1NPIA

Tityus serrulatus neurotoxin (ts1) at atomic resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Toxin VII
publication title Structural analysis of Tityus serrulatus Ts1 neurotoxin at atomic resolution: insights into interactions with Na+ channels.
pubmed doi rcsb
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1npiA00
1MYNA 4KYPA 1AYJA 2LT8A 1MR4A 1AHOA 1L4VA 4AEIA 5KK4A 1I2VA 1OMYA 1PX9A 1PTXA 1P0AA 1FH3A 1ZYWA 1SEGA 1T7BA 2KBKA 2B3CA 2LI7A 4UJ0A 4AB0A 1BMRA 1CHZA 1SN4A 2LY6A 2KYQA 1I6FA 4HE7A 2SN3A 1JZAA 1JZBA 2N66A 1P00A 2KPYA 2E0HA 3E7UX 1I2UA 1SNBA 2YC1C 1NRBA 2LR3A 2NY9X 1BK8A 2I61A 1NH5A 1C56A 2N2QA 1NRAA 1CN2A 1ZUTA 1OZZA 4CQKA 1TI5A 1BRZA 2ATBA 1T1TA 1N4NA 1DQ7A 2LKBA 4HHFA 1PE4A 1B7DA 1LQIA 5CY0A 2B68A 1ZVEA 2KGQA 2ASCA 1I6GA 2M8BB 1LQHA 1ZFUA 2A7TA 1GPSA 1ZU3A 1WT7A 1ZYVA 4AAZA 2N2RA 1LQQA 1BCGA 2LY5A 1T0ZA 2N69A 1T7EA 2YBRC 1VNAA 1NPIA 1SN1A 2NY8X 2LJMA 1B3CA 1DJTA 2LJ7A 1NE5A 2KJAA 3E7RL 2E3GA 4V1DC 2KBHA 2KBJA 2KSKA 1JXCA 2E3FA 1ICAA 1ZVGA 1KV0A 2GL1A 2YEOA 1VNBA 3PSMA 1GPTA 1C55A 1WWNA 2MZ0A 2BRZA 1WMTA 1T7AA 1JKZA
chains in the Genus database with same CATH superfamily
1MYNA 4KYPA 1AYJA 2LT8A 5AQVA 4H5VA 1MR4A 2VY6A 4H5WA 1AHOA 1NGHA 1L4VA 1KAYA 1HX1A 3GKUA 4AEIA 5KK4A 1NGBA 5AQIA 1I2VA 1OMYA 5AQHA 1PX9A 1PTXA 1P0AA 1QQOA 3SF4D 3QMLA 3KP0A 1FH3A 1NGCA 1ZYWA 3M3ZA 3L4IA 3FZHA 3KC6A 1POIA 1QQNA 1SEGA 1T7BA 5AQOA 5AQYA 3LDOA 2KBKA 3L6QA 2B3CA 2LI7A 5BN9A 4AB0A 4UJ0A 1BUPA 2QW9A 1BMRA 5AQGA 1CHZA 3BK3C 1SN4A 2LY6A 2KYQA 1I6FA 1QQMA 2YIPA 3GDQA 2E8AA 5AQRA 5EXWA 3FZFA 4GNIA 3GL1A 5BPMA 4HE7A 2SN3A 1JZAA 1JZBA 2N66A 3R2VA 3CW4A 3D2FB 1P00A 2KPYA 2E0HA 3E7UX 2QWLA 3A8YA 5BPNA 5F0XA 3FZLA 3KOYA 1I2UA 1SNBA 5AQNA 2YC1C 4UADE 1NRBA 5AQTA 5AQWA 2LR3A 2NY9X 1BK8A 2I61A 2D56A 2G2KA 1NGEA 1NH5A 2KHOA 1C56A 2N2QA 1NRAA 3ATUA 3QFUA 1CN2A 1KAXA 4FSVA 5FPDA 5AQKA 1BA0A 1ZUTA 2QWOA 1OZZA 4KBOA 2YIOA 4CQKA 1TI5A 3KOZA 1BRZA 1K8BA 3D2EB 5F2RA 2ATBA 1T1TA 2YILA 1N4NA 1DQ7A 2GMOA 2LKBA 4HHFA 1PE4A 1B7DA 2QWMA 1LQIA 1UGLA 2QXLA 3D2FA 5CY0A 4IO8A 2B68A 1ZVEA 2KGQA 1S3XA 2ASCA 1I6GA 4FL9A 2M8BB 1LQHA 1ZFUA 1NGAA 2A7TA 1GPSA 1ZU3A 1BA1A 5FPNA 3KOXA 1WT7A 5AQFA 1ZYVA 4AAZA 3HSCA 3ATVA 