4UAEF

Importin alpha 3 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
VESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Importin subunit alpha-3
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uaeF00
3KC6A 4UAFE 2GMOA 2VY6A 3R2VA 4UAEF 2JDQD 3KHWA 3L56A 3CW4A 4UADE
chains in the Genus database with same CATH superfamily
4AAZA 1T0ZA 1VNAA 5AQLA 3KC6A 4V1DC 3FZKA 2KBKA 4UAFE 3LDOA 5AQXA 3KOZA 1SN4A 2D56A 2E0HA 1PTXA 1PE4A 1NRAA 5AQYA 5EXWA 1CN2A 1BCGA 5AQIA 4AB0A 5FPMA 1NGIA 2B68A 3KP1A 1MR4A 1NGBA 5BPNA 3FZLA 2LI7A 2BUPA 3A8YA 5AQNA 3BK3C 2I61A 3E7RL 1GPTA 4KYPA 3L6QA 5AQMA 3FE1A 4H5NA 1JKZA 1NGGA 1OMYA 3KOXA 3L4IA 1I2VA 2BRZA 1I2UA 1QQOA 1WT7A 5FPEA 5EVZA 1ICAA 1BUPA 2YC1C 1MYNA 2QW9A 3M3ZA 1L4VA 3E7UX 3KOWA 5AQTA 2M8BB 2KBJA 3GKUA 1HX1A 3QFUA 1BRZA 2QWPA 3D2EB 5FPDA 2E88A 1DJTA 5F2RA 1ZYVA 1NGFA 1OZZA 2E8AA 3AY9A 1YUWA 4KBOA 5FPNA 1ZU3A 5AQUA 1CHZA 1ZYWA 2N2QA 2MZ0A 3D2FA 3R2VA 1NGHA 1ZVGA 5AQHA 2E3GA 1BMRA 1BK8A 2NY9X 5AQFA 2NY8X 2KPYA 1NGJA 1HPMA 1N4NA 2QWRA 3L56A 3QMLA 1ZUTA 2LN8A 2KHOA 3IUCA 2YILA 1C56A 2LY5A 1NRBA 1ZFUA 1SEGA 1WWNA 2LKBA 3CW4A 4IO8A 5AQOA 1C55A 1K8BA 1VNBA 3QFPA 2A7TA 5EY4A 2ASCA 1ZVEA 2VY6A 5BN8A 3C7NA 4HHFA 4FSVA 2N69A 3LDLA 5AQWA 5CY0A 4UJ0A 1XRSB 5AQRA 1GPSA 1NGCA 1I6GA 1JXCA 1LQIA 1QQNA 1ATSA 1KAZA 2QWNA 4GNIA 2V7ZA 1ATRA 3ATUA 3KP0A 5F0XA 2QWQA 2KBHA 2YBRC 2QXLA 5AQKA 3CQXA 2E2FA 2QWOA 2LY6A 2LR3A 1POIA 2SN3A 3FZFA 1NGEA 3PSMA 5BPLA 1KV0A 1NE5A 2KYQA 3KVGA 5AQGA 1FH3A 2KJAA 1NGDA 1T1TA 5KK4A 3GL1A 2YIPA 5AQZA 3LDNA 1JZBA 1PX9A 2ATBA 1NGAA 4UAEF 5BPMA 4H5VA 4HWIA 4UADE 1BA0A 2YEOA 3FZMA 3HSCA 1HJOA 5AQVA 1SNBA 5EX5A 5AQJA 4H5TA 5AQQA 1BA1A 3LDQA 2QWLA 2N2RA 1KAXA 1NH5A 1P0AA 3QI7A 1JZAA 4HE7A 2LT8A 3I33A 5AQPA 4H5WA 1B7DA 1DQ7A 1I6FA 1LQHA 1T7BA 1DKGD 2B3CA 1TI5A 3ATVA 3JXUA 4FL9A 1P00A 2GL1A 2JDQD 5AR0A 3KHWA 3GDQA 5F1XA 5BN9A 1UGLA 1B3CA 2MBKA 2LJMA 1QQMA 1WMTA 2KGQA 2LJ7A 1NPIA 2K35A 1SN1A 2MN5A 1LQQA 1S3XA 3D2EA 4H5RA 3SF4D 3C7NB 2N66A 2QWMA 5AQSA 3LDPA 2E3FA 3FZHA 1AHOA 2GMOA 2KSKA 2YIOA 1AYJA 1T7EA 4CQKA 3KOYA 2G2KA 1T7AA 1KAYA 3D2FB 4AEIA
chains in the Genus database with same CATH topology
