2ASCA 2KPYA 2BRZA 1I2VA 1N4NA 4V1DC 1NRBA 5CY0A 2GL1A 4AAZA 1JZAA 2LT8A 1T7BA 1ZU3A 1NH5A 1ZVEA 1ZYVA 1BK8A 2LJMA 1BCGA 1LQHA 1OMYA 4KYPA 1AYJA 4CQKA 1VNAA 1DJTA 1SNBA 1SN4A 2LY6A 1GPTA 2E3FA 2KYQA 1WMTA 1OZZA 2MZ0A 1B7DA 1LQIA 1T7AA 2KSKA 4UJ0A 1CHZA 2E3GA 2N69A 1L4VA 2A7TA 1I6FA 1T7EA 2YBRC 4HHFA 1NE5A 1C56A 1MYNA 3PSMA 1VNBA 1GPSA 1PX9A 1ICAA 1B3CA 1MR4A 2SN3A 1LQQA 1NPIA 2NY9X 1PE4A 1ZVGA 2LY5A 1JZBA 2YEOA 1SN1A 2KBHA 1AHOA 1NRAA 1FH3A 2I61A 2KJAA 1I2UA 5KK4A 2KGQA 2LJ7A 3E7RL 1ZYWA 2B3CA 1T0ZA 1WWNA 1JXCA 1CN2A 2N66A 3E7UX 2N2QA 4AEIA 1I6GA 1TI5A 1DQ7A
chains in the Genus database with same CATH superfamily
3FZMA 1BA1A 1HPMA 3A8YA 5AQLA 3QMLA 1C55A 2BUPA 4HWIA 2KHOA 4UADE 1JKZA 3C7NB 1ZFUA 1KAYA 4KBOA 5AQJA 5AQZA 5F1XA 2E8AA 3ATVA 4H5WA 1ZUTA 1SEGA 5AQSA 2LN8A 2KBJA 1K8BA 4HE7A 3JXUA 2MN5A 3LDNA 2YC1C 1P0AA 2NY8X 5AQTA 2JDQD 2YILA 5BN9A 2QWQA 2E0HA 2N2RA 1NGCA 2KBKA 2LKBA 1WT7A 3CW4A 1BRZA 1KV0A 1P00A 2LR3A 1BMRA 1NGBA 1QQNA 1PTXA 4AB0A 4FSVA 2B68A 5AQKA 4H5TA 3KOWA 1T1TA 2M8BB 2K35A 2VY6A 3D2FB 5AQWA 3L6QA 2ATBA 2LI7A 2ASCA 3HSCA 5BN8A 2KPYA 3FE1A 5AQOA 2BRZA 5FPMA 1N4NA 3GDQA 1I2VA 1UGLA 4V1DC 3SF4D 1NRBA 5CY0A 2GL1A 4AAZA 5BPLA 1JZAA 2LT8A 5AQIA 1HJOA 5EVZA 1T7BA 1BUPA 1ZU3A 4UAEF 1NH5A 1ZVEA 1ZYVA 5EY4A 1BK8A 2LJMA 5EXWA 3KOZA 1NGJA 1BCGA 1LQHA 1OMYA 4H5NA 3GKUA 3R2VA 1HX1A 3ATUA 4KYPA 1AYJA 4CQKA 1VNAA 1DJTA 1QQMA 1SNBA 4GNIA 1BA0A 1NGEA 1SN4A 5AQPA 5AQRA 3L56A 2LY6A 5AR0A 1NGHA 3KOYA 5AQUA 2QWOA 1GPTA 5FPDA 2YIOA 2E3FA 4H5RA 2KYQA 1WMTA 2QWLA 1OZZA 2MZ0A 1B7DA 1LQIA 1T7AA 4FL9A 2KSKA 4UAFE 3CQXA 5AQHA 4UJ0A 1CHZA 2E3GA 2N69A 1L4VA 2A7TA 3KP1A 3KVGA 1NGFA 1QQOA 1I6FA 1T7EA 2YBRC 3FZHA 3FZFA 3LDPA 4HHFA 5BPMA 1NE5A 1C56A 3KHWA 1MYNA 5F2RA 3PSMA 5FPEA 3GL1A 3KP0A 2E2FA 3D2FA 1VNBA 5AQMA 1GPSA 5BPNA 1ATRA 3QFPA 2MBKA 1PX9A 2QWMA 1ICAA 1B3CA 1MR4A 2SN3A 1LQQA 1NPIA 5AQVA 2QXLA 2NY9X 1DKGD 3M3ZA 1PE4A 3FZKA 4H5VA 2D56A 1ATSA 3IUCA 3LDOA 2YIPA 3QI7A 1S3XA 3QFUA 1ZVGA 2LY5A 1NGIA 3I33A 3KC6A 1JZBA 1NGAA 2QW9A 2YEOA 2G2KA 5FPNA 1SN1A 2KBHA 3L4IA 1AHOA 1NRAA 1FH3A 