4UAEF

Importin alpha 3 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
VESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Importin subunit alpha-3
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uaeF00
3KHWA 3CW4A 3R2VA 2JDQD 4UAEF 3KC6A 3L56A 4UADE 4UAFE 2VY6A 2GMOA
chains in the Genus database with same CATH superfamily
1T7AA 1NH5A 3KOWA 1JZBA 3ATVA 4GNIA 2KBHA 4UAFE 2GL1A 5AQPA 1NPIA 2E2FA 2QWMA 4HE7A 4V1DC 1KAYA 1I2UA 2N66A 3D2EB 1BA0A 1WMTA 5AQWA 1BA1A 3M3ZA 5BN9A 3QI7A 4CQKA 1BRZA 2QWRA 1CHZA 5AQHA 1CN2A 2BUPA 1WT7A 1NGDA 3LDPA 1TI5A 2LKBA 3JXUA 5AQMA 5EXWA 5FPEA 1NE5A 3CQXA 4H5VA 2KBKA 2LN8A 1ZU3A 1AHOA 1NGBA 4UJ0A 3GKUA 3I33A 2QWOA 1LQIA 1ZFUA 3D2FA 1P00A 3KOXA 2NY8X 2K35A 2SN3A 3LDQA 5AQFA 1NGCA 2QXLA 2N69A 5AQTA 5AQUA 2QWNA 1NRBA 5F0XA 2E0HA 2E3FA 2N2QA 2A7TA 2G2KA 1NGFA 1I6FA 1N4NA 3D2FB 1T7EA 2KGQA 1NGAA 5AR0A 5AQIA 5EY4A 1NGGA 3BK3C 1VNAA 1NGJA 2E88A 1BMRA 2KPYA 3FZMA 1B7DA 4H5NA 3KP1A 3A8YA 2LT8A 1T7BA 3SF4D 1JXCA 1QQOA 2LI7A 3KC6A 3L56A 1GPTA 1UGLA 1NGHA 1SNBA 5AQYA 1SEGA 1HJOA 2MN5A 2VY6A 2KBJA 5AQKA 5AQLA 3FZFA 1JKZA 5AQXA 5AQRA 1ATRA 3E7RL 3HSCA 3QMLA 4FSVA 1LQHA 1PTXA 2KSKA 3LDOA 1ZUTA 4AEIA 2I61A 2E8AA 3CW4A 1YUWA 3LDLA 4FL9A 4UAEF 1ATSA 5AQQA 3AY9A 5EX5A 4AAZA 3L6QA 2ASCA 1B3CA 1I2VA 5FPDA 2KYQA 1L4VA 2MZ0A 5AQVA 5BPMA 5KK4A 3C7NA 1DQ7A 2N2RA 3KOZA 1NGEA 3QFPA 5AQJA 5AQSA 3QFUA 1K8BA 1ZVGA 3KP0A 3FE1A 1DJTA 3GDQA 1HX1A 1T0ZA 1ZYVA 3KHWA 5BPNA 5AQZA 2QWPA 1AYJA 1BCGA 2MBKA 5AQNA 3C7NB 1GPSA 2LY6A 2YILA 3GL1A 3PSMA 5F2RA 1C55A 2QWLA 2KJAA 2LJMA 4HWIA 3FZHA 2YC1C 4H5TA 2B3CA 1OMYA 1I6GA 1WWNA 4HHFA 3R2VA 2JDQD 2YIOA 1HPMA 3IUCA 1S3XA 4KYPA 1NGIA 5BN8A 4KBOA 1MYNA 4AB0A 3FZLA 3LDNA 1POIA 3E7UX 1XRSB 2NY9X 2YBRC 2ATBA 1OZZA 1ZVEA 5FPNA 2QWQA 5AQOA 2M8BB 1BK8A 1ICAA 1JZAA 5F1XA 1DKGD 1QQNA 3ATUA 5FPMA 2BRZA 2D56A 1KAXA 5CY0A 3FZKA 2QW9A 3KVGA 5BPLA 1C56A 1KV0A 1KAZA 1QQMA 2LR3A 2B68A 2KHOA 1PE4A 1SN1A 5AQGA 1BUPA 1SN4A 2V7ZA 2GMOA 2LY5A 5EVZA 2LJ7A 1T1TA 1ZYWA 3KOYA 1VNBA 2E3GA 1MR4A 3L4IA 1PX9A 1P0AA 4H5WA 4IO8A 4UADE 4H5RA 2YIPA 3D2EA 1LQQA 2YEOA 1FH3A 1NRAA
chains in the Genus database with same CATH topology
4GNIA 3ATVA 5AQPA 4UAFE 2E2FA 2QWMA 1KAYA 3D2EB 1BA0A 5AQWA 1BA1A 3M3ZA 5BN9A 3QI7A 2QWRA 5AQHA 2BUPA 1NGDA 3LDPA 5AQMA 3JXUA 5EXWA 5FPEA 3CQXA 4H5VA 2LN8A 1NGBA 3I33A 2QWOA 3D2FA 2K35A 3LDQA 5AQFA 1NGCA 2QXLA 5AQTA 5AQUA 2QWNA 5F0XA 1NGFA 3D2FB 5AR0A 5EY4A 1NGAA 5AQIA 1NGGA 3BK3C 1NGJA 2E88A 3FZMA 4H5NA 3A8YA 3SF4D 1QQOA 3KC6A 3L56A 1NGHA 5AQYA 2MN5A 1HJOA 2VY6A 5AQKA 5AQLA 3FZFA 5AQXA 5AQRA 1ATRA 3HSCA 3QMLA 4FSVA 3LDOA 2E8AA 3CW4A 1YUWA 3LDLA 4FL9A 4UAEF 1ATSA 5AQQA 3AY9A 5EX5A 3L6QA 5FPDA 5AQVA 5BPMA 3C7NA 3QFPA 5AQSA 1NGEA 5AQJA 3QFUA 3FE1A 3GDQA 1HX1A 3KHWA 5BPNA 5AQZA 2QWPA 5AQNA 2MBKA 3C7NB 2YILA 3GL1A 5F2RA 2QWLA 4HWIA 3FZHA 4H5TA 3R2VA 2JDQD 2YIOA 1HPMA 3IUCA 1S3XA 1NGIA 5BN8A 4KBOA 3FZLA 3LDNA 1POIA 5FPNA 2QWQA 5AQOA 5F1XA 1DKGD 1QQNA 3ATUA 5FPMA 2D56A 1KAXA 3FZKA 2QW9A 3KVGA 5BPLA 1KAZA 1QQMA 5AQGA 2KHOA 1BUPA 2V7ZA 2GMOA 5EVZA 4UADE 3L4IA 4IO8A 4H5WA 4H5RA 2YIPA 3D2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHW A;  3CW4 A;  3R2V A;  2JDQ D;  4UAE F;  3KC6 A;  3L56 A;  4UAD E;  4UAF E;  2VY6 A;  2GMO A; 
#chains in the Genus database with same CATH topology
 1T7A A;  1NH5 A;  3KOW A;  1JZB A;  3ATV A;  4GNI A;  2KBH A;  4UAF E;  2GL1 A;  5AQP A;  1NPI A;  2E2F A;  2QWM A;  4HE7 A;  4V1D C;  1KAY A;  1I2U A;  2N66 A;  3D2E B;  1BA0 A;  1WMT A;  5AQW A;  1BA1 A;  3M3Z A;  5BN9 A;  3QI7 A;  4CQK A;  1BRZ A;  2QWR A;  1CHZ A;  5AQH A;  1CN2 A;  2BUP A;  1WT7 A;  1NGD A;  3LDP A;  1TI5 A;  2LKB A;  3JXU A;  5AQM A;  5EXW A;  5FPE A;  1NE5 A;  3CQX A;  4H5V A;  2KBK A;  2LN8 A;  1ZU3 A;  1AHO A;  1NGB A;  4UJ0 A;  3GKU A;  3I33 A;  2QWO A;  1LQI A;  1ZFU A;  3D2F A;  1P00 A;  3KOX A;  2NY8 X;  2K35 A;  2SN3 A;  3LDQ A;  5AQF A;  1NGC A;  2QXL A;  2N69 A;  5AQT A;  5AQU A;  2QWN A;  1NRB A;  5F0X A;  2E0H A;  2E3F A;  2N2Q A;  2A7T A;  2G2K A;  1NGF A;  1I6F A;  1N4N A;  3D2F B;  1T7E A;  2KGQ A;  1NGA A;  5AR0 A;  5AQI A;  5EY4 A;  1NGG A;  3BK3 C;  1VNA A;  1NGJ A;  2E88 A;  1BMR A;  2KPY A;  3FZM A;  1B7D A;  4H5N A;  3KP1 A;  3A8Y A;  2LT8 A;  1T7B A;  3SF4 D;  1JXC A;  1QQO A;  2LI7 A;  3KC6 A;  3L56 A;  1GPT A;  1UGL A;  1NGH A;  1SNB A;  5AQY A;  1SEG A;  1HJO A;  2MN5 A;  2VY6 A;  2KBJ A;  5AQK A;  5AQL A;  3FZF A;  1JKZ A;  5AQX A;  5AQR A;  1ATR A;  3E7R L;  3HSC A;  3QML A;  4FSV A;  1LQH A;  1PTX A;  2KSK A;  3LDO A;  1ZUT A;  4AEI A;  2I61 A;  2E8A A;  3CW4 A;  1YUW A;  3LDL A;  4FL9 A;  4UAE F;  1ATS A;  5AQQ A;  3AY9 A;  5EX5 A;  4AAZ A;  3L6Q A;  2ASC A;  1B3C A;  1I2V A;  5FPD A;  2KYQ A;  1L4V A;  2MZ0 A;  5AQV A;  5BPM A;  5KK4 A;  3C7N A;  1DQ7 A;  2N2R A;  3KOZ A;  1NGE A;  3QFP A;  5AQJ A;  5AQS A;  3QFU A;  1K8B A;  1ZVG A;  3KP0 A;  3FE1 A;  1DJT A;  3GDQ A;  1HX1 A;  1T0Z A;  1ZYV A;  3KHW A;  5BPN A;  