1PTXA

Crystal structure of toxin ii from the scorpion androctonus australis hector refined at 1.3 angstroms resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
b'VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCORPION TOXIN II
publication title Crystal structure of toxin II from the scorpion Androctonus australis Hector refined at 1.3 A resolution.
pubmed doi rcsb
source organism Androctonus australis
molecule tags Toxin
total genus 16
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1994-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ptxA00
1T7BA 1NH5A 2YC1C 2KYQA 1MR4A 1SN1A 2LT8A 1NE5A 2NY9X 1WMTA 1CHZA 4AEIA 2KGQA 1MYNA 1WWNA 1P00A 2N2RA 2N69A 2LKBA 2LJ7A 2KBHA 1SEGA 2M8BB 3E7RL 3E7UX 1BMRA 2N2QA 2N66A 1GPTA 1NRBA 1DJTA 1P0AA 4UJ0A 2GL1A 1AYJA 4AB0A 1DQ7A 1WT7A 2LJMA 1ICAA 1B7DA 2BRZA 5CY0A 5KK4A 1ZUTA 2A7TA 1T7EA 1I2UA 1NPIA 2I61A 2YEOA 3PSMA 2E3GA 1JXCA 2LY6A 1SN4A 2E3FA 1ZYVA 2ATBA 4V1DC 2E0HA 2YBRC 1OMYA 2KBJA 1ZFUA 1NRAA 4KYPA 1BK8A 2B3CA 1I6GA 4AAZA 1TI5A 4CQKA 1L4VA 1ZU3A 1AHOA 1FH3A 2KPYA 1BRZA 2KBKA 1I2VA 4HE7A 1JZAA 2LI7A 2KSKA 1B3CA 1KV0A 1OZZA 1LQHA 2KJAA 1PE4A 1C56A 1N4NA 1ZYWA 1LQIA 1VNAA 1T7AA 2SN3A 1LQQA 1JKZA 2B68A 1T1TA 2LR3A 1BCGA 1ZVGA 2NY8X 1PTXA 1I6FA 1VNBA 2ASCA 1GPSA 1T0ZA 2MZ0A 4HHFA 2LY5A 1SNBA 1CN2A 1JZBA 1ZVEA 1C55A 1PX9A
chains in the Genus database with same CATH superfamily
5AQLA 1T7BA 2LN8A 1NH5A 2YC1C 2KYQA 4IO8A 5AQFA 3QFUA 1MR4A 1SN1A 3GDQA 2LT8A 5AQKA 5EXWA 5FPMA 1YUWA 2G2KA 1NE5A 2NY9X 3KVGA 1WMTA 2K35A 3CQXA 5BPMA 4HWIA 1CHZA 4AEIA 2KGQA 4H5TA 5EVZA 1MYNA 3LDQA 3LDPA 1WWNA 1P00A 3KHWA 3KOYA 2MBKA 2N2RA 5AQUA 5AQZA 3IUCA 2D56A 1DKGD 2N69A 1NGCA 3D2FB 4FSVA 3M3ZA 5AR0A 2LKBA 2LJ7A 2KBHA 1SEGA 2QWNA 5F1XA 5AQWA 5AQSA 2E88A 2BUPA 3KP1A 1BA1A 2M8BB 3D2FA 3GL1A 3E7RL 2MN5A 5F2RA 3E7UX 1S3XA 5AQHA 3FZKA 2QWRA 1BMRA 1NGBA 2N2QA 2N66A 4KBOA 5FPDA 3KOZA 1BUPA 5AQRA 2QWOA 1GPTA 1HX1A 1BA0A 1NRBA 1DJTA 1P0AA 3D2EB 2GL1A 3LDOA 5BN9A 4UJ0A 3LDLA 1AYJA 4AB0A 1DQ7A 1WT7A 1XRSB 3KP0A 5BN8A 2LJMA 3D2EA 1ICAA 1B7DA 2BRZA 5CY0A 5F0XA 2KHOA 2YIPA 5KK4A 4H5RA 1ZUTA 2A7TA 1T7EA 5EX5A 1I2UA 1NPIA 4FL9A 2I61A 2YEOA 2QW9A 3PSMA 5AQMA 3R2VA 1K8BA 2E3GA 3QFPA 1JXCA 2LY6A 1SN4A 2E3FA 3L6QA 4H5VA 3GKUA 1ZYVA 