2GL1A

Nmr solution structure of vigna radiata defensin 2 (vrd2)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDF1
publication title Structure-based protein engineering for alpha-amylase inhibitory activity of plant defensin.
pubmed doi rcsb
molecule tags Plant protein
total genus 12
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2006-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2gl1A00
1ZVEA 1SEGA 2ATBA 1MR4A 1NRAA 1BMRA 1NPIA 2B68A 4AB0A 1DQ7A 2LKBA 2B3CA 2BRZA 1AHOA 1WT7A 2A7TA 1NRBA 1T1TA 2YBRC 2LY6A 2KBKA 1I2VA 4AAZA 1BRZA 2M8BB 2E3GA 2YEOA 1C55A 1ZYVA 4V1DC 4UJ0A 2MZ0A 1FH3A 1GPSA 1JZBA 1CHZA 1PX9A 2N69A 1LQQA 1P0AA 1I2UA 1N4NA 1ICAA 1P00A 2N2QA 2ASCA 1VNBA 1CN2A 2KJAA 1MYNA 1VNAA 1WMTA 4CQKA 3E7UX 1TI5A 1ZYWA 2YC1C 4KYPA 2LJMA 2N66A 1BK8A 1NH5A 1PE4A 1GPTA 2KPYA 1I6FA 2I61A 4HHFA 4HE7A 1T7EA 4AEIA 1ZU3A 1ZUTA 1NE5A 2KSKA 3PSMA 2KBHA 1WWNA 2KBJA 1AYJA 1ZVGA 2LT8A 1DJTA 1T7AA 2KGQA 2LJ7A 2KYQA 2E0HA 1JKZA 1B7DA 2SN3A 1I6GA 5KK4A 1ZFUA 2LR3A 2NY8X 2LY5A 1T0ZA 1PTXA 1SN4A 2E3FA 2LI7A 2GL1A 1SN1A 1LQHA 1OMYA 1KV0A 5CY0A 1BCGA 2N2RA 1L4VA 1C56A 1JXCA 1T7BA 3E7RL 1B3CA 1LQIA 1OZZA 2NY9X 1SNBA 1JZAA
chains in the Genus database with same CATH superfamily
3AY9A 1ZVEA 1SEGA 4UAFE 3QI7A 5FPMA 1XRSB 2ATBA 3FZKA 1NGEA 5AQMA 5AQRA 1MR4A 1NRAA 1BMRA 4H5NA 1NPIA 2B68A 2E88A 1NGCA 3FZFA 3GDQA 4UAEF 2JDQD 2BUPA 2MBKA 1HX1A 3LDQA 3QFUA 1DQ7A 1NGFA 4AB0A 2LKBA 1QQNA 3LDPA 1HJOA 1NGHA 5EY4A 2B3CA 2BRZA 1AHOA 1WT7A 2A7TA 1NRBA 1POIA 2QWOA 2QWPA 1T1TA 2YBRC 5BPMA 2LY6A 2KBKA 1S3XA 3KOWA 3KVGA 4AAZA 1I2VA 3FZHA 1BRZA 2M8BB 1HPMA 3LDOA 2E3GA 2YEOA 5AQXA 1C55A 1YUWA 1ZYVA 2QWQA 4FSVA 4V1DC 2MZ0A 5AQGA 5FPNA 4UJ0A 1FH3A 1GPSA 1JZBA 1KAXA 1CHZA 1PX9A 2N69A 1ATRA 3KP1A 1NGJA 1LQQA 1P0AA 5AQHA 1I2UA 5BPNA 1N4NA 2QWNA 3L6QA 1BA1A 1P00A 1ICAA 3KHWA 3QFPA 5BN8A 4H5VA 1KAZA 2N2QA 5AQLA 3JXUA 2ASCA 1VNBA 1CN2A 3M3ZA 2E8AA 2KJAA 3CQXA 1MYNA 5AQJA 1VNAA 5F0XA 1WMTA 3KC6A 4UADE 1K8BA 5AQTA 3D2EA 4CQKA 3E7UX 1TI5A 1ZYWA 2YC1C 4H5WA 4KYPA 2LJMA 2N66A 3KOXA 4IO8A 5F1XA 1NH5A 1BK8A 5FPEA 2QWRA 3L56A 1PE4A 1GPTA 2KPYA 3A8YA 1I6FA 5BN9A 1NGBA 1NGGA 2I61A 1NGAA 4HHFA 4HWIA 4HE7A 1T7EA 3GKUA 4FL9A 3ATUA 4KBOA 1BUPA 2E2FA 