5AR0A 2N2RA 2E2FA 2E88A 1LQQA 3KVGA 1BCGA 3LDLA 3LDPA 2LY5A 3C7NB 2MBKA 4UAFE 1T0ZA 1KAZA 1NGFA 3FZKA 2BUPA 2N69A 5AQZA 1T7EA 2YBRC 4H5NA 4H5TA 3D2EA 3FZMA 3LDNA 1VNAA 2QWRA 2JDQD 5AQMA 4HWIA 3JXUA 1NPIA 1SN1A 2NY8X 1XRSB 5AQJA 5AQSA 2LJMA 5AQUA 5BN8A 1B3CA 1ATRA 1DJTA 5AQLA 3I33A 3CQXA 1DKGD 5FPMA 1HJOA 1NE5A 2LJ7A 5AQQA 2KJAA 5FPEA 1HPMA 5EX5A 5EVZA 3E7RL 5AQXA 4UAEF 5BPLA 2E3GA 4V1DC 2KBHA 2KBJA 1NGGA 1ATSA 2KSKA 2K35A 3AY9A 1JXCA 2E3FA 3L56A 1ICAA 3C7NA 1ZVGA 2QWQA 3IUCA 2MN5A 1NGIA 3KOWA 1KV0A 2LN8A 2GL1A 2QWPA 2YEOA 1VNBA 3PSMA 3QFPA 2QWNA 3QI7A 2V7ZA 4H5RA 1GPTA 1C55A 3KHWA 1WWNA 2MZ0A 3FE1A 5F1XA 3LDQA 5EY4A 2BRZA 5AQPA 1WMTA 1T7AA 1NGJA 1JKZA 1YUWA 1NGDA 3KP1A
chains in the Genus database with same CATH topology
1MYNA 4KYPA 1AYJA 2LT8A 1MR4A 1AHOA 1L4VA 4AEIA 5KK4A 1I2VA 1OMYA 1PX9A 1PTXA 1P0AA 1FH3A 1ZYWA 1SEGA 1T7BA 2KBKA 2B3CA 2LI7A 4UJ0A 4AB0A 1BMRA 1CHZA 1SN4A 2LY6A 2KYQA 1I6FA 4HE7A 2SN3A 1JZAA 1JZBA 2N66A 1P00A 2KPYA 2E0HA 3E7UX 1I2UA 1SNBA 2YC1C 1NRBA 2LR3A 2NY9X 1BK8A 2I61A 1NH5A 1C56A 2N2QA 1NRAA 1CN2A 1ZUTA 1OZZA 4CQKA 1TI5A 1BRZA 2ATBA 1T1TA 1N4NA 1DQ7A 2LKBA 4HHFA 1PE4A 1B7DA 1LQIA 5CY0A 2B68A 1ZVEA 2KGQA 2ASCA 1I6GA 2M8BB 1LQHA 1ZFUA 2A7TA 1GPSA 1ZU3A 1WT7A 1ZYVA 4AAZA 2N2RA 1LQQA 1BCGA 2LY5A 1T0ZA 2N69A 1T7EA 2YBRC 1VNAA 1NPIA 1SN1A 2NY8X 2LJMA 1B3CA 1DJTA 2LJ7A 1NE5A 2KJAA 3E7RL 2E3GA 4V1DC 2KBHA 2KBJA 2KSKA 1JXCA 2E3FA 1ICAA 1ZVGA 1KV0A 2GL1A 2YEOA 1VNBA 3PSMA 1GPTA 1C55A 1WWNA 2MZ0A 2BRZA 1WMTA 1T7AA 1JKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYN A;  4KYP A;  1AYJ A;  2LT8 A;  1MR4 A;  1AHO A;  1L4V A;  4AEI A;  5KK4 A;  1I2V A;  1OMY A;  1PX9 A;  1PTX A;  1P0A A;  1FH3 A;  1ZYW A;  1SEG A;  1T7B A;  2KBK A;  2B3C A;  2LI7 A;  4UJ0 A;  4AB0 A;  1BMR A;  1CHZ A;  1SN4 A;  2LY6 A;  2KYQ A;  1I6F A;  4HE7 A;  2SN3 A;  1JZA A;  1JZB A;  2N66 A;  1P00 A;  2KPY A;  2E0H A;  3E7U X;  1I2U A;  1SNB A;  2YC1 C;  1NRB A;  2LR3 A;  2NY9 X;  1BK8 A;  2I61 A;  1NH5 A;  1C56 A;  2N2Q A;  1NRA A;  1CN2 A;  1ZUT A;  1OZZ A;  4CQK A;  1TI5 A;  1BRZ A;  2ATB A;  1T1T A;  1N4N A;  1DQ7 A;  2LKB A;  4HHF A;  1PE4 A;  1B7D A;  1LQI A;  5CY0 A;  2B68 A;  1ZVE A;  2KGQ A;  2ASC A;  1I6G A;  2M8B B;  1LQH A;  1ZFU A;  2A7T A;  1GPS A;  1ZU3 A;  1WT7 A;  1ZYV A;  4AAZ A;  2N2R A;  1LQQ A;  1BCG A;  2LY5 A;  1T0Z A;  2N69 A;  1T7E A;  2YBR C;  1VNA A;  1NPI A;  1SN1 A;  2NY8 X;  2LJM A;  1B3C A;  1DJT A;  2LJ7 A;  1NE5 A;  2KJA A;  3E7R L;  2E3G A;  4V1D C;  2KBH A;  2KBJ A;  2KSK A;  1JXC A;  2E3F A;  1ICA A;  1ZVG A;  1KV0 A;  2GL1 A;  2YEO A;  1VNB A;  3PSM A;  1GPT A;  1C55 A;  1WWN A;  2MZ0 A;  2BRZ A;  1WMT A;  1T7A A;  1JKZ A; 
#chains in the Genus database with same CATH topology
 1MYN A;  4KYP A;  1AYJ A;  2LT8 A;  5AQV A;  4H5V A;  1MR4 A;  2VY6 A;  4H5W A;  1AHO A;  1NGH A;  1L4V A;  1KAY A;  1HX1 A;  3GKU A;  4AEI A;  5KK4 A;  1NGB A;  5AQI A;  1I2V A;  1OMY A;  5AQH A;  1PX9 A;  1PTX A;  1P0A A;  1QQO A;  3SF4 D;  3QML A;  3KP0 A;  1FH3 A;  1NGC A;  1ZYW A;  3M3Z A;  3L4I A;  3FZH A;  3KC6 A;  1POI A;  1QQN A;  1SEG A;  1T7B A;  5AQO A;  5AQY A;  3LDO A;  2KBK A;  3L6Q A;  2B3C A;  2LI7 A;  5BN9 A;  4AB0 A;  4UJ0 A;  1BUP A;  2QW9 A;  1BMR A;  5AQG A;  1CHZ A;  3BK3 C;  1SN4 A;  2LY6 A;  2KYQ A;  1I6F A;  1QQM A;  2YIP A;  3GDQ A;  2E8A A;  5AQR A;  5EXW A;  3FZF A;  4GNI A;  3GL1 A;  5BPM A;  4HE7 A;  2SN3 A;  1JZA A;  1JZB A;  2N66 A;  3R2V A;  3CW4 A;  3D2F B;  1P00 A;  2KPY A;  2E0H A;  3E7U X;  2QWL A;  3A8Y A;  5BPN A;  5F0X A;  3FZL A;  3KOY A;  1I2U A;  1SNB A;  5AQN A;  2YC1 C;  4UAD E;  1NRB A;  5AQT A;  5AQW A;  2LR3 A;  2NY9 X;  1BK8 A;  2I61 A;  2D56 A;  2G2K A;  1NGE A;  1NH5 A;  2KHO A;  1C56 A;  2N2Q A;  1NRA A;  3ATU A;  3QFU A;  1CN2 A;  1KAX A;  4FSV A;  5FPD A;  5AQK A;  1BA0 A;  1ZUT A;  2QWO A;  1OZZ A;  4KBO A;  2YIO A;  4CQK A;  1TI5 A;  3KOZ A;  1BRZ A;  1K8B A;  3D2E B;  5F2R A;  2ATB A;  1T1T A;  2YIL A;  1N4N A;  1DQ7 A;  2GMO A;  2LKB A;  4HHF A;  1PE4 A;  1B7D A;  2QWM A;  1LQI A;  1UGL A;  2QXL A;  3D2F A;  5CY0 A;  4IO8 A;  2B68 A;  1ZVE A;  2KGQ A;  1S3X A;  2ASC A;  1I6G A;  4FL9 A;  2M8B B;  1LQH A;  1ZFU A;  1NGA A;  2A7T A;  1GPS A;  1ZU3 A;  1BA1 A;  5FPN A;  3KOX A;  1WT7 A;  5AQF A;  1ZYV A;  4AAZ A;  3HSC A;  3ATV A;  5AR0 A;  2N2R A;  2E2F A;  2E88 A;  1LQQ A;  3KVG A;  1BCG A;  3LDL A;  3LDP A;  2LY5 