1T1TA

Solution structure of kurtoxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
KIDGYPVDYWNCKRICWYNNKYCNDLCKGLKADSGYCWGWTLSCYCQGLPDNARIKRSGRCRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kurtoxin
publication title Solution structure of kurtoxin
rcsb
source organism Parabuthus transvaalicus
molecule tags Toxin
total genus 9
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2004-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t1tA00
1LQHA 1GPTA 1ZYVA 2N69A 1CN2A 1NRBA 1T7BA 1PTXA 1AYJA 2M8BB 2YEOA 4AAZA 5CY0A 1SNBA 2N2RA 1P00A 1B7DA 1ZUTA 1NE5A 2LI7A 2KGQA 2NY8X 5KK4A 1BRZA 1LQQA 3E7RL 1SN4A 2LKBA 1NH5A 1T7AA 1I6FA 1T0ZA 2A7TA 1N4NA 1NPIA 2NY9X 1DQ7A 4HE7A 1L4VA 2N66A 2YBRC 4AB0A 1JZAA 1SN1A 2ASCA 2BRZA 1JZBA 3E7UX 2LJ7A 3PSMA 1SEGA 1BCGA 1LQIA 2E0HA 2KBHA 1NRAA 2E3FA 2KBJA 2LJMA 2KYQA 1I2UA 1P0AA 2YC1C 1WT7A 1T7EA 1FH3A 1AHOA 2LY6A 2MZ0A 2SN3A 1B3CA 1C55A 1I2VA 1JXCA 1PE4A 1OMYA 2B3CA 1ZU3A 2KBKA 4AEIA 1WMTA 2LY5A 2GL1A 1BK8A 1JKZA 1DJTA 1ZFUA 4HHFA 2LT8A 1C56A 1WWNA 1GPSA 1ZVEA 1ZYWA 2KPYA 2I61A 1ZVGA 1ICAA 4CQKA 1PX9A 2N2QA 1TI5A 4UJ0A 1OZZA 1I6GA 1VNBA 1BMRA 2LR3A 4KYPA 1VNAA 4V1DC 2KJAA 1MR4A 2ATBA 1MYNA 2B68A 2KSKA 2E3GA 1CHZA 1T1TA 1KV0A
chains in the Genus database with same CATH superfamily
1LQHA 1GPTA 3CQXA 1ZYVA 2N69A 1CN2A 1NRBA 3C7NB 1BA1A 1T7BA 1PTXA 5AQKA 1AYJA 3L4IA 2E8AA 5FPDA 5AQYA 2M8BB 2YEOA 5AQHA 5BPMA 4AAZA 2QXLA 3KOWA 3LDLA 4IO8A 2GMOA 5CY0A 2V7ZA 3LDPA 3D2FB 1SNBA 2N2RA 5FPEA 4KBOA 5EX5A 1YUWA 1P00A 1B7DA 1ZUTA 1NE5A 2LI7A 2QWOA 2MBKA 2KGQA 3ATVA 2NY8X 5KK4A 1QQNA 1BRZA 3KVGA 3A8YA 1LQQA 3E7RL 2E88A 1SN4A 2LKBA 4H5VA 3D2EA 1NH5A 1T7AA 1I6FA 5AQFA 1T0ZA 1NGJA 1S3XA 5AQSA 2JDQD 2A7TA 1N4NA 1NPIA 4FL9A 3LDNA 2NY9X 1DQ7A 4HE7A 5AQZA 1KAXA 5BPNA 5AQJA 1NGGA 2G2KA 1L4VA 4HWIA 2N66A 2YBRC 1NGIA 1JZAA 3C7NA 4AB0A 4H5WA 1SN1A 1BUPA 3LDOA 2ASCA 3L6QA 2BRZA 1JZBA 3AY9A 3E7UX 2LJ7A 1ATRA 3PSMA 3QI7A 3KOYA 3QMLA 1SEGA 1BCGA 1XRSB 2QW9A 2YIPA 1LQIA 3D2FA 3CW4A 1NGAA 2E0HA 5AQRA 2KBHA 5BPLA 3FZKA 3GL1A 1NRAA 5AQMA 3FZLA 5AQTA 2BUPA 1NGBA 2E3FA 2KBJA 2KYQA 2LJMA 2E2FA 5EVZA 3SF4D 1I2UA 1P0AA 3LDQA 2YC1C 1WT7A 1T7EA 2VY6A 5AR0A 2QWNA 2LN8A 1FH3A 1AHOA 1HX1A 3QFPA 2LY6A 2MZ0A 2SN3A 4UAEF 