1NPIA

Tityus serrulatus neurotoxin (ts1) at atomic resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin VII
publication title Structural analysis of Tityus serrulatus Ts1 neurotoxin at atomic resolution: insights into interactions with Na+ channels.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1npiA00
1KV0A 2A7TA 2LI7A 1ZU3A 1P0AA 2E3GA 3E7UX 2GL1A 1I2VA 1DQ7A 2M8BB 2I61A 1BRZA 1B3CA 1NRBA 4HHFA 2YC1C 2LY6A 2KGQA 1B7DA 2KBHA 1SEGA 2BRZA 1T7EA 2KBKA 2LT8A 2NY8X 1BCGA 1WWNA 1C55A 2LJ7A 1JZAA 2SN3A 1BMRA 2YEOA 4V1DC 1ZFUA 2ASCA 1C56A 1T7BA 2KSKA 1OMYA 2ATBA 2E3FA 2N69A 2NY9X 1BK8A 2YBRC 1JKZA 1AHOA 1SNBA 1SN1A 5CY0A 1VNBA 1MR4A 1I2UA 1ZVEA 1WMTA 1PX9A 4AEIA 1WT7A 1CHZA 1ZUTA 2KJAA 1ZVGA 2LKBA 3PSMA 1AYJA 1L4VA 1VNAA 1GPTA 1ICAA 1N4NA 4UJ0A 1NE5A 2MZ0A 2B68A 5KK4A 2LJMA 1OZZA 1DJTA 1P00A 2KPYA 1NPIA 2KYQA 1LQHA 1LQQA 2B3CA 2KBJA 1I6FA 2N2QA 1ZYWA 1FH3A 1NH5A 3E7RL 4AAZA 1PE4A 4CQKA 1GPSA 1JXCA 2E0HA 1LQIA 1T0ZA 1TI5A 1T7AA 4HE7A 1T1TA 2LY5A 4KYPA 1I6GA 4AB0A 2N2RA 1CN2A 1ZYVA 1PTXA 2LR3A 1SN4A 2N66A 1NRAA 1MYNA 1JZBA
chains in the Genus database with same CATH superfamily
1KV0A 5AQSA 2A7TA 4UAFE 4UAEF 2LI7A 1ZU3A 5EX5A 1P0AA 3C7NB 2E3GA 3E7UX 2GL1A 1I2VA 2QWMA 1BA0A 2MN5A 1NGDA 2QWOA 1DQ7A 3FZMA 5AQTA 2GMOA 2E2FA 5AQRA 2M8BB 2I61A 5AQWA 3HSCA 2YILA 5AQPA 1BRZA 1B3CA 1NRBA 4HHFA 2QWLA 2YC1C 2LY6A 3L4IA 3D2EB 3GKUA 1B7DA 2KGQA 1BA1A 2KBHA 1SEGA 3D2EA 3FZFA 5AQNA 1ATRA 2BRZA 1QQNA 2QWPA 3FE1A 1HX1A 3KP0A 1T7EA 2KBKA 2QWRA 3IUCA 3KP1A 2LT8A 2NY8X 3QFPA 5AQKA 1BCGA 1WWNA 1C55A 2VY6A 2LJ7A 5AQJA 3KOZA 1DKGD 1JZAA 2SN3A 5AQOA 3A8YA 5F2RA 3C7NA 3FZKA 4H5TA 1BMRA 2YEOA 4V1DC 1YUWA 1ZFUA 3KHWA 2ASCA 1C56A 1T7BA 2KSKA 1OMYA 2YIOA 2QW9A 3L56A 3LDOA 4FL9A 3M3ZA 5AQQA 2ATBA 1KAZA 5AQXA 5AQZA 2E3FA 3L6QA 1NGGA 4GNIA 2N69A 1NGEA 2NY9X 1BK8A 2JDQD 2YBRC 1JKZA 1K8BA 2E88A 3KC6A 1AHOA 5AQGA 1SNBA 1SN1A 2YIPA 1VNBA 5CY0A 1MR4A 5AQUA 1I2UA 4H5WA 1ATSA 1ZVEA 1WMTA 1PX9A 4UADE 5AQYA 4AEIA 1WT7A 1CHZA 4IO8A 3D2FB 1ZUTA 1KAXA 4H5NA 2KJAA 1ZVGA 2LKBA 1HJOA 3PSMA 3GDQA 5AQLA 1AYJA 1L4VA 2QWQA 5BPMA 5F0XA 1VNAA 5BN8A 1GPTA 3AY9A 1ICAA 1N4NA 4UJ0A 1NE5A 2MZ0A 3FZHA 4KBOA 2B68A 2LN8A 5EVZA 3KOYA 2QWNA 