A;  3C7N B;  2MBK A;  4UAF E;  1T0Z A;  1KAZ A;  1NGF A;  3FZK A;  2BUP A;  2N69 A;  5AQZ A;  1T7E A;  2YBR C;  4H5N A;  4H5T A;  3D2E A;  3FZM A;  3LDN A;  1VNA A;  2QWR A;  2JDQ D;  5AQM A;  4HWI A;  3JXU A;  1NPI A;  1SN1 A;  2NY8 X;  1XRS B;  5AQJ A;  5AQS A;  2LJM A;  5AQU A;  5BN8 A;  1B3C A;  1ATR A;  1DJT A;  5AQL A;  3I33 A;  3CQX A;  1DKG D;  5FPM A;  1HJO A;  1NE5 A;  2LJ7 A;  5AQQ A;  2KJA A;  5FPE A;  1HPM A;  5EX5 A;  5EVZ A;  3E7R L;  5AQX A;  4UAE F;  5BPL A;  2E3G A;  4V1D C;  2KBH A;  2KBJ A;  1NGG A;  1ATS A;  2KSK A;  2K35 A;  3AY9 A;  1JXC A;  2E3F A;  3L56 A;  1ICA A;  3C7N A;  1ZVG A;  2QWQ A;  3IUC A;  2MN5 A;  1NGI A;  3KOW A;  1KV0 A;  2LN8 A;  2GL1 A;  2QWP A;  2YEO A;  1VNB A;  3PSM A;  3QFP A;  2QWN A;  3QI7 A;  2V7Z A;  4H5R A;  1GPT A;  1C55 A;  3KHW A;  1WWN A;  2MZ0 A;  3FE1 A;  5F1X A;  3LDQ A;  5EY4 A;  2BRZ A;  5AQP A;  1WMT A;  1T7A A;  1NGJ A;  1JKZ A;  1YUW A;  1NGD A;  3KP1 A; 
#chains in the Genus database with same CATH homology
 1MYN A;  4KYP A;  1AYJ A;  2LT8 A;  1MR4 A;  1AHO A;  1L4V A;  4AEI A;  5KK4 A;  1I2V A;  1OMY A;  1PX9 A;  1PTX A;  1P0A A;  1FH3 A;  1ZYW A;  1SEG A;  1T7B A;  2KBK A;  2B3C A;  2LI7 A;  4UJ0 A;  4AB0 A;  1BMR A;  1CHZ A;  1SN4 A;  2LY6 A;  2KYQ A;  1I6F A;  4HE7 A;  2SN3 A;  1JZA A;  1JZB A;  2N66 A;  1P00 A;  2KPY A;  2E0H A;  3E7U X;  1I2U A;  1SNB A;  2YC1 C;  1NRB A;  2LR3 A;  2NY9 X;  1BK8 A;  2I61 A;  1NH5 A;  1C56 A;  2N2Q A;  1NRA A;  1CN2 A;  1ZUT A;  1OZZ A;  4CQK A;  1TI5 A;  1BRZ A;  2ATB A;  1T1T A;  1N4N A;  1DQ7 A;  2LKB A;  4HHF A;  1PE4 A;  1B7D A;  1LQI A;  5CY0 A;  2B68 A;  1ZVE A;  2KGQ A;  2ASC A;  1I6G A;  2M8B B;  1LQH A;  1ZFU A;  2A7T A;  1GPS A;  1ZU3 A;  1WT7 A;  1ZYV A;  4AAZ A;  2N2R A;  1LQQ A;  1BCG A;  2LY5 A;  1T0Z A;  2N69 A;  1T7E A;  2YBR C;  1VNA A;  1NPI A;  1SN1 A;  2NY8 X;  2LJM A;  1B3C A;  1DJT A;  2LJ7 A;  1NE5 A;  2KJA A;  3E7R L;  2E3G A;  4V1D C;  2KBH A;  2KBJ A;  2KSK A;  1JXC A;  2E3F A;  1ICA A;  1ZVG A;  1KV0 A;  2GL1 A;  2YEO A;  1VNB A;  3PSM A;  1GPT A;  1C55 A;  1WWN A;  2MZ0 A;  2BRZ A;  1WMT A;  1T7A A;  1JKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...