2V7ZA 1NGGA 1NGDA 3LDLA 2I61A 3KOXA 1KAZA 3D2EA 5AQQA 2E88A 2GMOA 2KJAA 5AQXA 3FZLA 1I2UA 3AY9A 1YUWA 5AQFA 3D2EB 5KK4A 2KGQA 2LJ7A 1KAXA 3BK3C 3E7RL 5EX5A 1ZYWA 2B3CA 2QWPA 1T0ZA 1WWNA 1JXCA 1POIA 4IO8A 5AQNA 1CN2A 2QWRA 2N66A 2QWNA 3E7UX 3LDQA 1XRSB 2N2QA 5AQYA 4AEIA 1I6GA 5F0XA 3C7NA 1TI5A 5AQGA 1DQ7A
chains in the Genus database with same CATH topology
1C55A 1JKZA 1ZFUA 1ZUTA 1SEGA 2KBJA 4HE7A 2YC1C 1P0AA 2NY8X 2E0HA 2N2RA 2KBKA 2LKBA 1WT7A 1BRZA 1KV0A 1P00A 2LR3A 1BMRA 1PTXA 4AB0A 2B68A 1T1TA 2M8BB 2ATBA 2LI7A 2ASCA 2KPYA 2BRZA 1I2VA 1N4NA 4V1DC 1NRBA 5CY0A 2GL1A 4AAZA 1JZAA 2LT8A 1T7BA 1ZU3A 1NH5A 1ZVEA 1ZYVA 1BK8A 2LJMA 1BCGA 1LQHA 1OMYA 4KYPA 1AYJA 4CQKA 1VNAA 1DJTA 1SNBA 1SN4A 2LY6A 1GPTA 2E3FA 2KYQA 1WMTA 1OZZA 2MZ0A 1B7DA 1LQIA 1T7AA 2KSKA 4UJ0A 1CHZA 2E3GA 2N69A 1L4VA 2A7TA 1I6FA 1T7EA 2YBRC 4HHFA 1NE5A 1C56A 1MYNA 3PSMA 1VNBA 1GPSA 1PX9A 1ICAA 1B3CA 1MR4A 2SN3A 1LQQA 1NPIA 2NY9X 1PE4A 1ZVGA 2LY5A 1JZBA 2YEOA 1SN1A 2KBHA 1AHOA 1NRAA 1FH3A 2I61A 2KJAA 1I2UA 5KK4A 2KGQA 2LJ7A 3E7RL 1ZYWA 2B3CA 1T0ZA 1WWNA 1JXCA 1CN2A 2N66A 3E7UX 2N2QA 4AEIA 1I6GA 1TI5A 1DQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C55 A;  1JKZ A;  1ZFU A;  1ZUT A;  1SEG A;  2KBJ A;  4HE7 A;  2YC1 C;  1P0A A;  2NY8 X;  2E0H A;  2N2R A;  2KBK A;  2LKB A;  1WT7 A;  1BRZ A;  1KV0 A;  1P00 A;  2LR3 A;  1BMR A;  1PTX A;  4AB0 A;  2B68 A;  1T1T A;  2M8B B;  2ATB A;  2LI7 A;  2ASC A;  2KPY A;  2BRZ A;  1I2V A;  1N4N A;  4V1D C;  1NRB A;  5CY0 A;  2GL1 A;  4AAZ A;  1JZA A;  2LT8 A;  1T7B A;  1ZU3 A;  1NH5 A;  1ZVE A;  1ZYV A;  1BK8 A;  2LJM A;  1BCG A;  1LQH A;  1OMY A;  4KYP A;  1AYJ A;  4CQK A;  1VNA A;  1DJT A;  1SNB A;  1SN4 A;  2LY6 A;  1GPT A;  2E3F A;  2KYQ A;  1WMT A;  1OZZ A;  2MZ0 A;  1B7D A;  1LQI A;  1T7A A;  2KSK A;  4UJ0 A;  1CHZ A;  2E3G A;  2N69 A;  1L4V A;  2A7T A;  1I6F A;  1T7E A;  2YBR C;  4HHF A;  1NE5 A;  1C56 A;  1MYN A;  3PSM A;  1VNB A;  1GPS A;  1PX9 A;  1ICA A;  1B3C A;  1MR4 A;  2SN3 A;  1LQQ A;  1NPI A;  2NY9 X;  1PE4 A;  1ZVG A;  2LY5 A;  1JZB A;  2YEO A;  1SN1 A;  2KBH A;  1AHO A;  1NRA A;  1FH3 A;  2I61 A;  2KJA A;  1I2U A;  5KK4 A;  2KGQ A;  2LJ7 A;  3E7R L;  1ZYW A;  2B3C A;  1T0Z A;  1WWN A;  1JXC A;  1CN2 A;  2N66 A;  3E7U X;  2N2Q A;  4AEI A;  1I6G A;  1TI5 A;  1DQ7 A; 