3KOZA 5AQVA 4AEIA 1ATSA 1BA0A 3ATVA 3D2FB 1NGIA 1ZU3A 1NGDA 5AQPA 5FPDA 4H5RA 1ZUTA 1NE5A 2KSKA 3D2EB 5AQNA 5AQOA 3PSMA 5AQZA 2KBHA 1WWNA 2KBJA 5F2RA 1AYJA 4GNIA 3C7NA 2QXLA 1ZVGA 3D2FA 2LT8A 1DJTA 1T7AA 3LDNA 2KGQA 2LJ7A 5AQFA 5AQYA 2G2KA 3GL1A 3R2VA 2KYQA 5AQWA 2E0HA 5EXWA 1JKZA 5AQKA 1B7DA 2SN3A 1I6GA 2KHOA 3QMLA 5KK4A 2YILA 3KP0A 1ZFUA 3FZMA 2K35A 5AR0A 1UGLA 2LR3A 2VY6A 5AQUA 2GMOA 2MN5A 2LY5A 2NY8X 1T0ZA 1PTXA 2V7ZA 3SF4D 2QWLA 2D56A 3C7NB 1SN4A 1DKGD 2E3FA 4H5TA 3BK3C 2LI7A 3FZLA 3I33A 5AQQA 1KAYA 2LN8A 2GL1A 3CW4A 1SN1A 3KOYA 1LQHA 1OMYA 5BPLA 3IUCA 3LDLA 5EX5A 1KV0A 5AQSA 5CY0A 5AQIA 2YIOA 5EVZA 1BCGA 1QQMA 2N2RA 1C56A 1L4VA 1JXCA 1T7BA 3HSCA 2QWMA 2YIPA 3E7RL 1B3CA 1LQIA 2QW9A 1OZZA 3L4IA 3FE1A 2NY9X 1SNBA 1JZAA 1QQOA
chains in the Genus database with same CATH topology
1ZVEA 1SEGA 2ATBA 1MR4A 1NRAA 1BMRA 1NPIA 2B68A 4AB0A 1DQ7A 2LKBA 2B3CA 2BRZA 1AHOA 1WT7A 2A7TA 1NRBA 1T1TA 2YBRC 2LY6A 2KBKA 1I2VA 4AAZA 1BRZA 2M8BB 2E3GA 2YEOA 1C55A 1ZYVA 4V1DC 4UJ0A 2MZ0A 1FH3A 1GPSA 1JZBA 1CHZA 1PX9A 2N69A 1LQQA 1P0AA 1I2UA 1N4NA 1ICAA 1P00A 2N2QA 2ASCA 1VNBA 1CN2A 2KJAA 1MYNA 1VNAA 1WMTA 4CQKA 3E7UX 1TI5A 1ZYWA 2YC1C 4KYPA 2LJMA 2N66A 1BK8A 1NH5A 1PE4A 1GPTA 2KPYA 1I6FA 2I61A 4HHFA 4HE7A 1T7EA 4AEIA 1ZU3A 1ZUTA 1NE5A 2KSKA 3PSMA 2KBHA 1WWNA 2KBJA 1AYJA 1ZVGA 2LT8A 1DJTA 1T7AA 2KGQA 2LJ7A 2KYQA 2E0HA 1JKZA 1B7DA 2SN3A 1I6GA 5KK4A 1ZFUA 2LR3A 2NY8X 2LY5A 1T0ZA 1PTXA 1SN4A 2E3FA 2LI7A 2GL1A 1SN1A 1LQHA 1OMYA 1KV0A 5CY0A 1BCGA 2N2RA 1L4VA 1C56A 1JXCA 1T7BA 3E7RL 1B3CA 1LQIA 1OZZA 2NY9X 1SNBA 1JZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVE A;  1SEG A;  2ATB A;  1MR4 A;  1NRA A;  1BMR A;  1NPI A;  2B68 A;  4AB0 A;  1DQ7 A;  2LKB A;  2B3C A;  2BRZ A;  1AHO A;  1WT7 A;  2A7T A;  1NRB A;  1T1T A;  2YBR C;  2LY6 A;  2KBK A;  1I2V A;  4AAZ A;  1BRZ A;  2M8B B;  2E3G A;  2YEO A;  1C55 A;  1ZYV A;  4V1D C;  4UJ0 A;  2MZ0 A;  1FH3 A;  1GPS A;  1JZB A;  1CHZ A;  1PX9 A;  2N69 A;  1LQQ A;  1P0A A;  1I2U A;  1N4N A;  1ICA A;  1P00 A;  2N2Q A;  2ASC A;  1VNB A;  1CN2 A;  2KJA A;  1MYN A;  1VNA A;  1WMT A;  4CQK A;  3E7U X;  1TI5 A;  1ZYW A;  2YC1 C;  4KYP A;  2LJM A;  2N66 A;  1BK8 A;  1NH5 A;  1PE4 A;  1GPT A;  2KPY