5EY4A 5KK4A 3GL1A 3QI7A 2LJMA 5AQIA 1OZZA 1NGAA 1QQMA 1DJTA 1P00A 2KPYA 1NGFA 1KAYA 1NGBA 1LQHA 1NPIA 2KYQA 5BN9A 3CQXA 1BUPA 2D56A 1UGLA 1LQQA 2B3CA 2G2KA 2KBJA 3JXUA 3FZLA 1POIA 1I6FA 2N2QA 1ZYWA 5AQVA 2K35A 5EXWA 5FPMA 1FH3A 3ATVA 1NH5A 3E7RL 4AAZA 1PE4A 4CQKA 3BK3C 3LDPA 1JXCA 1GPSA 2E0HA 1LQIA 1T0ZA 3KOWA 4H5VA 1TI5A 1NGHA 1T7AA 3D2FA 3QMLA 5FPEA 1NGIA 2KHOA 4HE7A 1T1TA 2LY5A 4KYPA 2V7ZA 5FPNA 3ATUA 5BPNA 1I6GA 3QFUA 5AR0A 1NGJA 4AB0A 1NGCA 2QXLA 4H5RA 2N2RA 5AQFA 1CN2A 5AQHA 3R2VA 1HPMA 3SF4D 3LDLA 1ZYVA 3LDQA 2BUPA 3KVGA 4HWIA 1PTXA 2LR3A 1QQOA 2MBKA 3CW4A 1SN4A 2N66A 1NRAA 3KOXA 5AQMA 5FPDA 1S3XA 1MYNA 3I33A 3LDNA 5F1XA 4FSVA 2E8AA 1JZBA 1XRSB 5BPLA
chains in the Genus database with same CATH topology
1KV0A 2A7TA 2LI7A 1ZU3A 1P0AA 2E3GA 3E7UX 2GL1A 1I2VA 1DQ7A 2M8BB 2I61A 1BRZA 1B3CA 1NRBA 4HHFA 2YC1C 2LY6A 2KGQA 1B7DA 2KBHA 1SEGA 2BRZA 1T7EA 2KBKA 2LT8A 2NY8X 1BCGA 1WWNA 1C55A 2LJ7A 1JZAA 2SN3A 1BMRA 2YEOA 4V1DC 1ZFUA 2ASCA 1C56A 1T7BA 2KSKA 1OMYA 2ATBA 2E3FA 2N69A 2NY9X 1BK8A 2YBRC 1JKZA 1AHOA 1SNBA 1SN1A 5CY0A 1VNBA 1MR4A 1I2UA 1ZVEA 1WMTA 1PX9A 4AEIA 1WT7A 1CHZA 1ZUTA 2KJAA 1ZVGA 2LKBA 3PSMA 1AYJA 1L4VA 1VNAA 1GPTA 1ICAA 1N4NA 4UJ0A 1NE5A 2MZ0A 2B68A 5KK4A 2LJMA 1OZZA 1DJTA 1P00A 2KPYA 1NPIA 2KYQA 1LQHA 1LQQA 2B3CA 2KBJA 1I6FA 2N2QA 1ZYWA 1FH3A 1NH5A 3E7RL 4AAZA 1PE4A 4CQKA 1GPSA 1JXCA 2E0HA 1LQIA 1T0ZA 1TI5A 1T7AA 4HE7A 1T1TA 2LY5A 4KYPA 1I6GA 4AB0A 2N2RA 1CN2A 1ZYVA 1PTXA 2LR3A 1SN4A 2N66A 1NRAA 1MYNA 1JZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KV0 A;  2A7T A;  2LI7 A;  1ZU3 A;  1P0A A;  2E3G A;  3E7U X;  2GL1 A;  1I2V A;  1DQ7 A;  2M8B B;  2I61 A;  1BRZ A;  1B3C A;  1NRB A;  4HHF A;  2YC1 C;  2LY6 A;  2KGQ A;  1B7D A;  2KBH A;  1SEG A;  2BRZ A;  1T7E A;  2KBK A;  2LT8 A;  2NY8 X;  1BCG A;  1WWN A;  1C55 A;  2LJ7 A;  1JZA A;  2SN3 A;  1BMR A;  2YEO A;  4V1D C;  1ZFU A;  2ASC A;  1C56 A;  1T7B A;  2KSK A;  1OMY A;  2ATB A;  2E3F A;  2N69 A;  2NY9 X;  1BK8 A;  2YBR C;  1JKZ A;  1AHO A;  1SNB A;  1SN1 A;  5CY0 A;  1VNB A;  1MR4 A;  1I2U A;  1ZVE A;  1WMT A;  1PX9 A;  4AEI A;  1WT7 A;  1CHZ A;  1ZUT A;  2KJA A;  1ZVG A;  2LKB A;  3PSM A;  1AYJ A;  1L4V A;  1VNA