4UAEF

Importin alpha 3 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
b'VESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Importin subunit alpha-3
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uaeF00
4UAFE 3KHWA 3KC6A 3CW4A 2GMOA 3R2VA 2VY6A 4UAEF 2JDQD 4UADE 3L56A
chains in the Genus database with same CATH superfamily
1ATRA 1ZFUA 2I61A 2YIOA 3KHWA 5EY4A 1DKGD 1ZYWA 5BPLA 1HJOA 2LKBA 2LR3A 1LQQA 1I2UA 3LDOA 2E8AA 5BN8A 5F1XA 1T7AA 4H5NA 5AQXA 1NH5A 5EXWA 5AQWA 1ICAA 5AQYA 2BUPA 1SN4A 1WWNA 3FZKA 3FZMA 1NGHA 1PTXA 3C7NA 1BMRA 2N69A 1HPMA 1BCGA 1P0AA 1ZYVA 2MZ0A 1QQOA 3D2EA 1NGFA 4KYPA 3AY9A 1TI5A 4H5RA 5BPMA 3E7RL 1K8BA 1PX9A 5AQUA 1MR4A 5AQMA 4UJ0A 1GPTA 2NY9X 3KP0A 4UAFE 2QXLA 1ATSA 5AR0A 2YBRC 3FE1A 1UGLA 1I2VA 1NRAA 2LT8A 3KOWA 4FL9A 1ZVGA 1NGDA 3QI7A 2VY6A 2A7TA 1C55A 1OZZA 1NGIA 2QW9A 5FPMA 5AQTA 2K35A 1KAYA 1VNAA 2QWOA 4H5TA 4HHFA 1NGCA 1XRSB 2B68A 1KAXA 2KJAA 5AQJA 2B3CA 2NY8X 5FPNA 2GL1A 1PE4A 1FH3A 2KYQA 4UADE 1JZAA 1CHZA 1T1TA 2KPYA 1POIA 3LDPA 1YUWA 5AQFA 1MYNA 1BK8A 5AQHA 2E3FA 1S3XA 3D2FB 3E7UX 2G2KA 3FZHA 2LN8A 2ATBA 5AQNA 1T0ZA 3GDQA 3I33A 3LDNA 5CY0A 4V1DC 5FPDA 1NE5A 5AQZA 5BPNA 5FPEA 1T7BA 1LQHA 5AQPA 1QQNA 1ZUTA 2KGQA 3KOZA 2MN5A 1WT7A 3JXUA 2QWNA 3KC6A 1QQMA 2YIPA 1SEGA 1SN1A 3A8YA 3FZFA 1ZU3A 1VNBA 5AQVA 2D56A 3LDQA 2E0HA 3HSCA 2KBHA 3CW4A 3GL1A 1DJTA 3L6QA 2LY5A 4FSVA 1AHOA 2JDQD 2LJMA 1NGEA 3SF4D 3GKUA 2ASCA 5AQLA 1P00A 4UAEF 5AQQA 2QWLA 2KBJA 3FZLA 1NGGA 1OMYA 4AB0A 3D2FA 1BA1A 1DQ7A 2QWPA 1T7EA 1I6GA 1JKZA 3R2VA 2YILA 1BRZA 1NPIA 2E88A 4H5VA 2SN3A 4GNIA 3L4IA 4AAZA 5F2RA 5AQRA 3CQXA 1NRBA 2GMOA 2N66A 2QWRA 2YEOA 1BA0A 2N2QA 1WMTA 1SNBA 2KSKA 5AQKA 5EVZA 1GPSA 3L56A 3KVGA 1BUPA 3M3ZA 3ATVA 5AQOA 2N2RA 1I6FA 3ATUA 5KK4A 3KOXA 5AQSA 2E2FA 4IO8A 1L4VA 2LI7A 2MBKA 5AQGA 1C56A 2M8BB 3BK3C 3C7NB 1CN2A 3KOYA 3PSMA 5F0XA 1JZBA 5AQIA 3IUCA 5BN9A 3D2EB 1NGAA 1KAZA 2V7ZA 1NGBA 4KBOA 1B3CA 1LQIA 2YC1C 3LDLA 1NGJA 2QWQA 1ZVEA 1HX1A 3QFUA 2KHOA 1B7DA 2KBKA 3KP1A 1N4NA 2E3GA 1AYJA 2LY6A 1JXCA 5EX5A 2LJ7A 4HWIA 1KV0A 4H5WA 4AEIA 4CQKA 2BRZA 2QWMA 4HE7A 3QMLA 3QFPA
chains in the Genus database with same CATH topology
