1PTXA

Crystal structure of toxin ii from the scorpion androctonus australis hector refined at 1.3 angstroms resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SCORPION TOXIN II
publication title Crystal structure of toxin II from the scorpion Androctonus australis Hector refined at 1.3 A resolution.
pubmed doi rcsb
source organism Androctonus australis
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1994-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ptxA00
1LQHA 1JKZA 1GPSA 2YBRC 1T7EA 1T1TA 2NY8X 1NH5A 2LJMA 2LR3A 1GPTA 2ATBA 1ZU3A 1I6GA 2LY6A 2B68A 1BK8A 1WWNA 1ZYWA 2YEOA 2MZ0A 3PSMA 1SN1A 2A7TA 1NRBA 2KBJA 1DJTA 1LQIA 1C56A 1AYJA 1C55A 1SN4A 1ZVGA 5KK4A 2LY5A 1BMRA 3E7UX 1P00A 2I61A 2N66A 4HHFA 1ZVEA 1JZAA 4HE7A 1FH3A 1SNBA 1NPIA 1NE5A 4CQKA 1N4NA 2N69A 2NY9X 1CN2A 2KGQA 2M8BB 2B3CA 1I2UA 4V1DC 1WT7A 2KJAA 2ASCA 1PTXA 1NRAA 1AHOA 2E0HA 2LJ7A 1LQQA 1DQ7A 1I2VA 2N2QA 1BRZA 1CHZA 2E3FA 1ZYVA 4AB0A 1MR4A 2SN3A 1P0AA 1T7AA 1I6FA 1TI5A 1ZFUA 2N2RA 3E7RL 5CY0A 2E3GA 2KYQA 1B7DA 1WMTA 4UJ0A 2LI7A 1L4VA 4KYPA 1JXCA 1SEGA 1MYNA 4AEIA 2LT8A 1VNBA 1OMYA 1OZZA 2LKBA 2KBHA 2KBKA 4AAZA 2GL1A 1PE4A 1PX9A 2KPYA 2BRZA 1ICAA 1VNAA 1B3CA 1KV0A 1JZBA 1T0ZA 2YC1C 2KSKA 1BCGA 1T7BA 1ZUTA
chains in the Genus database with same CATH superfamily
1LQHA 3QFPA 1JKZA 1NGGA 5EX5A 2MN5A 5F1XA 1GPSA 3ATUA 3D2EB 2YBRC 1T7EA 1HJOA 4H5WA 1T1TA 2NY8X 5AQZA 1NH5A 2LJMA 2LR3A 5AQPA 1GPTA 2ATBA 2BUPA 2YILA 3LDPA 5AQXA 1ZU3A 3QI7A 3FZFA 3KC6A 3FZHA 5F2RA 3AY9A 3L56A 2E8AA 2G2KA 3ATVA 3JXUA 5BN8A 1I6GA 1QQOA 2LY6A 2B68A 1S3XA 1BK8A 1WWNA 1ZYWA 3QFUA 2QWLA 5AQSA 2YEOA 2MZ0A 3PSMA 1SN1A 4IO8A 1NGJA 2A7TA 2QWOA 3LDOA 1NRBA 3FZMA 5FPEA 2KBJA 1XRSB 4H5VA 1DJTA 3FZLA 5AQNA 2QWMA 3LDNA 1LQIA 5AQLA 1K8BA 1KAZA 3M3ZA 3GDQA 1KAXA 1C56A 1AYJA 1C55A 1SN4A 1ZVGA 1NGFA 1NGBA 3KOZA 5KK4A 2LY5A 5AR0A 5AQWA 2LN8A 2YIPA 3IUCA 3R2VA 1DKGD 3C7NA 1BMRA 3E7UX 1YUWA 1P00A 2I61A 1NGIA 2N66A 4HHFA 1ZVEA 1UGLA 1JZAA 4HE7A 4KBOA 5AQMA 1FH3A 5AQFA 2QXLA 1SNBA 1ATSA 3KP0A 3KOWA 4H5RA 3GKUA 5EVZA 2QW9A 1NPIA 1NE5A 1NGAA 2GMOA 3L4IA 5BN9A 5F0XA 3CW4A 2QWQA 4CQKA 1N4NA 2N69A 2NY9X 1CN2A 1HPMA 2KGQA 2M8BB 2MBKA 2B3CA 2KHOA 5BPNA 1BUPA 4FSVA 1I2UA 1BA1A 4V1DC 1NGHA 1WT7A 5AQHA 