A;  1I6F A;  2I61 A;  4HHF A;  4HE7 A;  1T7E A;  4AEI A;  1ZU3 A;  1ZUT A;  1NE5 A;  2KSK A;  3PSM A;  2KBH A;  1WWN A;  2KBJ A;  1AYJ A;  1ZVG A;  2LT8 A;  1DJT A;  1T7A A;  2KGQ A;  2LJ7 A;  2KYQ A;  2E0H A;  1JKZ A;  1B7D A;  2SN3 A;  1I6G A;  5KK4 A;  1ZFU A;  2LR3 A;  2NY8 X;  2LY5 A;  1T0Z A;  1PTX A;  1SN4 A;  2E3F A;  2LI7 A;  2GL1 A;  1SN1 A;  1LQH A;  1OMY A;  1KV0 A;  5CY0 A;  1BCG A;  2N2R A;  1L4V A;  1C56 A;  1JXC A;  1T7B A;  3E7R L;  1B3C A;  1LQI A;  1OZZ A;  2NY9 X;  1SNB A;  1JZA A; 
#chains in the Genus database with same CATH topology
 3AY9 A;  1ZVE A;  1SEG A;  4UAF E;  3QI7 A;  5FPM A;  1XRS B;  2ATB A;  3FZK A;  1NGE A;  5AQM A;  5AQR A;  1MR4 A;  1NRA A;  1BMR A;  4H5N A;  1NPI A;  2B68 A;  2E88 A;  1NGC A;  3FZF A;  3GDQ A;  4UAE F;  2JDQ D;  2BUP A;  2MBK A;  1HX1 A;  3LDQ A;  3QFU A;  1DQ7 A;  1NGF A;  4AB0 A;  2LKB A;  1QQN A;  3LDP A;  1HJO A;  1NGH A;  5EY4 A;  2B3C A;  2BRZ A;  1AHO A;  1WT7 A;  2A7T A;  1NRB A;  1POI A;  2QWO A;  2QWP A;  1T1T A;  2YBR C;  5BPM A;  2LY6 A;  2KBK A;  1S3X A;  3KOW A;  3KVG A;  4AAZ A;  1I2V A;  3FZH A;  1BRZ A;  2M8B B;  1HPM A;  3LDO A;  2E3G A;  2YEO A;  5AQX A;  1C55 A;  1YUW A;  1ZYV A;  2QWQ A;  4FSV A;  4V1D C;  2MZ0 A;  5AQG A;  5FPN A;  4UJ0 A;  1FH3 A;  1GPS A;  1JZB A;  1KAX A;  1CHZ A;  1PX9 A;  2N69 A;  1ATR A;  3KP1 A;  1NGJ A;  1LQQ A;  1P0A A;  5AQH A;  1I2U A;  5BPN A;  1N4N A;  2QWN A;  3L6Q A;  1BA1 A;  1P00 A;  1ICA A;  3KHW A;  3QFP A;  5BN8 A;  4H5V A;  1KAZ A;  2N2Q A;  5AQL A;  3JXU A;  2ASC A;  1VNB A;  1CN2 A;  3M3Z A;  2E8A A;  2KJA A;  3CQX A;  1MYN A;  5AQJ A;  1VNA A;  5F0X A;  1WMT A;  3KC6 A;  4UAD E;  1K8B A;  5AQT A;  3D2E A;  4CQK A;  3E7U X;  1TI5 A;  1ZYW A;  2YC1 C;  4H5W A;  4KYP A;  2LJM A;  2N66 A;  3KOX A;  4IO8 A;  5F1X A;  1NH5 A;  1BK8 A;  5FPE A;  2QWR A;  3L56 A;  1PE4 A;  1GPT A;  2KPY A;  3A8Y A;  1I6F A;  5BN9 A;  1NGB A;  1NGG A;  2I61 A;  1NGA A;  4HHF A;  4HWI A;  4HE7 A;  1T7E A;  3GKU A;  4FL9 A;  3ATU A;  4KBO A;  1BUP A;  2E2F A;  3KOZ A;  5AQV A;  4AEI A;  1ATS A;  1BA0 A;  3ATV A;  3D2F B;  1NGI A;  1ZU3 A;  1NGD A;  5AQP A;  5FPD A;  4H5R A;  1ZUT A;  1NE5 A;  2KSK A;  3D2E B;  5AQN