2ATBA 1QQNA 2YILA 4V1DC 1NGEA 2E0HA 3CW4A 2YBRC 4UADE 1OMYA 2KBJA 1ZFUA 1NRAA 4KYPA 5AQVA 2B3CA 1BK8A 1I6GA 1NGDA 1TI5A 1UGLA 4AAZA 4CQKA 1HJOA 2QXLA 3LDNA 3JXUA 4UAEF 1ZU3A 2E8AA 1L4VA 1AHOA 3KOWA 3QMLA 5AQOA 2KPYA 1BRZA 1FH3A 3KC6A 2KBKA 5BPLA 3L56A 1I2VA 1NGHA 1KAXA 4HE7A 4H5WA 3FZLA 5AQQA 1JZAA 5EY4A 2LI7A 1ATSA 2KSKA 3A8YA 3AY9A 3FE1A 5FPNA 2JDQD 4GNIA 5AQYA 2YIOA 1B3CA 1KV0A 3ATVA 2QWPA 5AQTA 1OZZA 3FZMA 3BK3C 3I33A 1NGAA 1HPMA 1LQHA 2V7ZA 2KJAA 1PE4A 1C56A 1N4NA 1ZYWA 4UAFE 5AQIA 1POIA 1LQIA 5AQJA 1VNAA 1T7AA 2QWMA 2SN3A 1NGJA 2GMOA 1LQQA 1JKZA 5AQPA 1NGGA 3ATUA 2VY6A 5FPEA 1KAYA 2B68A 1T1TA 2LR3A 1BCGA 1ZVGA 2NY8X 4H5NA 3C7NB 1PTXA 1I6FA 1VNBA 1NGFA 2ASCA 3L4IA 1GPSA 3HSCA 1QQMA 5AQNA 1T0ZA 2MZ0A 1NGIA 2E2FA 2LY5A 1ATRA 3C7NA 3FZHA 3KOXA 3QI7A 4HHFA 1SNBA 5AQXA 1JZBA 3SF4D 5BPNA 1ZVEA 1CN2A 1C55A 5AQGA 2QWLA 2QWQA 1KAZA 3FZFA 1PX9A 1QQOA
chains in the Genus database with same CATH topology
1T7BA 1NH5A 2YC1C 2KYQA 1MR4A 1SN1A 2LT8A 1NE5A 2NY9X 1WMTA 1CHZA 4AEIA 2KGQA 1MYNA 1WWNA 1P00A 2N2RA 2N69A 2LKBA 2LJ7A 2KBHA 1SEGA 2M8BB 3E7RL 3E7UX 1BMRA 2N2QA 2N66A 1GPTA 1NRBA 1DJTA 1P0AA 4UJ0A 2GL1A 1AYJA 4AB0A 1DQ7A 1WT7A 2LJMA 1ICAA 1B7DA 2BRZA 5CY0A 5KK4A 1ZUTA 2A7TA 1T7EA 1I2UA 1NPIA 2I61A 2YEOA 3PSMA 2E3GA 1JXCA 2LY6A 1SN4A 2E3FA 1ZYVA 2ATBA 4V1DC 2E0HA 2YBRC 1OMYA 2KBJA 1ZFUA 1NRAA 4KYPA 1BK8A 2B3CA 1I6GA 4AAZA 1TI5A 4CQKA 1L4VA 1ZU3A 1AHOA 1FH3A 2KPYA 1BRZA 2KBKA 1I2VA 4HE7A 1JZAA 2LI7A 2KSKA 1B3CA 1KV0A 1OZZA 1LQHA 2KJAA 1PE4A 1C56A 1N4NA 1ZYWA 1LQIA 1VNAA 1T7AA 2SN3A 1LQQA 1JKZA 2B68A 1T1TA 2LR3A 1BCGA 1ZVGA 2NY8X 1PTXA 1I6FA 1VNBA 2ASCA 1GPSA 1T0ZA 2MZ0A 4HHFA 2LY5A 1SNBA 1CN2A 1JZBA 1ZVEA 1C55A 1PX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7B A;  1NH5 A;  2YC1 C;  2KYQ A;  1MR4 A;  1SN1 A;  2LT8 A;  1NE5 A;  2NY9 X;  1WMT A;  1CHZ A;  4AEI A;  2KGQ A;  1MYN A;  1WWN A;  1P00 A;  2N2R A;  2N69 A;  2LKB A;  2LJ7 A;  2KBH A;  1SEG A;  2M8B B;  3E7R L;  3E7U X;  1BMR A;  2N2Q A;  2N66 A;  1GPT A;  1NRB A;  1DJT A;  1P0A A;  4UJ0 A;  2GL1 A;  1AYJ A;  4AB0 A;  1DQ7 A;  1WT7 A;  2LJM A;  1ICA A;  1B7D A;  2BRZ A;  5CY0 A;  5KK4 A;  1ZUT A;  2A7T A;  1T7E A;  1I2U A;  1NPI A;  2I61 A;  2YEO A;  3PSM A;  2E3G A;  1JXC A;  2LY6 A;  1SN4 