2KJAA 2ASCA 1PTXA 1NRAA 1ATRA 1AHOA 3CQXA 3LDLA 5AQOA 2E0HA 5EY4A 2LJ7A 1LQQA 1DQ7A 1I2VA 2D56A 1POIA 2N2QA 1BRZA 2QWPA 1CHZA 3D2FB 3QMLA 2E3FA 5AQUA 5FPNA 1ZYVA 4UAFE 3D2EA 5BPMA 5AQQA 4FL9A 1MR4A 2E2FA 4AB0A 2SN3A 2QWNA 1P0AA 5FPMA 1T7AA 1ZFUA 1TI5A 1I6FA 1HX1A 2N2RA 2VY6A 5AQVA 3C7NB 1NGEA 3E7RL 5FPDA 3I33A 3KP1A 3BK3C 5AQTA 2E3GA 1BA0A 4H5NA 5EXWA 5CY0A 4H5TA 2KYQA 3LDQA 1B7DA 1WMTA 2K35A 3HSCA 4UJ0A 2LI7A 3L6QA 2QWRA 2V7ZA 4HWIA 5AQRA 4UAEF 5AQIA 5AQKA 1L4VA 4KYPA 1JXCA 2YIOA 3KOXA 1SEGA 1QQNA 1MYNA 3SF4D 4AEIA 2JDQD 2LT8A 5AQYA 1VNBA 1OMYA 1OZZA 2LKBA 3KVGA 1NGCA 2KBHA 2KBKA 4AAZA 1NGDA 2GL1A 1PE4A 1PX9A 3FZKA 4UADE 5AQGA 2KPYA 2BRZA 3KOYA 1ICAA 2E88A 1VNAA 1B3CA 1KV0A 1JZBA 1QQMA 1T0ZA 3GL1A 2YC1C 3A8YA 2KSKA 3D2FA 4GNIA 5BPLA 1BCGA 3KHWA 5AQJA 1KAYA 1T7BA 3FE1A 1ZUTA
chains in the Genus database with same CATH topology
1LQHA 1JKZA 1GPSA 2YBRC 1T7EA 1T1TA 2NY8X 1NH5A 2LJMA 2LR3A 1GPTA 2ATBA 1ZU3A 1I6GA 2LY6A 2B68A 1BK8A 1WWNA 1ZYWA 2YEOA 2MZ0A 3PSMA 1SN1A 2A7TA 1NRBA 2KBJA 1DJTA 1LQIA 1C56A 1AYJA 1C55A 1SN4A 1ZVGA 5KK4A 2LY5A 1BMRA 3E7UX 1P00A 2I61A 2N66A 4HHFA 1ZVEA 1JZAA 4HE7A 1FH3A 1SNBA 1NPIA 1NE5A 4CQKA 1N4NA 2N69A 2NY9X 1CN2A 2KGQA 2M8BB 2B3CA 1I2UA 4V1DC 1WT7A 2KJAA 2ASCA 1PTXA 1NRAA 1AHOA 2E0HA 2LJ7A 1LQQA 1DQ7A 1I2VA 2N2QA 1BRZA 1CHZA 2E3FA 1ZYVA 4AB0A 1MR4A 2SN3A 1P0AA 1T7AA 1I6FA 1TI5A 1ZFUA 2N2RA 3E7RL 5CY0A 2E3GA 2KYQA 1B7DA 1WMTA 4UJ0A 2LI7A 1L4VA 4KYPA 1JXCA 1SEGA 1MYNA 4AEIA 2LT8A 1VNBA 1OMYA 1OZZA 2LKBA 2KBHA 2KBKA 4AAZA 2GL1A 1PE4A 1PX9A 2KPYA 2BRZA 1ICAA 1VNAA 1B3CA 1KV0A 1JZBA 1T0ZA 2YC1C 2KSKA 1BCGA 1T7BA 1ZUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQH A;  1JKZ A;  1GPS A;  2YBR C;  1T7E A;  1T1T A;  2NY8 X;  1NH5 A;  2LJM A;  2LR3 A;  1GPT A;  2ATB A;  1ZU3 A;  1I6G A;  2LY6 A;  2B68 A;  1BK8 A;  1WWN A;  1ZYW A;  2YEO A;  2MZ0 A;  3PSM A;  1SN1 A;  2A7T A;  1NRB A;  2KBJ A;  1DJT A;  1LQI A;  1C56 A;  1AYJ A;  1C55 A;  1SN4 A;  1ZVG A;  5KK4 A;  2LY5 A;  1BMR A;  3E7U X;  1P00 A;  2I61 A;  2N66 A;  4HHF A;  1ZVE A;  1JZA A;  4HE7 A;  1FH3 A;  1SNB A;  1NPI A;  1NE5 A;  4CQK A;  1N4N A;  2N69 A;  2NY9 X;  1CN2 A;  2KGQ A;  2M8B B;  2B3C A;  1I2U A;  4V1D C;  1WT7 A;  2KJA A;  2ASC