1ATRA 2YIOA 3KHWA 5EY4A 5BPLA 1DKGD 1HJOA 3LDOA 2E8AA 5BN8A 5F1XA 4H5NA 5AQXA 5EXWA 5AQWA 5AQYA 2BUPA 3FZKA 3FZMA 1NGHA 3C7NA 1HPMA 5AQQA 1QQOA 3D2EA 1NGFA 3AY9A 4H5RA 5BPMA 5AQUA 5AQMA 4UAFE 2QXLA 1ATSA 5AR0A 3FE1A 4FL9A 1NGDA 3QI7A 2VY6A 1NGIA 2QW9A 5FPMA 5AQTA 2K35A 1KAYA 2QWOA 4H5TA 1NGCA 1KAXA 5AQJA 5FPNA 4UADE 1POIA 3LDPA 1YUWA 5AQFA 5AQHA 3D2FB 1S3XA 3FZHA 2LN8A 5AQNA 3LDNA 3GDQA 3I33A 5FPDA 5AQZA 5BPNA 5FPEA 5AQPA 1QQNA 2MN5A 3JXUA 2QWNA 3KC6A 1QQMA 2YIPA 3A8YA 3FZFA 5AQVA 2D56A 3LDQA 3HSCA 3GL1A 3CW4A 3L6QA 4FSVA 2JDQD 1NGEA 3SF4D 5AQLA 4UAEF 2QWLA 3FZLA 1NGGA 3D2FA 1BA1A 2QWPA 3R2VA 2YILA 4H5VA 2E88A 4GNIA 3L4IA 5F2RA 5AQRA 3CQXA 2GMOA 2QWRA 1BA0A 5AQKA 5EVZA 3L56A 3KVGA 1BUPA 3M3ZA 3ATVA 5AQOA 3ATUA 5AQSA 2E2FA 4IO8A 2MBKA 5AQGA 3BK3C 3C7NB 5F0XA 5AQIA 3IUCA 5BN9A 3D2EB 1NGAA 1KAZA 2V7ZA 1NGBA 4KBOA 3LDLA 1NGJA 2QWQA 1HX1A 3QFUA 2KHOA 5EX5A 4HWIA 4H5WA 2QWMA 3QMLA 3QFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAF E;  3KHW A;  3KC6 A;  3CW4 A;  2GMO A;  3R2V A;  2VY6 A;  4UAE F;  2JDQ D;  4UAD E;  3L56 A; 
#chains in the Genus database with same CATH topology
 1ATR A;  1ZFU A;  2I61 A;  2YIO A;  3KHW A;  5EY4 A;  1DKG D;  1ZYW A;  5BPL A;  1HJO A;  2LKB A;  2LR3 A;  1LQQ A;  1I2U A;  3LDO A;  2E8A A;  5BN8 A;  5F1X A;  1T7A A;  4H5N A;  5AQX A;  1NH5 A;  5EXW A;  5AQW A;  1ICA A;  5AQY A;  2BUP A;  1SN4 A;  1WWN A;  3FZK A;  3FZM A;  1NGH A;  1PTX A;  3C7N A;  1BMR A;  2N69 A;  1HPM A;  1BCG A;  1P0A A;  1ZYV A;  2MZ0 A;  1QQO A;  3D2E A;  1NGF A;  4KYP A;  3AY9 A;  1TI5 A;  4H5R A;  5BPM A;  3E7R L;  1K8B A;  1PX9 A;  5AQU A;  1MR4 A;  5AQM A;  4UJ0 A;  1GPT A;  2NY9 X;  3KP0 A;  4UAF E;  2QXL A;  1ATS A;  5AR0 A;  2YBR C;  3FE1 A;  1UGL A;  1I2V A;  1NRA A;  2LT8 A;  3KOW A;  4FL9 A;  1ZVG A;  1NGD A;  3QI7 A;  2VY6 A;  2A7T A;  1C55 A;  1OZZ A;  1NGI A;  2QW9 A;  5FPM A;  5AQT A;  2K35 A;  1KAY A;  1VNA A;  2QWO A;  4H5T A;  4HHF A;  1NGC A;  1XRS B;  2B68 A;  1KAX A;  2KJA A;  5AQJ A;  2B3C A;  2NY8 X;  5FPN A;  2GL1 A;  1PE4 A;  1FH3 A;  2KYQ A;  4UAD E;  1JZA A;  1CHZ A;  1T1T A;  2KPY A;  1POI A;  3LDP A;  1YUW A;  5AQF A;  1MYN A;  1BK8 A;  5AQH A;  2E3F A;  1S3X A;  3D2F B;  3E7U X;  2G2K A;  3FZH A;  2LN8 A;  2ATB A;  5AQN A;  1T0Z A;  3GDQ A;  3I33 A;  3LDN A;  5CY0 A;  4V1D C;  5FPD A;  1NE5 A;  5AQZ A;  5BPN A;  5FPE A;  1T7B A;  1LQH A;  5AQP A;  1QQN A;  1ZUT A;  2KGQ A;  3KOZ A;  2MN5 A;  1WT7 A;  3JXU A;  2QWN A;  3KC6 A;  1QQM A;  2YIP A;  1SEG A;  1SN1 A;  3A8Y A;  3FZF A;  1ZU3 A;  1VNB A;  5AQV A;  2D56 A;  3LDQ A;  2E0H A;  3HSC A;  2KBH A;  3CW4 A;  3GL1 A;  1DJT A;  3L6Q A;  2LY5 A;  4FSV A;  1AHO A;  2JDQ D;  2LJM A;  1NGE A;  3SF4 D;  3GKU A;  2ASC A;  5AQL A;  1P00 A;  4UAE F;  5AQQ A;  2QWL