5AQLA 3KC6A 3FZKA 4UAFE 5AQXA 3LDOA 2D56A 5AQYA 5EXWA 5AQIA 5FPMA 1NGIA 1NGBA 5BPNA 3FZLA 2BUPA 3A8YA 5AQNA 3BK3C 3L6QA 5AQMA 3FE1A 4H5NA 1NGGA 3L4IA 1QQOA 5EVZA 1BUPA 2QW9A 3M3ZA 5AQTA 1HX1A 3QFUA 2QWPA 3D2EB 5FPDA 2E88A 5F2RA 1NGFA 2E8AA 3AY9A 1YUWA 4KBOA 5FPNA 5AQUA 3R2VA 3D2FA 5AQHA 1NGHA 5AQFA 2QWRA 3L56A 1NGJA 1HPMA 3QMLA 2LN8A 2KHOA 3IUCA 2YILA 3CW4A 4IO8A 5AQOA 5EY4A 3QFPA 2VY6A 5BN8A 3C7NA 4FSVA 3LDLA 5AQWA 5AQRA 1NGCA 1QQNA 1ATSA 1KAZA 2QWNA 4GNIA 2V7ZA 1ATRA 3ATUA 5F0XA 2QWQA 2QXLA 5AQKA 3CQXA 2E2FA 1POIA 3FZFA 1NGEA 5BPLA 5AQGA 3KVGA 1NGDA 3GL1A 2YIPA 5AQZA 3LDNA 1NGAA 4UAEF 5BPMA 4H5VA 4HWIA 4UADE 3HSCA 1BA0A 3FZMA 5AQVA 1HJOA 5EX5A 5AQJA 4H5TA 5AQQA 1BA1A 3LDQA 2QWLA 1KAXA 3QI7A 3I33A 5AQPA 4H5WA 3ATVA 3JXUA 1DKGD 4FL9A 5AR0A 2JDQD 3KHWA 3GDQA 5F1XA 5BN9A 2MBKA 2MN5A 1QQMA 2QWOA 5FPEA 2K35A 3SF4D 3D2EA 1S3XA 4H5RA 3C7NB 5AQSA 2QWMA 3LDPA 3FZHA 2GMOA 2YIOA 1KAYA 3D2FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KC6 A;  4UAF E;  2GMO A;  2VY6 A;  3R2V A;  4UAE F;  2JDQ D;  3KHW A;  3L56 A;  3CW4 A;  4UAD E; 
#chains in the Genus database with same CATH topology
 4AAZ A;  1T0Z A;  1VNA A;  5AQL A;  3KC6 A;  4V1D C;  3FZK A;  2KBK A;  4UAF E;  3LDO A;  5AQX A;  3KOZ A;  1SN4 A;  2D56 A;  2E0H A;  1PTX A;  1PE4 A;  1NRA A;  5AQY A;  5EXW A;  1CN2 A;  1BCG A;  5AQI A;  4AB0 A;  5FPM A;  1NGI A;  2B68 A;  3KP1 A;  1MR4 A;  1NGB A;  5BPN A;  3FZL A;  2LI7 A;  2BUP A;  3A8Y A;  5AQN A;  3BK3 C;  2I61 A;  3E7R L;  1GPT A;  4KYP A;  3L6Q A;  5AQM A;  3FE1 A;  4H5N A;  1JKZ A;  1NGG A;  1OMY A;  3KOX A;  3L4I A;  1I2V A;  2BRZ A;  1I2U A;  1QQO A;  1WT7 A;  5FPE A;  5EVZ A;  1ICA A;  1BUP A;  2YC1 C;  1MYN A;  2QW9 A;  3M3Z A;  1L4V A;  3E7U X;  3KOW A;  5AQT A;  2M8B B;  2KBJ A;  3GKU A;  1HX1 A;  3QFU A;  1BRZ A;  2QWP A;  3D2E B;  5FPD A;  2E88 A;  1DJT A;  5F2R A;  1ZYV A;  1NGF A;  1OZZ A;  2E8A A;  3AY9 A;  1YUW A;  4KBO A;  5FPN A;  1ZU3 A;  5AQU A;  1CHZ A;  1ZYW A;  2N2Q A;  2MZ0 A;  3D2F A;  3R2V A;  1NGH A;  1ZVG A;  5AQH A;  2E3G A;  1BMR A;  1BK8 A;  2NY9 X;  5AQF A;  2NY8 X;  2KPY A;  1NGJ A;  1HPM A;  1N4N A;  2QWR A;  3L56 A;  3QML A;  1ZUT A;  2LN8 A;  2KHO A;  3IUC A;  2YIL A;  1C56 A;  2LY5 A;  1NRB A;  1ZFU A;  1SEG A;  1WWN A;  2LKB A;  3CW4 A;  4IO8 A;  5AQO A;  1C55 A;  1K8B A;  1VNB A;  3QFP A;  2A7T A;  5EY4 A;  2ASC A;  1ZVE A;  2VY6 A;  5BN8 A;  3C7N A;  4HHF A;  4FSV A;  2N69 A;  3LDL A;  5AQW A;  5CY0 A;  4UJ0 A;  1XRS B;  5AQR A;  1GPS A;  1NGC A;  1I6G A;  1JXC A;  1LQI A;  1QQN A;  1ATS A;  1KAZ A;  2QWN A;  4GNI A;  2V7Z A;  1ATR A;  3ATU A;  3KP0 A;  5F0X A;  2QWQ A;  2KBH A;  2YBR C;  2QXL A;  5AQK A;  3CQX A;  2E2F A;  2QWO A;  2LY6 A;  2LR3 A;  1POI A;  2SN3 A;  3FZF A;  1NGE A;  3PSM A;  5BPL A;  