A;  1PTX A;  1NRA A;  1AHO A;  2E0H A;  2LJ7 A;  1LQQ A;  1DQ7 A;  1I2V A;  2N2Q A;  1BRZ A;  1CHZ A;  2E3F A;  1ZYV A;  4AB0 A;  1MR4 A;  2SN3 A;  1P0A A;  1T7A A;  1I6F A;  1TI5 A;  1ZFU A;  2N2R A;  3E7R L;  5CY0 A;  2E3G A;  2KYQ A;  1B7D A;  1WMT A;  4UJ0 A;  2LI7 A;  1L4V A;  4KYP A;  1JXC A;  1SEG A;  1MYN A;  4AEI A;  2LT8 A;  1VNB A;  1OMY A;  1OZZ A;  2LKB A;  2KBH A;  2KBK A;  4AAZ A;  2GL1 A;  1PE4 A;  1PX9 A;  2KPY A;  2BRZ A;  1ICA A;  1VNA A;  1B3C A;  1KV0 A;  1JZB A;  1T0Z A;  2YC1 C;  2KSK A;  1BCG A;  1T7B A;  1ZUT A; 
#chains in the Genus database with same CATH topology
 1LQH A;  3QFP A;  1JKZ A;  1NGG A;  5EX5 A;  2MN5 A;  5F1X A;  1GPS A;  3ATU A;  3D2E B;  2YBR C;  1T7E A;  1HJO A;  4H5W A;  1T1T A;  2NY8 X;  5AQZ A;  1NH5 A;  2LJM A;  2LR3 A;  5AQP A;  1GPT A;  2ATB A;  2BUP A;  2YIL A;  3LDP A;  5AQX A;  1ZU3 A;  3QI7 A;  3FZF A;  3KC6 A;  3FZH A;  5F2R A;  3AY9 A;  3L56 A;  2E8A A;  2G2K A;  3ATV A;  3JXU A;  5BN8 A;  1I6G A;  1QQO A;  2LY6 A;  2B68 A;  1S3X A;  1BK8 A;  1WWN A;  1ZYW A;  3QFU A;  2QWL A;  5AQS A;  2YEO A;  2MZ0 A;  3PSM A;  1SN1 A;  4IO8 A;  1NGJ A;  2A7T A;  2QWO A;  3LDO A;  1NRB A;  3FZM A;  5FPE A;  2KBJ A;  1XRS B;  4H5V A;  1DJT A;  3FZL A;  5AQN A;  2QWM A;  3LDN A;  1LQI A;  5AQL A;  1K8B A;  1KAZ A;  3M3Z A;  3GDQ A;  1KAX A;  1C56 A;  1AYJ A;  1C55 A;  1SN4 A;  1ZVG A;  1NGF A;  1NGB A;  3KOZ A;  5KK4 A;  2LY5 A;  5AR0 A;  5AQW A;  2LN8 A;  2YIP A;  3IUC A;  3R2V A;  1DKG D;  3C7N A;  1BMR A;  3E7U X;  1YUW A;  1P00 A;  2I61 A;  1NGI A;  2N66 A;  4HHF A;  1ZVE A;  1UGL A;  1JZA A;  4HE7 A;  4KBO A;  5AQM A;  1FH3 A;  5AQF A;  2QXL A;  1SNB A;  1ATS A;  3KP0 A;  3KOW A;  4H5R A;  3GKU A;  5EVZ A;  2QW9 A;  1NPI A;  1NE5 A;  1NGA A;  2GMO A;  3L4I A;  5BN9 A;  5F0X A;  3CW4 A;  2QWQ A;  4CQK A;  1N4N A;  2N69 A;  2NY9 X;  1CN2 A;  1HPM A;  2KGQ A;  2M8B B;  2MBK A;  2B3C A;  2KHO A;  5BPN A;  1BUP A;  4FSV A;  1I2U A;  1BA1 A;  4V1D C;  1NGH A;  1WT7 A;  5AQH A;  2KJA A;  2ASC A;  1PTX A;  1NRA A;  1ATR A;  1AHO A;  3CQX A;  3LDL A;  5AQO A;  2E0H A;  5EY4 A;  2LJ7 A;  1LQQ A;  1DQ7 A;  1I2V A;  2D56 A;  1POI A;  2N2Q A;  1BRZ A;  2QWP A;  1CHZ A;  3D2F B;  3QML A;  2E3F