A;  1GPT A;  1ICA A;  1N4N A;  4UJ0 A;  1NE5 A;  2MZ0 A;  2B68 A;  5KK4 A;  2LJM A;  1OZZ A;  1DJT A;  1P00 A;  2KPY A;  1NPI A;  2KYQ A;  1LQH A;  1LQQ A;  2B3C A;  2KBJ A;  1I6F A;  2N2Q A;  1ZYW A;  1FH3 A;  1NH5 A;  3E7R L;  4AAZ A;  1PE4 A;  4CQK A;  1GPS A;  1JXC A;  2E0H A;  1LQI A;  1T0Z A;  1TI5 A;  1T7A A;  4HE7 A;  1T1T A;  2LY5 A;  4KYP A;  1I6G A;  4AB0 A;  2N2R A;  1CN2 A;  1ZYV A;  1PTX A;  2LR3 A;  1SN4 A;  2N66 A;  1NRA A;  1MYN A;  1JZB A; 
#chains in the Genus database with same CATH topology
 1KV0 A;  5AQS A;  2A7T A;  4UAF E;  4UAE F;  2LI7 A;  1ZU3 A;  5EX5 A;  1P0A A;  3C7N B;  2E3G A;  3E7U X;  2GL1 A;  1I2V A;  2QWM A;  1BA0 A;  2MN5 A;  1NGD A;  2QWO A;  1DQ7 A;  3FZM A;  5AQT A;  2GMO A;  2E2F A;  5AQR A;  2M8B B;  2I61 A;  5AQW A;  3HSC A;  2YIL A;  5AQP A;  1BRZ A;  1B3C A;  1NRB A;  4HHF A;  2QWL A;  2YC1 C;  2LY6 A;  3L4I A;  3D2E B;  3GKU A;  1B7D A;  2KGQ A;  1BA1 A;  2KBH A;  1SEG A;  3D2E A;  3FZF A;  5AQN A;  1ATR A;  2BRZ A;  1QQN A;  2QWP A;  3FE1 A;  1HX1 A;  3KP0 A;  1T7E A;  2KBK A;  2QWR A;  3IUC A;  3KP1 A;  2LT8 A;  2NY8 X;  3QFP A;  5AQK A;  1BCG A;  1WWN A;  1C55 A;  2VY6 A;  2LJ7 A;  5AQJ A;  3KOZ A;  1DKG D;  1JZA A;  2SN3 A;  5AQO A;  3A8Y A;  5F2R A;  3C7N A;  3FZK A;  4H5T A;  1BMR A;  2YEO A;  4V1D C;  1YUW A;  1ZFU A;  3KHW A;  2ASC A;  1C56 A;  1T7B A;  2KSK A;  1OMY A;  2YIO A;  2QW9 A;  3L56 A;  3LDO A;  4FL9 A;  3M3Z A;  5AQQ A;  2ATB A;  1KAZ A;  5AQX A;  5AQZ A;  2E3F A;  3L6Q A;  1NGG A;  4GNI A;  2N69 A;  1NGE A;  2NY9 X;  1BK8 A;  2JDQ D;  2YBR C;  1JKZ A;  1K8B A;  2E88 A;  3KC6 A;  1AHO A;  5AQG A;  1SNB A;  1SN1 A;  2YIP A;  1VNB A;  5CY0 A;  1MR4 A;  5AQU A;  1I2U A;  4H5W A;  1ATS A;  1ZVE A;  1WMT A;  1PX9 A;  4UAD E;  5AQY A;  4AEI A;  1WT7 A;  1CHZ A;  4IO8 A;  3D2F B;  1ZUT A;  1KAX A;  4H5N A;  2KJA A;  1ZVG A;  2LKB A;  1HJO A;  3PSM A;  3GDQ A;  5AQL A;  1AYJ A;  1L4V A;  2QWQ A;  5BPM A;  5F0X A;  1VNA A;  5BN8 A;  1GPT A;  3AY9 A;  1ICA A;  1N4N A;  4UJ0 A;  1NE5 A;  2MZ0 A;  3FZH A;  4KBO A;  2B68 A;  2LN8 A;  5EVZ A;  3KOY A;  2QWN A;  5EY4 A;  5KK4 A;  3GL1 A;  3QI7 A;  2LJM A;  5AQI A;  1OZZ A;  1NGA A;  