1KV0 A;  1NE5 A;  2KYQ A;  3KVG A;  5AQG A;  1FH3 A;  2KJA A;  1NGD A;  1T1T A;  5KK4 A;  3GL1 A;  2YIP A;  5AQZ A;  3LDN A;  1JZB A;  1PX9 A;  2ATB A;  1NGA A;  4UAE F;  5BPM A;  4H5V A;  4HWI A;  4UAD E;  1BA0 A;  2YEO A;  3FZM A;  3HSC A;  1HJO A;  5AQV A;  1SNB A;  5EX5 A;  5AQJ A;  4H5T A;  5AQQ A;  1BA1 A;  3LDQ A;  2QWL A;  2N2R A;  1KAX A;  1NH5 A;  1P0A A;  3QI7 A;  1JZA A;  4HE7 A;  2LT8 A;  3I33 A;  5AQP A;  4H5W A;  1B7D A;  1DQ7 A;  1I6F A;  1LQH A;  1T7B A;  1DKG D;  2B3C A;  1TI5 A;  3ATV A;  3JXU A;  4FL9 A;  1P00 A;  2GL1 A;  2JDQ D;  5AR0 A;  3KHW A;  3GDQ A;  5F1X A;  5BN9 A;  1UGL A;  1B3C A;  2MBK A;  2LJM A;  1QQM A;  1WMT A;  2KGQ A;  2LJ7 A;  1NPI A;  2K35 A;  1SN1 A;  2MN5 A;  1LQQ A;  1S3X A;  3D2E A;  4H5R A;  3SF4 D;  3C7N B;  2N66 A;  2QWM A;  5AQS A;  3LDP A;  2E3F A;  3FZH A;  1AHO A;  2GMO A;  2KSK A;  2YIO A;  1AYJ A;  1T7E A;  4CQK A;  3KOY A;  2G2K A;  1T7A A;  1KAY A;  3D2F B;  4AEI A; 
#chains in the Genus database with same CATH homology
 5AQL A;  3KC6 A;  3FZK A;  4UAF E;  5AQX A;  3LDO A;  2D56 A;  5AQY A;  5EXW A;  5AQI A;  5FPM A;  1NGI A;  1NGB A;  5BPN A;  3FZL A;  2BUP A;  3A8Y A;  5AQN A;  3BK3 C;  3L6Q A;  5AQM A;  3FE1 A;  4H5N A;  1NGG A;  3L4I A;  1QQO A;  5EVZ A;  1BUP A;  2QW9 A;  3M3Z A;  5AQT A;  1HX1 A;  3QFU A;  2QWP A;  3D2E B;  5FPD A;  2E88 A;  5F2R A;  1NGF A;  2E8A A;  3AY9 A;  1YUW A;  4KBO A;  5FPN A;  5AQU A;  3R2V A;  3D2F A;  5AQH A;  1NGH A;  5AQF A;  2QWR A;  3L56 A;  1NGJ A;  1HPM A;  3QML A;  2LN8 A;  2KHO A;  3IUC A;  2YIL A;  3CW4 A;  4IO8 A;  5AQO A;  5EY4 A;  3QFP A;  2VY6 A;  5BN8 A;  3C7N A;  4FSV A;  3LDL A;  5AQW A;  5AQR A;  1NGC A;  1QQN A;  1ATS A;  1KAZ A;  2QWN A;  4GNI A;  2V7Z A;  1ATR A;  3ATU A;  5F0X A;  2QWQ A;  2QXL A;  5AQK A;  3CQX A;  2E2F A;  1POI A;  3FZF A;  1NGE A;  5BPL A;  5AQG A;  3KVG A;  1NGD A;  3GL1 A;  2YIP A;  5AQZ A;  3LDN A;  1NGA A;  4UAE F;  5BPM A;  4H5V A;  4HWI A;  4UAD E;  3HSC A;  1BA0 A;  3FZM A;  5AQV A;  1HJO A;  5EX5 A;  5AQJ A;  4H5T A;  5AQQ A;  1BA1 A;  3LDQ A;  2QWL A;  1KAX A;  3QI7 A;  3I33 A;  5AQP A;  4H5W A;  3ATV A;  3JXU A;  1DKG D;  4FL9 A;  5AR0 A;  2JDQ D;  3KHW A;  3GDQ A;  5F1X A;  5BN9 A;  2MBK A;  2MN5 A;  1QQM A;  2QWO A;  5FPE A;  2K35 A;  3SF4 D;  3D2E A;  1S3X A;  4H5R A;  3C7N B;  5AQS A;  2QWM A;  3LDP A;  3FZH A;  2GMO A;  2YIO A;  1KAY A;  3D2F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...