A;  5AQU A;  5FPN A;  1ZYV A;  4UAF E;  3D2E A;  5BPM A;  5AQQ A;  4FL9 A;  1MR4 A;  2E2F A;  4AB0 A;  2SN3 A;  2QWN A;  1P0A A;  5FPM A;  1T7A A;  1ZFU A;  1TI5 A;  1I6F A;  1HX1 A;  2N2R A;  2VY6 A;  5AQV A;  3C7N B;  1NGE A;  3E7R L;  5FPD A;  3I33 A;  3KP1 A;  3BK3 C;  5AQT A;  2E3G A;  1BA0 A;  4H5N A;  5EXW A;  5CY0 A;  4H5T A;  2KYQ A;  3LDQ A;  1B7D A;  1WMT A;  2K35 A;  3HSC A;  4UJ0 A;  2LI7 A;  3L6Q A;  2QWR A;  2V7Z A;  4HWI A;  5AQR A;  4UAE F;  5AQI A;  5AQK A;  1L4V A;  4KYP A;  1JXC A;  2YIO A;  3KOX A;  1SEG A;  1QQN A;  1MYN A;  3SF4 D;  4AEI A;  2JDQ D;  2LT8 A;  5AQY A;  1VNB A;  1OMY A;  1OZZ A;  2LKB A;  3KVG A;  1NGC A;  2KBH A;  2KBK A;  4AAZ A;  1NGD A;  2GL1 A;  1PE4 A;  1PX9 A;  3FZK A;  4UAD E;  5AQG A;  2KPY A;  2BRZ A;  3KOY A;  1ICA A;  2E88 A;  1VNA A;  1B3C A;  1KV0 A;  1JZB A;  1QQM A;  1T0Z A;  3GL1 A;  2YC1 C;  3A8Y A;  2KSK A;  3D2F A;  4GNI A;  5BPL A;  1BCG A;  3KHW A;  5AQJ A;  1KAY A;  1T7B A;  3FE1 A;  1ZUT A; 
#chains in the Genus database with same CATH homology
 1LQH A;  1JKZ A;  1GPS A;  2YBR C;  1T7E A;  1T1T A;  2NY8 X;  1NH5 A;  2LJM A;  2LR3 A;  1GPT A;  2ATB A;  1ZU3 A;  1I6G A;  2LY6 A;  2B68 A;  1BK8 A;  1WWN A;  1ZYW A;  2YEO A;  2MZ0 A;  3PSM A;  1SN1 A;  2A7T A;  1NRB A;  2KBJ A;  1DJT A;  1LQI A;  1C56 A;  1AYJ A;  1C55 A;  1SN4 A;  1ZVG A;  5KK4 A;  2LY5 A;  1BMR A;  3E7U X;  1P00 A;  2I61 A;  2N66 A;  4HHF A;  1ZVE A;  1JZA A;  4HE7 A;  1FH3 A;  1SNB A;  1NPI A;  1NE5 A;  4CQK A;  1N4N A;  2N69 A;  2NY9 X;  1CN2 A;  2KGQ A;  2M8B B;  2B3C A;  1I2U A;  4V1D C;  1WT7 A;  2KJA A;  2ASC A;  1PTX A;  1NRA A;  1AHO A;  2E0H A;  2LJ7 A;  1LQQ A;  1DQ7 A;  1I2V A;  2N2Q A;  1BRZ A;  1CHZ A;  2E3F A;  1ZYV A;  4AB0 A;  1MR4 A;  2SN3 A;  1P0A A;  1T7A A;  1I6F A;  1TI5 A;  1ZFU A;  2N2R A;  3E7R L;  5CY0 A;  2E3G A;  2KYQ A;  1B7D A;  1WMT A;  4UJ0 A;  2LI7 A;  1L4V A;  4KYP A;  1JXC A;  1SEG A;  1MYN A;  4AEI A;  2LT8 A;  1VNB A;  1OMY A;  1OZZ A;  2LKB A;  2KBH A;  2KBK A;  4AAZ A;  2GL1 A;  1PE4 A;  1PX9 A;  2KPY A;  2BRZ A;  1ICA A;  1VNA A;  1B3C A;  1KV0 A;  1JZB A;  1T0Z A;  2YC1 C;  2KSK A;  1BCG A;  1T7B A;  1ZUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...