5AQGA 5AQXA 1B3CA 1C55A 1JXCA 1POIA 1I2VA 3ATUA 1PE4A 5AQVA 1ATSA 1OMYA 2B3CA 1ZU3A 2KBKA 2YILA 3KP1A 4AEIA 2QWPA 3GDQA 1WMTA 2LY5A 1NGEA 2GL1A 5EXWA 2YIOA 3D2EB 5FPMA 1BK8A 3HSCA 3FE1A 1HPMA 2KHOA 2D56A 1JKZA 1DJTA 1ZFUA 3KOXA 4HHFA 3FZHA 2QWMA 5AQIA 2LT8A 1C56A 1WWNA 1QQOA 3KOZA 3R2VA 1GPSA 1NGHA 1ZVEA 2QWQA 5AQOA 4H5NA 1ZYWA 2KPYA 2I61A 1ZVGA 2MN5A 3GKUA 1ICAA 3KC6A 5F2RA 3L56A 5FPNA 4CQKA 1PX9A 1BA0A 1QQMA 3IUCA 3QFUA 5EY4A 1K8BA 2N2QA 1NGCA 1TI5A 1OZZA 4UJ0A 4H5RA 5F1XA 1NGFA 5AQNA 5F0XA 1I6GA 3KP0A 4UAFE 4H5TA 1VNBA 3KHWA 5AQWA 1UGLA 3FZMA 1BMRA 2QWRA 4UADE 2LR3A 4FSVA 1HJOA 3BK3C 4GNIA 4KYPA 5BN9A 1VNAA 1NGDA 3JXUA 1DKGD 4V1DC 2KJAA 5BN8A 3I33A 1MR4A 1KAYA 1KAZA 5AQUA 3FZFA 5AQPA 3M3ZA 2ATBA 2K35A 5AQLA 1MYNA 2B68A 2KSKA 2QWLA 2E3GA 1CHZA 5AQQA 1T1TA 1KV0A
chains in the Genus database with same CATH topology
1LQHA 1GPTA 1ZYVA 2N69A 1CN2A 1NRBA 1T7BA 1PTXA 1AYJA 2M8BB 2YEOA 4AAZA 5CY0A 1SNBA 2N2RA 1P00A 1B7DA 1ZUTA 1NE5A 2LI7A 2KGQA 2NY8X 5KK4A 1BRZA 1LQQA 3E7RL 1SN4A 2LKBA 1NH5A 1T7AA 1I6FA 1T0ZA 2A7TA 1N4NA 1NPIA 2NY9X 1DQ7A 4HE7A 1L4VA 2N66A 2YBRC 4AB0A 1JZAA 1SN1A 2ASCA 2BRZA 1JZBA 3E7UX 2LJ7A 3PSMA 1SEGA 1BCGA 1LQIA 2E0HA 2KBHA 1NRAA 2E3FA 2KBJA 2LJMA 2KYQA 1I2UA 1P0AA 2YC1C 1WT7A 1T7EA 1FH3A 1AHOA 2LY6A 2MZ0A 2SN3A 1B3CA 1C55A 1I2VA 1JXCA 1PE4A 1OMYA 2B3CA 1ZU3A 2KBKA 4AEIA 1WMTA 2LY5A 2GL1A 1BK8A 1JKZA 1DJTA 1ZFUA 4HHFA 2LT8A 1C56A 1WWNA 1GPSA 1ZVEA 1ZYWA 2KPYA 2I61A 1ZVGA 1ICAA 4CQKA 1PX9A 2N2QA 1TI5A 4UJ0A 1OZZA 1I6GA 1VNBA 1BMRA 2LR3A 4KYPA 1VNAA 4V1DC 2KJAA 1MR4A 2ATBA 1MYNA 2B68A 2KSKA 2E3GA 1CHZA 1T1TA 1KV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQH A;  1GPT A;  1ZYV A;  2N69 A;  1CN2 A;  1NRB A;  1T7B A;  1PTX A;  1AYJ A;  2M8B B;  2YEO A;  4AAZ A;  5CY0 A;  1SNB A;  2N2R A;  1P00 A;  1B7D A;  1ZUT A;  1NE5 A;  2LI7 A;  2KGQ A;  2NY8 X;  5KK4 A;  1BRZ A;  1LQQ A;  3E7R L;  1SN4 A;  2LKB A;  1NH5 A;  1T7A A;  1I6F A;  1T0Z A;  2A7T A;  1N4N A;  1NPI A;  2NY9 X;  1DQ7 A;  4HE7 A;  1L4V A;  2N66 A;  2YBR C;  4AB0 A;  1JZA A;  1SN1 A;  2ASC A;  2BRZ A;  1JZB A;  3E7U X;  2LJ7 A;  3PSM A;  1SEG A;  1BCG A;  1LQI A;  2E0H A;  2KBH A;  1NRA A;  2E3F A;  2KBJ A;  2LJM A;  2KYQ A;  1I2U A;  1P0A