#chains in the Genus database with same CATH topology
 3FZM A;  1BA1 A;  1HPM A;  3A8Y A;  5AQL A;  3QML A;  1C55 A;  2BUP A;  4HWI A;  2KHO A;  4UAD E;  1JKZ A;  3C7N B;  1ZFU A;  1KAY A;  4KBO A;  5AQJ A;  5AQZ A;  5F1X A;  2E8A A;  3ATV A;  4H5W A;  1ZUT A;  1SEG A;  5AQS A;  2LN8 A;  2KBJ A;  1K8B A;  4HE7 A;  3JXU A;  2MN5 A;  3LDN A;  2YC1 C;  1P0A A;  2NY8 X;  5AQT A;  2JDQ D;  2YIL A;  5BN9 A;  2QWQ A;  2E0H A;  2N2R A;  1NGC A;  2KBK A;  2LKB A;  1WT7 A;  3CW4 A;  1BRZ A;  1KV0 A;  1P00 A;  2LR3 A;  1BMR A;  1NGB A;  1QQN A;  1PTX A;  4AB0 A;  4FSV A;  2B68 A;  5AQK A;  4H5T A;  3KOW A;  1T1T A;  2M8B B;  2K35 A;  2VY6 A;  3D2F B;  5AQW A;  3L6Q A;  2ATB A;  2LI7 A;  2ASC A;  3HSC A;  5BN8 A;  2KPY A;  3FE1 A;  5AQO A;  2BRZ A;  5FPM A;  1N4N A;  3GDQ A;  1I2V A;  1UGL A;  4V1D C;  3SF4 D;  1NRB A;  5CY0 A;  2GL1 A;  4AAZ A;  5BPL A;  1JZA A;  2LT8 A;  5AQI A;  1HJO A;  5EVZ A;  1T7B A;  1BUP A;  1ZU3 A;  4UAE F;  1NH5 A;  1ZVE A;  1ZYV A;  5EY4 A;  1BK8 A;  2LJM A;  5EXW A;  3KOZ A;  1NGJ A;  1BCG A;  1LQH A;  1OMY A;  4H5N A;  3GKU A;  3R2V A;  1HX1 A;  3ATU A;  4KYP A;  1AYJ A;  4CQK A;  1VNA A;  1DJT A;  1QQM A;  1SNB A;  4GNI A;  1BA0 A;  1NGE A;  1SN4 A;  5AQP A;  5AQR A;  3L56 A;  2LY6 A;  5AR0 A;  1NGH A;  3KOY A;  5AQU A;  2QWO A;  1GPT A;  5FPD A;  2YIO A;  2E3F A;  4H5R A;  2KYQ A;  1WMT A;  2QWL A;  1OZZ A;  2MZ0 A;  1B7D A;  1LQI A;  1T7A A;  4FL9 A;  2KSK A;  4UAF E;  3CQX A;  5AQH A;  4UJ0 A;  1CHZ A;  2E3G A;  2N69 A;  1L4V A;  2A7T A;  3KP1 A;  3KVG A;  1NGF A;  1QQO A;  1I6F A;  1T7E A;  2YBR C;  3FZH A;  3FZF A;  3LDP A;  4HHF A;  5BPM A;  1NE5 A;  1C56 A;  3KHW A;  1MYN A;  5F2R A;  3PSM A;  5FPE A;  3GL1 A;  3KP0 A;  2E2F A;  3D2F A;  1VNB A;  5AQM A;  1GPS A;  5BPN A;  1ATR A;  3QFP A;  2MBK A;  1PX9 A;  2QWM A;  1ICA