5AQZ A;  2QWP A;  1AYJ A;  1BCG A;  2MBK A;  5AQN A;  3C7N B;  1GPS A;  2LY6 A;  2YIL A;  3GL1 A;  3PSM A;  5F2R A;  1C55 A;  2QWL A;  2KJA A;  2LJM A;  4HWI A;  3FZH A;  2YC1 C;  4H5T A;  2B3C A;  1OMY A;  1I6G A;  1WWN A;  4HHF A;  3R2V A;  2JDQ D;  2YIO A;  1HPM A;  3IUC A;  1S3X A;  4KYP A;  1NGI A;  5BN8 A;  4KBO A;  1MYN A;  4AB0 A;  3FZL A;  3LDN A;  1POI A;  3E7U X;  1XRS B;  2NY9 X;  2YBR C;  2ATB A;  1OZZ A;  1ZVE A;  5FPN A;  2QWQ A;  5AQO A;  2M8B B;  1BK8 A;  1ICA A;  1JZA A;  5F1X A;  1DKG D;  1QQN A;  3ATU A;  5FPM A;  2BRZ A;  2D56 A;  1KAX A;  5CY0 A;  3FZK A;  2QW9 A;  3KVG A;  5BPL A;  1C56 A;  1KV0 A;  1KAZ A;  1QQM A;  2LR3 A;  2B68 A;  2KHO A;  1PE4 A;  1SN1 A;  5AQG A;  1BUP A;  1SN4 A;  2V7Z A;  2GMO A;  2LY5 A;  5EVZ A;  2LJ7 A;  1T1T A;  1ZYW A;  3KOY A;  1VNB A;  2E3G A;  1MR4 A;  3L4I A;  1PX9 A;  1P0A A;  4H5W A;  4IO8 A;  4UAD E;  4H5R A;  2YIP A;  3D2E A;  1LQQ A;  2YEO A;  1FH3 A;  1NRA A; 
#chains in the Genus database with same CATH homology
 4GNI A;  3ATV A;  5AQP A;  4UAF E;  2E2F A;  2QWM A;  1KAY A;  3D2E B;  1BA0 A;  5AQW A;  1BA1 A;  3M3Z A;  5BN9 A;  3QI7 A;  2QWR A;  5AQH A;  2BUP A;  1NGD A;  3LDP A;  5AQM A;  3JXU A;  5EXW A;  5FPE A;  3CQX A;  4H5V A;  2LN8 A;  1NGB A;  3I33 A;  2QWO A;  3D2F A;  2K35 A;  3LDQ A;  5AQF A;  1NGC A;  2QXL A;  5AQT A;  5AQU A;  2QWN A;  5F0X A;  1NGF A;  3D2F B;  5AR0 A;  5EY4 A;  1NGA A;  5AQI A;  1NGG A;  3BK3 C;  1NGJ A;  2E88 A;  3FZM A;  4H5N A;  3A8Y A;  3SF4 D;  1QQO A;  3KC6 A;  3L56 A;  1NGH A;  5AQY A;  2MN5 A;  1HJO A;  2VY6 A;  5AQK A;  5AQL A;  3FZF A;  5AQX A;  5AQR A;  1ATR A;  3HSC A;  3QML A;  4FSV A;  3LDO A;  2E8A A;  3CW4 A;  1YUW A;  3LDL A;  4FL9 A;  4UAE F;  1ATS A;  5AQQ A;  3AY9 A;  5EX5 A;  3L6Q A;  5FPD A;  5AQV A;  5BPM A;  3C7N A;  3QFP A;  5AQS A;  1NGE A;  5AQJ A;  3QFU A;  3FE1 A;  3GDQ A;  1HX1 A;  3KHW A;  5BPN A;  5AQZ A;  2QWP A;  5AQN A;  2MBK A;  3C7N B;  2YIL A;  3GL1 A;  5F2R A;  2QWL A;  4HWI A;  3FZH A;  4H5T A;  3R2V A;  2JDQ D;  2YIO A;  1HPM A;  3IUC A;  1S3X A;  1NGI A;  5BN8 A;  4KBO A;  3FZL A;  3LDN A;  1POI A;  5FPN A;  2QWQ A;  5AQO A;  5F1X A;  1DKG D;  1QQN A;  3ATU A;  5FPM A;  2D56 A;  1KAX A;  3FZK A;  2QW9 A;  3KVG A;  5BPL A;  1KAZ A;  1QQM A;  5AQG A;  2KHO A;  1BUP A;  2V7Z A;  2GMO A;  5EVZ A;  4UAD E;  3L4I A;  4IO8 A;  4H5W A;  4H5R A;  2YIP A;  3D2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...