A;  2YC1 C;  1WT7 A;  1T7E A;  1FH3 A;  1AHO A;  2LY6 A;  2MZ0 A;  2SN3 A;  1B3C A;  1C55 A;  1I2V A;  1JXC A;  1PE4 A;  1OMY A;  2B3C A;  1ZU3 A;  2KBK A;  4AEI A;  1WMT A;  2LY5 A;  2GL1 A;  1BK8 A;  1JKZ A;  1DJT A;  1ZFU A;  4HHF A;  2LT8 A;  1C56 A;  1WWN A;  1GPS A;  1ZVE A;  1ZYW A;  2KPY A;  2I61 A;  1ZVG A;  1ICA A;  4CQK A;  1PX9 A;  2N2Q A;  1TI5 A;  4UJ0 A;  1OZZ A;  1I6G A;  1VNB A;  1BMR A;  2LR3 A;  4KYP A;  1VNA A;  4V1D C;  2KJA A;  1MR4 A;  2ATB A;  1MYN A;  2B68 A;  2KSK A;  2E3G A;  1CHZ A;  1T1T A;  1KV0 A; 
#chains in the Genus database with same CATH topology
 1LQH A;  1GPT A;  3CQX A;  1ZYV A;  2N69 A;  1CN2 A;  1NRB A;  3C7N B;  1BA1 A;  1T7B A;  1PTX A;  5AQK A;  1AYJ A;  3L4I A;  2E8A A;  5FPD A;  5AQY A;  2M8B B;  2YEO A;  5AQH A;  5BPM A;  4AAZ A;  2QXL A;  3KOW A;  3LDL A;  4IO8 A;  2GMO A;  5CY0 A;  2V7Z A;  3LDP A;  3D2F B;  1SNB A;  2N2R A;  5FPE A;  4KBO A;  5EX5 A;  1YUW A;  1P00 A;  1B7D A;  1ZUT A;  1NE5 A;  2LI7 A;  2QWO A;  2MBK A;  2KGQ A;  3ATV A;  2NY8 X;  5KK4 A;  1QQN A;  1BRZ A;  3KVG A;  3A8Y A;  1LQQ A;  3E7R L;  2E88 A;  1SN4 A;  2LKB A;  4H5V A;  3D2E A;  1NH5 A;  1T7A A;  1I6F A;  5AQF A;  1T0Z A;  1NGJ A;  1S3X A;  5AQS A;  2JDQ D;  2A7T A;  1N4N A;  1NPI A;  4FL9 A;  3LDN A;  2NY9 X;  1DQ7 A;  4HE7 A;  5AQZ A;  1KAX A;  5BPN A;  5AQJ A;  1NGG A;  2G2K A;  1L4V A;  4HWI A;  2N66 A;  2YBR C;  1NGI A;  1JZA A;  3C7N A;  4AB0 A;  4H5W A;  1SN1 A;  1BUP A;  3LDO A;  2ASC A;  3L6Q A;  2BRZ A;  1JZB A;  3AY9 A;  3E7U X;  2LJ7 A;  1ATR A;  3PSM A;  3QI7 A;  3KOY A;  3QML A;  1SEG A;  1BCG A;  1XRS B;  2QW9 A;  2YIP A;  1LQI A;  3D2F A;  3CW4 A;  1NGA A;  2E0H A;  5AQR A;  2KBH A;  5BPL A;  3FZK A;  3GL1 A;  1NRA A;  5AQM A;  3FZL A;  5AQT A;  2BUP A;  1NGB A;  2E3F A;  2KBJ A;  2KYQ A;  2LJM A;  2E2F A;  5EVZ A;  3SF4 D;  1I2U A;  1P0A A;  3LDQ A;  2YC1 C;  1WT7 A;  1T7E A;  2VY6 A;  5AR0 A;  2QWN A;  2LN8 A;  1FH3 A;  1AHO A;  1HX1 A;  3QFP A;  2LY6 A;  2MZ0 A;  2SN3 A;  4UAE F;  5AQG A;  5AQX A;  1B3C A;  1C55 A;  1JXC A;  1POI A;  1I2V A;  3ATU A;  1PE4 A;  5AQV A;  1ATS A;  1OMY A;  2B3C A;  1ZU3 A;  2KBK A;  2YIL A;  3KP1 A;  4AEI A;  2QWP A;  3GDQ A;  1WMT A;  2LY5 A;  