A;  5AQO A;  3PSM A;  5AQZ A;  2KBH A;  1WWN A;  2KBJ A;  5F2R A;  1AYJ A;  4GNI A;  3C7N A;  2QXL A;  1ZVG A;  3D2F A;  2LT8 A;  1DJT A;  1T7A A;  3LDN A;  2KGQ A;  2LJ7 A;  5AQF A;  5AQY A;  2G2K A;  3GL1 A;  3R2V A;  2KYQ A;  5AQW A;  2E0H A;  5EXW A;  1JKZ A;  5AQK A;  1B7D A;  2SN3 A;  1I6G A;  2KHO A;  3QML A;  5KK4 A;  2YIL A;  3KP0 A;  1ZFU A;  3FZM A;  2K35 A;  5AR0 A;  1UGL A;  2LR3 A;  2VY6 A;  5AQU A;  2GMO A;  2MN5 A;  2LY5 A;  2NY8 X;  1T0Z A;  1PTX A;  2V7Z A;  3SF4 D;  2QWL A;  2D56 A;  3C7N B;  1SN4 A;  1DKG D;  2E3F A;  4H5T A;  3BK3 C;  2LI7 A;  3FZL A;  3I33 A;  5AQQ A;  1KAY A;  2LN8 A;  2GL1 A;  3CW4 A;  1SN1 A;  3KOY A;  1LQH A;  1OMY A;  5BPL A;  3IUC A;  3LDL A;  5EX5 A;  1KV0 A;  5AQS A;  5CY0 A;  5AQI A;  2YIO A;  5EVZ A;  1BCG A;  1QQM A;  2N2R A;  1C56 A;  1L4V A;  1JXC A;  1T7B A;  3HSC A;  2QWM A;  2YIP A;  3E7R L;  1B3C A;  1LQI A;  2QW9 A;  1OZZ A;  3L4I A;  3FE1 A;  2NY9 X;  1SNB A;  1JZA A;  1QQO A; 
#chains in the Genus database with same CATH homology
 1ZVE A;  1SEG A;  2ATB A;  1MR4 A;  1NRA A;  1BMR A;  1NPI A;  2B68 A;  4AB0 A;  1DQ7 A;  2LKB A;  2B3C A;  2BRZ A;  1AHO A;  1WT7 A;  2A7T A;  1NRB A;  1T1T A;  2YBR C;  2LY6 A;  2KBK A;  1I2V A;  4AAZ A;  1BRZ A;  2M8B B;  2E3G A;  2YEO A;  1C55 A;  1ZYV A;  4V1D C;  4UJ0 A;  2MZ0 A;  1FH3 A;  1GPS A;  1JZB A;  1CHZ A;  1PX9 A;  2N69 A;  1LQQ A;  1P0A A;  1I2U A;  1N4N A;  1ICA A;  1P00 A;  2N2Q A;  2ASC A;  1VNB A;  1CN2 A;  2KJA A;  1MYN A;  1VNA A;  1WMT A;  4CQK A;  3E7U X;  1TI5 A;  1ZYW A;  2YC1 C;  4KYP A;  2LJM A;  2N66 A;  1BK8 A;  1NH5 A;  1PE4 A;  1GPT A;  2KPY A;  1I6F A;  2I61 A;  4HHF A;  4HE7 A;  1T7E A;  4AEI A;  1ZU3 A;  1ZUT A;  1NE5 A;  2KSK A;  3PSM A;  2KBH A;  1WWN A;  2KBJ A;  1AYJ A;  1ZVG A;  2LT8 A;  1DJT A;  1T7A A;  2KGQ A;  2LJ7 A;  2KYQ A;  2E0H A;  1JKZ A;  1B7D A;  2SN3 A;  1I6G A;  5KK4 A;  1ZFU A;  2LR3 A;  2NY8 X;  2LY5 A;  1T0Z A;  1PTX A;  1SN4 A;  2E3F A;  2LI7 A;  2GL1 A;  1SN1 A;  1LQH A;  1OMY A;  1KV0 A;  5CY0 A;  1BCG A;  2N2R A;  1L4V A;  1C56 A;  1JXC A;  1T7B A;  3E7R L;  1B3C A;  1LQI A;  1OZZ A;  2NY9 X;  1SNB A;  1JZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...