A;  2E3F A;  1ZYV A;  2ATB A;  4V1D C;  2E0H A;  2YBR C;  1OMY A;  2KBJ A;  1ZFU A;  1NRA A;  4KYP A;  1BK8 A;  2B3C A;  1I6G A;  4AAZ A;  1TI5 A;  4CQK A;  1L4V A;  1ZU3 A;  1AHO A;  1FH3 A;  2KPY A;  1BRZ A;  2KBK A;  1I2V A;  4HE7 A;  1JZA A;  2LI7 A;  2KSK A;  1B3C A;  1KV0 A;  1OZZ A;  1LQH A;  2KJA A;  1PE4 A;  1C56 A;  1N4N A;  1ZYW A;  1LQI A;  1VNA A;  1T7A A;  2SN3 A;  1LQQ A;  1JKZ A;  2B68 A;  1T1T A;  2LR3 A;  1BCG A;  1ZVG A;  2NY8 X;  1PTX A;  1I6F A;  1VNB A;  2ASC A;  1GPS A;  1T0Z A;  2MZ0 A;  4HHF A;  2LY5 A;  1SNB A;  1CN2 A;  1JZB A;  1ZVE A;  1C55 A;  1PX9 A; 
#chains in the Genus database with same CATH topology
 5AQL A;  1T7B A;  2LN8 A;  1NH5 A;  2YC1 C;  2KYQ A;  4IO8 A;  5AQF A;  3QFU A;  1MR4 A;  1SN1 A;  3GDQ A;  2LT8 A;  5AQK A;  5EXW A;  5FPM A;  1YUW A;  2G2K A;  1NE5 A;  2NY9 X;  3KVG A;  1WMT A;  2K35 A;  3CQX A;  5BPM A;  4HWI A;  1CHZ A;  4AEI A;  2KGQ A;  4H5T A;  5EVZ A;  1MYN A;  3LDQ A;  3LDP A;  1WWN A;  1P00 A;  3KHW A;  3KOY A;  2MBK A;  2N2R A;  5AQU A;  5AQZ A;  3IUC A;  2D56 A;  1DKG D;  2N69 A;  1NGC A;  3D2F B;  4FSV A;  3M3Z A;  5AR0 A;  2LKB A;  2LJ7 A;  2KBH A;  1SEG A;  2QWN A;  5F1X A;  5AQW A;  5AQS A;  2E88 A;  2BUP A;  3KP1 A;  1BA1 A;  2M8B B;  3D2F A;  3GL1 A;  3E7R L;  2MN5 A;  5F2R A;  3E7U X;  1S3X A;  5AQH A;  3FZK A;  2QWR A;  1BMR A;  1NGB A;  2N2Q A;  2N66 A;  4KBO A;  5FPD A;  3KOZ A;  1BUP A;  5AQR A;  2QWO A;  1GPT A;  1HX1 A;  1BA0 A;  1NRB A;  1DJT A;  1P0A A;  3D2E B;  2GL1 A;  3LDO A;  5BN9 A;  4UJ0 A;  3LDL A;  1AYJ A;  4AB0 A;  1DQ7 A;  1WT7 A;  1XRS B;  3KP0 A;  5BN8 A;  2LJM A;  3D2E A;  1ICA A;  1B7D A;  2BRZ A;  5CY0 A;  5F0X A;  2KHO A;  2YIP A;  5KK4 A;  4H5R A;  1ZUT A;  2A7T A;  1T7E A;  5EX5 A;  1I2U A;  1NPI A;  4FL9 A;  2I61 A;  2YEO A;  2QW9 A;  3PSM A;  5AQM A;  3R2V A;  1K8B A;  2E3G A;  3QFP A;  1JXC A;  2LY6 A;  1SN4 A;  2E3F A;  3L6Q A;  4H5V A;  3GKU A;  1ZYV A;  2ATB A;  1QQN A;  2YIL A;  4V1D C;  1NGE A;  2E0H A;  3CW4 A;  2YBR C;  4UAD E;  1OMY A;  2KBJ A;  1ZFU A;  1NRA A;  4KYP A;  5AQV A;  2B3C A;  1BK8 A;  1I6G A;  1NGD A;  1TI5 A;  1UGL A;  4AAZ A;  4CQK A;  1HJO A;  2QXL A;  3LDN A;  3JXU A;  4UAE F;  1ZU3 A;  2E8A A;  1L4V A;  1AHO A;  3KOW A;  