1NGE A;  2GL1 A;  5EXW A;  2YIO A;  3D2E B;  5FPM A;  1BK8 A;  3HSC A;  3FE1 A;  1HPM A;  2KHO A;  2D56 A;  1JKZ A;  1DJT A;  1ZFU A;  3KOX A;  4HHF A;  3FZH A;  2QWM A;  5AQI A;  2LT8 A;  1C56 A;  1WWN A;  1QQO A;  3KOZ A;  3R2V A;  1GPS A;  1NGH A;  1ZVE A;  2QWQ A;  5AQO A;  4H5N A;  1ZYW A;  2KPY A;  2I61 A;  1ZVG A;  2MN5 A;  3GKU A;  1ICA A;  3KC6 A;  5F2R A;  3L56 A;  5FPN A;  4CQK A;  1PX9 A;  1BA0 A;  1QQM A;  3IUC A;  3QFU A;  5EY4 A;  1K8B A;  2N2Q A;  1NGC A;  1TI5 A;  1OZZ A;  4UJ0 A;  4H5R A;  5F1X A;  1NGF A;  5AQN A;  5F0X A;  1I6G A;  3KP0 A;  4UAF E;  4H5T A;  1VNB A;  3KHW A;  5AQW A;  1UGL A;  3FZM A;  1BMR A;  2QWR A;  4UAD E;  2LR3 A;  4FSV A;  1HJO A;  3BK3 C;  4GNI A;  4KYP A;  5BN9 A;  1VNA A;  1NGD A;  3JXU A;  1DKG D;  4V1D C;  2KJA A;  5BN8 A;  3I33 A;  1MR4 A;  1KAY A;  1KAZ A;  5AQU A;  3FZF A;  5AQP A;  3M3Z A;  2ATB A;  2K35 A;  5AQL A;  1MYN A;  2B68 A;  2KSK A;  2QWL A;  2E3G A;  1CHZ A;  5AQQ A;  1T1T A;  1KV0 A; 
#chains in the Genus database with same CATH homology
 1LQH A;  1GPT A;  1ZYV A;  2N69 A;  1CN2 A;  1NRB A;  1T7B A;  1PTX A;  1AYJ A;  2M8B B;  2YEO A;  4AAZ A;  5CY0 A;  1SNB A;  2N2R A;  1P00 A;  1B7D A;  1ZUT A;  1NE5 A;  2LI7 A;  2KGQ A;  2NY8 X;  5KK4 A;  1BRZ A;  1LQQ A;  3E7R L;  1SN4 A;  2LKB A;  1NH5 A;  1T7A A;  1I6F A;  1T0Z A;  2A7T A;  1N4N A;  1NPI A;  2NY9 X;  1DQ7 A;  4HE7 A;  1L4V A;  2N66 A;  2YBR C;  4AB0 A;  1JZA A;  1SN1 A;  2ASC A;  2BRZ A;  1JZB A;  3E7U X;  2LJ7 A;  3PSM A;  1SEG A;  1BCG A;  1LQI A;  2E0H A;  2KBH A;  1NRA A;  2E3F A;  2KBJ A;  2LJM A;  2KYQ A;  1I2U A;  1P0A A;  2YC1 C;  1WT7 A;  1T7E A;  1FH3 A;  1AHO A;  2LY6 A;  2MZ0 A;  2SN3 A;  1B3C A;  1C55 A;  1I2V A;  1JXC A;  1PE4 A;  1OMY A;  2B3C A;  1ZU3 A;  2KBK A;  4AEI A;  1WMT A;  2LY5 A;  2GL1 A;  1BK8 A;  1JKZ A;  1DJT A;  1ZFU A;  4HHF A;  2LT8 A;  1C56 A;  1WWN A;  1GPS A;  1ZVE A;  1ZYW A;  2KPY A;  2I61 A;  1ZVG A;  1ICA A;  4CQK A;  1PX9 A;  2N2Q A;  1TI5 A;  4UJ0 A;  1OZZ A;  1I6G A;  1VNB A;  1BMR A;  2LR3 A;  4KYP A;  1VNA A;  4V1D C;  2KJA A;  1MR4 A;  2ATB A;  1MYN A;  2B68 A;  2KSK A;  2E3G A;  1CHZ A;  1T1T A;  1KV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...