A;  2KBJ A;  3FZL A;  1NGG A;  1OMY A;  4AB0 A;  3D2F A;  1BA1 A;  1DQ7 A;  2QWP A;  1T7E A;  1I6G A;  1JKZ A;  3R2V A;  2YIL A;  1BRZ A;  1NPI A;  2E88 A;  4H5V A;  2SN3 A;  4GNI A;  3L4I A;  4AAZ A;  5F2R A;  5AQR A;  3CQX A;  1NRB A;  2GMO A;  2N66 A;  2QWR A;  2YEO A;  1BA0 A;  2N2Q A;  1WMT A;  1SNB A;  2KSK A;  5AQK A;  5EVZ A;  1GPS A;  3L56 A;  3KVG A;  1BUP A;  3M3Z A;  3ATV A;  5AQO A;  2N2R A;  1I6F A;  3ATU A;  5KK4 A;  3KOX A;  5AQS A;  2E2F A;  4IO8 A;  1L4V A;  2LI7 A;  2MBK A;  5AQG A;  1C56 A;  2M8B B;  3BK3 C;  3C7N B;  1CN2 A;  3KOY A;  3PSM A;  5F0X A;  1JZB A;  5AQI A;  3IUC A;  5BN9 A;  3D2E B;  1NGA A;  1KAZ A;  2V7Z A;  1NGB A;  4KBO A;  1B3C A;  1LQI A;  2YC1 C;  3LDL A;  1NGJ A;  2QWQ A;  1ZVE A;  1HX1 A;  3QFU A;  2KHO A;  1B7D A;  2KBK A;  3KP1 A;  1N4N A;  2E3G A;  1AYJ A;  2LY6 A;  1JXC A;  5EX5 A;  2LJ7 A;  4HWI A;  1KV0 A;  4H5W A;  4AEI A;  4CQK A;  2BRZ A;  2QWM A;  4HE7 A;  3QML A;  3QFP A; 
#chains in the Genus database with same CATH homology
 1ATR A;  2YIO A;  3KHW A;  5EY4 A;  5BPL A;  1DKG D;  1HJO A;  3LDO A;  2E8A A;  5BN8 A;  5F1X A;  4H5N A;  5AQX A;  5EXW A;  5AQW A;  5AQY A;  2BUP A;  3FZK A;  3FZM A;  1NGH A;  3C7N A;  1HPM A;  5AQQ A;  1QQO A;  3D2E A;  1NGF A;  3AY9 A;  4H5R A;  5BPM A;  5AQU A;  5AQM A;  4UAF E;  2QXL A;  1ATS A;  5AR0 A;  3FE1 A;  4FL9 A;  1NGD A;  3QI7 A;  2VY6 A;  1NGI A;  2QW9 A;  5FPM A;  5AQT A;  2K35 A;  1KAY A;  2QWO A;  4H5T A;  1NGC A;  1KAX A;  5AQJ A;  5FPN A;  4UAD E;  1POI A;  3LDP A;  1YUW A;  5AQF A;  5AQH A;  3D2F B;  1S3X A;  3FZH A;  2LN8 A;  5AQN A;  3LDN A;  3GDQ A;  3I33 A;  5FPD A;  5AQZ A;  5BPN A;  5FPE A;  5AQP A;  1QQN A;  2MN5 A;  3JXU A;  2QWN A;  3KC6 A;  1QQM A;  2YIP A;  3A8Y A;  3FZF A;  5AQV A;  2D56 A;  3LDQ A;  3HSC A;  3GL1 A;  3CW4 A;  3L6Q A;  4FSV A;  2JDQ D;  1NGE A;  3SF4 D;  5AQL A;  4UAE F;  2QWL A;  3FZL A;  1NGG A;  3D2F A;  1BA1 A;  2QWP A;  3R2V A;  2YIL A;  4H5V A;  2E88 A;  4GNI A;  3L4I A;  5F2R A;  5AQR A;  3CQX A;  2GMO A;  2QWR A;  1BA0 A;  5AQK A;  5EVZ A;  3L56 A;  3KVG A;  1BUP A;  3M3Z A;  3ATV A;  5AQO A;  3ATU A;  5AQS A;  2E2F A;  4IO8 A;  2MBK A;  5AQG A;  3BK3 C;  3C7N B;  5F0X A;  5AQI A;  3IUC A;  5BN9 A;  3D2E B;  1NGA A;  1KAZ A;  2V7Z A;  1NGB A;  4KBO A;  3LDL A;  1NGJ A;  2QWQ A;  1HX1 A;  3QFU A;  2KHO A;  5EX5 A;  4HWI A;  4H5W A;  2QWM A;  3QML A;  3QFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...