3QML A;  5AQO A;  2KPY A;  1BRZ A;  1FH3 A;  3KC6 A;  2KBK A;  5BPL A;  3L56 A;  1I2V A;  1NGH A;  1KAX A;  4HE7 A;  4H5W A;  3FZL A;  5AQQ A;  1JZA A;  5EY4 A;  2LI7 A;  1ATS A;  2KSK A;  3A8Y A;  3AY9 A;  3FE1 A;  5FPN A;  2JDQ D;  4GNI A;  5AQY A;  2YIO A;  1B3C A;  1KV0 A;  3ATV A;  2QWP A;  5AQT A;  1OZZ A;  3FZM A;  3BK3 C;  3I33 A;  1NGA A;  1HPM A;  1LQH A;  2V7Z A;  2KJA A;  1PE4 A;  1C56 A;  1N4N A;  1ZYW A;  4UAF E;  5AQI A;  1POI A;  1LQI A;  5AQJ A;  1VNA A;  1T7A A;  2QWM A;  2SN3 A;  1NGJ A;  2GMO A;  1LQQ A;  1JKZ A;  5AQP A;  1NGG A;  3ATU A;  2VY6 A;  5FPE A;  1KAY A;  2B68 A;  1T1T A;  2LR3 A;  1BCG A;  1ZVG A;  2NY8 X;  4H5N A;  3C7N B;  1PTX A;  1I6F A;  1VNB A;  1NGF A;  2ASC A;  3L4I A;  1GPS A;  3HSC A;  1QQM A;  5AQN A;  1T0Z A;  2MZ0 A;  1NGI A;  2E2F A;  2LY5 A;  1ATR A;  3C7N A;  3FZH A;  3KOX A;  3QI7 A;  4HHF A;  1SNB A;  5AQX A;  1JZB A;  3SF4 D;  5BPN A;  1ZVE A;  1CN2 A;  1C55 A;  5AQG A;  2QWL A;  2QWQ A;  1KAZ A;  3FZF A;  1PX9 A;  1QQO A; 
#chains in the Genus database with same CATH homology
 1T7B A;  1NH5 A;  2YC1 C;  2KYQ A;  1MR4 A;  1SN1 A;  2LT8 A;  1NE5 A;  2NY9 X;  1WMT A;  1CHZ A;  4AEI A;  2KGQ A;  1MYN A;  1WWN A;  1P00 A;  2N2R A;  2N69 A;  2LKB A;  2LJ7 A;  2KBH A;  1SEG A;  2M8B B;  3E7R L;  3E7U X;  1BMR A;  2N2Q A;  2N66 A;  1GPT A;  1NRB A;  1DJT A;  1P0A A;  4UJ0 A;  2GL1 A;  1AYJ A;  4AB0 A;  1DQ7 A;  1WT7 A;  2LJM A;  1ICA A;  1B7D A;  2BRZ A;  5CY0 A;  5KK4 A;  1ZUT A;  2A7T A;  1T7E A;  1I2U A;  1NPI A;  2I61 A;  2YEO A;  3PSM A;  2E3G A;  1JXC A;  2LY6 A;  1SN4 A;  2E3F A;  1ZYV A;  2ATB A;  4V1D C;  2E0H A;  2YBR C;  1OMY A;  2KBJ A;  1ZFU A;  1NRA A;  4KYP A;  1BK8 A;  2B3C A;  1I6G A;  4AAZ A;  1TI5 A;  4CQK A;  1L4V A;  1ZU3 A;  1AHO A;  1FH3 A;  2KPY A;  1BRZ A;  2KBK A;  1I2V A;  4HE7 A;  1JZA A;  2LI7 A;  2KSK A;  1B3C A;  1KV0 A;  1OZZ A;  1LQH A;  2KJA A;  1PE4 A;  1C56 A;  1N4N A;  1ZYW A;  1LQI A;  1VNA A;  1T7A A;  2SN3 A;  1LQQ A;  1JKZ A;  2B68 A;  1T1T A;  2LR3 A;  1BCG A;  1ZVG A;  2NY8 X;  1PTX A;  1I6F A;  1VNB A;  2ASC A;  1GPS A;  1T0Z A;  2MZ0 A;  4HHF A;  2LY5 A;  1SNB A;  1CN2 A;  1JZB A;  1ZVE A;  1C55 A;  1PX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...