1QQM A;  1DJT A;  1P00 A;  2KPY A;  1NGF A;  1KAY A;  1NGB A;  1LQH A;  1NPI A;  2KYQ A;  5BN9 A;  3CQX A;  1BUP A;  2D56 A;  1UGL A;  1LQQ A;  2B3C A;  2G2K A;  2KBJ A;  3JXU A;  3FZL A;  1POI A;  1I6F A;  2N2Q A;  1ZYW A;  5AQV A;  2K35 A;  5EXW A;  5FPM A;  1FH3 A;  3ATV A;  1NH5 A;  3E7R L;  4AAZ A;  1PE4 A;  4CQK A;  3BK3 C;  3LDP A;  1JXC A;  1GPS A;  2E0H A;  1LQI A;  1T0Z A;  3KOW A;  4H5V A;  1TI5 A;  1NGH A;  1T7A A;  3D2F A;  3QML A;  5FPE A;  1NGI A;  2KHO A;  4HE7 A;  1T1T A;  2LY5 A;  4KYP A;  2V7Z A;  5FPN A;  3ATU A;  5BPN A;  1I6G A;  3QFU A;  5AR0 A;  1NGJ A;  4AB0 A;  1NGC A;  2QXL A;  4H5R A;  2N2R A;  5AQF A;  1CN2 A;  5AQH A;  3R2V A;  1HPM A;  3SF4 D;  3LDL A;  1ZYV A;  3LDQ A;  2BUP A;  3KVG A;  4HWI A;  1PTX A;  2LR3 A;  1QQO A;  2MBK A;  3CW4 A;  1SN4 A;  2N66 A;  1NRA A;  3KOX A;  5AQM A;  5FPD A;  1S3X A;  1MYN A;  3I33 A;  3LDN A;  5F1X A;  4FSV A;  2E8A A;  1JZB A;  1XRS B;  5BPL A; 
#chains in the Genus database with same CATH homology
 1KV0 A;  2A7T A;  2LI7 A;  1ZU3 A;  1P0A A;  2E3G A;  3E7U X;  2GL1 A;  1I2V A;  1DQ7 A;  2M8B B;  2I61 A;  1BRZ A;  1B3C A;  1NRB A;  4HHF A;  2YC1 C;  2LY6 A;  2KGQ A;  1B7D A;  2KBH A;  1SEG A;  2BRZ A;  1T7E A;  2KBK A;  2LT8 A;  2NY8 X;  1BCG A;  1WWN A;  1C55 A;  2LJ7 A;  1JZA A;  2SN3 A;  1BMR A;  2YEO A;  4V1D C;  1ZFU A;  2ASC A;  1C56 A;  1T7B A;  2KSK A;  1OMY A;  2ATB A;  2E3F A;  2N69 A;  2NY9 X;  1BK8 A;  2YBR C;  1JKZ A;  1AHO A;  1SNB A;  1SN1 A;  5CY0 A;  1VNB A;  1MR4 A;  1I2U A;  1ZVE A;  1WMT A;  1PX9 A;  4AEI A;  1WT7 A;  1CHZ A;  1ZUT A;  2KJA A;  1ZVG A;  2LKB A;  3PSM A;  1AYJ A;  1L4V A;  1VNA A;  1GPT A;  1ICA A;  1N4N A;  4UJ0 A;  1NE5 A;  2MZ0 A;  2B68 A;  5KK4 A;  2LJM A;  1OZZ A;  1DJT A;  1P00 A;  2KPY A;  1NPI A;  2KYQ A;  1LQH A;  1LQQ A;  2B3C A;  2KBJ A;  1I6F A;  2N2Q A;  1ZYW A;  1FH3 A;  1NH5 A;  3E7R L;  4AAZ A;  1PE4 A;  4CQK A;  1GPS A;  1JXC A;  2E0H A;  1LQI A;  1T0Z A;  1TI5 A;  1T7A A;  4HE7 A;  1T1T A;  2LY5 A;  4KYP A;  1I6G A;  4AB0 A;  2N2R A;  1CN2 A;  1ZYV A;  1PTX A;  2LR3 A;  1SN4 A;  2N66 A;  1NRA A;  1MYN A;  1JZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...