A;  1B3C A;  1MR4 A;  2SN3 A;  1LQQ A;  1NPI A;  5AQV A;  2QXL A;  2NY9 X;  1DKG D;  3M3Z A;  1PE4 A;  3FZK A;  4H5V A;  2D56 A;  1ATS A;  3IUC A;  3LDO A;  2YIP A;  3QI7 A;  1S3X A;  3QFU A;  1ZVG A;  2LY5 A;  1NGI A;  3I33 A;  3KC6 A;  1JZB A;  1NGA A;  2QW9 A;  2YEO A;  2G2K A;  5FPN A;  1SN1 A;  2KBH A;  3L4I A;  1AHO A;  1NRA A;  1FH3 A;  2V7Z A;  1NGG A;  1NGD A;  3LDL A;  2I61 A;  3KOX A;  1KAZ A;  3D2E A;  5AQQ A;  2E88 A;  2GMO A;  2KJA A;  5AQX A;  3FZL A;  1I2U A;  3AY9 A;  1YUW A;  5AQF A;  3D2E B;  5KK4 A;  2KGQ A;  2LJ7 A;  1KAX A;  3BK3 C;  3E7R L;  5EX5 A;  1ZYW A;  2B3C A;  2QWP A;  1T0Z A;  1WWN A;  1JXC A;  1POI A;  4IO8 A;  5AQN A;  1CN2 A;  2QWR A;  2N66 A;  2QWN A;  3E7U X;  3LDQ A;  1XRS B;  2N2Q A;  5AQY A;  4AEI A;  1I6G A;  5F0X A;  3C7N A;  1TI5 A;  5AQG A;  1DQ7 A; 
#chains in the Genus database with same CATH homology
 1C55 A;  1JKZ A;  1ZFU A;  1ZUT A;  1SEG A;  2KBJ A;  4HE7 A;  2YC1 C;  1P0A A;  2NY8 X;  2E0H A;  2N2R A;  2KBK A;  2LKB A;  1WT7 A;  1BRZ A;  1KV0 A;  1P00 A;  2LR3 A;  1BMR A;  1PTX A;  4AB0 A;  2B68 A;  1T1T A;  2M8B B;  2ATB A;  2LI7 A;  2ASC A;  2KPY A;  2BRZ A;  1I2V A;  1N4N A;  4V1D C;  1NRB A;  5CY0 A;  2GL1 A;  4AAZ A;  1JZA A;  2LT8 A;  1T7B A;  1ZU3 A;  1NH5 A;  1ZVE A;  1ZYV A;  1BK8 A;  2LJM A;  1BCG A;  1LQH A;  1OMY A;  4KYP A;  1AYJ A;  4CQK A;  1VNA A;  1DJT A;  1SNB A;  1SN4 A;  2LY6 A;  1GPT A;  2E3F A;  2KYQ A;  1WMT A;  1OZZ A;  2MZ0 A;  1B7D A;  1LQI A;  1T7A A;  2KSK A;  4UJ0 A;  1CHZ A;  2E3G A;  2N69 A;  1L4V A;  2A7T A;  1I6F A;  1T7E A;  2YBR C;  4HHF A;  1NE5 A;  1C56 A;  1MYN A;  3PSM A;  1VNB A;  1GPS A;  1PX9 A;  1ICA A;  1B3C A;  1MR4 A;  2SN3 A;  1LQQ A;  1NPI A;  2NY9 X;  1PE4 A;  1ZVG A;  2LY5 A;  1JZB A;  2YEO A;  1SN1 A;  2KBH A;  1AHO A;  1NRA A;  1FH3 A;  2I61 A;  2KJA A;  1I2U A;  5KK4 A;  2KGQ A;  2LJ7 A;  3E7R L;  1ZYW A;  2B3C A;  1T0Z A;  1WWN A;  1JXC A;  1CN2 A;  2N66 A;  3E7U X;  2N2Q A;  4AEI A;  1I6G A;  1TI5 A;  1DQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...