1NPIA

Tityus serrulatus neurotoxin (ts1) at atomic resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
b'KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin VII
publication title Structural analysis of Tityus serrulatus Ts1 neurotoxin at atomic resolution: insights into interactions with Na+ channels.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1npiA00
1NRAA 1I6GA 2LJMA 1I2UA 2KBKA 1WT7A 2NY8X 1FH3A 2I61A 1SNBA 2YC1C 2N69A 1WWNA 2KPYA 4AB0A 2LI7A 1BK8A 2LY5A 1N4NA 1ZU3A 1LQHA 1AYJA 1L4VA 4AEIA 1SN4A 5CY0A 1I6FA 2BRZA 1SEGA 4HHFA 1JKZA 1GPTA 2N2RA 1T7EA 1OMYA 5KK4A 1VNAA 1WMTA 4CQKA 3E7UX 1PE4A 2KJAA 3E7RL 1T7BA 1P0AA 1ZFUA 4UJ0A 2LY6A 1C55A 1JZBA 1DJTA 2MZ0A 1NPIA 1NH5A 4HE7A 2KBJA 2N2QA 1CHZA 2LKBA 1ZVGA 2KBHA 1C56A 1OZZA 1ZYVA 2A7TA 2NY9X 1VNBA 2M8BB 2E3FA 2B68A 2YBRC 1ZUTA 1JZAA 1BRZA 1MR4A 2KGQA 1NE5A 2B3CA 2E0HA 1B7DA 1JXCA 2KSKA 1ZYWA 1KV0A 1PTXA 4KYPA 1T0ZA 1T7AA 1LQIA 1ICAA 1GPSA 2ASCA 1P00A 2ATBA 1BCGA 2LR3A 1NRBA 1BMRA 2GL1A 3PSMA 2SN3A 1SN1A 1DQ7A 2YEOA 1CN2A 1ZVEA 2E3GA 2KYQA 1B3CA 1AHOA 1PX9A 2LJ7A 1I2VA 1MYNA 1LQQA 1TI5A 4AAZA 4V1DC 1T1TA 2N66A 2LT8A
chains in the Genus database with same CATH superfamily
5AQMA 1NRAA 1YUWA 1I6GA 2YIPA 3KC6A 1NGGA 2LJMA 5AQRA 1QQMA 1I2UA 1K8BA 1NGJA 2KBKA 1NGEA 1BA1A 1WT7A 3D2EB 3LDQA 2G2KA 2NY8X 3LDLA 1FH3A 2I61A 2D56A 3C7NA 3GKUA 2JDQD 1SNBA 2YC1C 5AQGA 3IUCA 5BPLA 2N69A 3FZKA 5AQSA 1WWNA 2KPYA 1NGFA 3BK3C 4AB0A 3D2FA 2KHOA 2LI7A 5AQFA 1BK8A 3QFPA 2LY5A 2E88A 3D2FB 1DKGD 5AQXA 3LDOA 5AQTA 1N4NA 1ZU3A 4UADE 1LQHA 1ATRA 4UAEF 5AR0A 2BUPA 1AYJA 1L4VA 3KVGA 2E8AA 1KAYA 4AEIA 1SN4A 3QMLA 5CY0A 3LDNA 4H5TA 1I6FA 3JXUA 2BRZA 1SEGA 4HHFA 5AQJA 1XRSB 2N2RA 1HPMA 2QWNA 2YILA 1JKZA 1KAXA 3R2VA 5BPMA 1T7EA 5AQVA 1OMYA 2K35A 1HX1A 2QW9A 5BN9A 3L56A 5KK4A 5EVZA 1VNAA 3GL1A 4H5NA 1BA0A 1WMTA 2QWQA 4CQKA 3E7UX 1PE4A 2KJAA 3SF4D 3E7RL 3L6QA 3C7NB 5FPDA 1T7BA 5AQNA 1P0AA 1ZFUA 5FPNA 4UJ0A 4FL9A 3M3ZA 4H5WA 1GPTA 2GMOA 2LY6A 1C55A 1JZBA 1DJTA 3KHWA 2V7ZA 2MZ0A 1QQNA 2MN5A 1NPIA 5AQQA 1NH5A 3ATUA 1KAZA 4HE7A 3KOXA 2KBJA 4FSVA 2N2QA 1CHZA 2E2FA 2LKBA 1ZVGA 2KBHA 3KOYA 2QWLA 1C56A 1NGBA 1OZZA 1UGLA 1ZYVA 1NGCA 3KP1A 2LN8A 4H5RA 2A7TA 5FPMA 5F0XA 1NGIA 4KBOA 5AQZA 2QXLA 3I33A 2NY9X 3KP0A 5EXWA 3L4IA 1VNBA 2M8BB 2E3FA 2B68A 2YBRC 5BN8A 5FPEA 1NGDA 3LDPA 3FZFA 3GDQA 1ZUTA 1JZAA 5F1XA 1BRZA 1MR4A 2KGQA 5AQUA 1NE5A 3KOZA 2B3CA 2E0HA 5AQIA 1B7DA 1JXCA 2KSKA 2VY6A 5BPNA 1ZYWA 5AQKA 1ATSA 1BUPA 1KV0A 1PTXA 4H5VA 4KYPA 2YIOA 1T7AA 1LQIA 5AQYA 5EX5A 4GNIA 1NGHA 3HSCA 1ICAA 1GPSA 3D2EA 5AQWA 2ASCA 1P00A 2ATBA 5EY4A 3FZHA 1BCGA 1POIA 2QWPA 2LR3A 1NRBA 4HWIA 2GL1A 3PSMA 3QFUA 2SN3A 5AQLA 2QWMA 3FZMA 1BMRA 1SN1A 3A8YA 3ATVA 3AY9A 1DQ7A 5F2RA 2YEOA 1CN2A 5AQPA 2QWRA 3QI7A 1ZVEA 2E3GA 3KOWA 1NGAA 2KYQA 2MBKA 1B3CA 1AHOA 1PX9A 2LJ7A 1I2VA 3CQXA 3FZLA 1MYNA 4IO8A 5AQOA 1LQQA 1QQOA 1TI5A 4AAZA 5AQHA 2QWOA 4V1DC 1S3XA 1T1TA 1HJOA 2LT8A 3CW4A 4UAFE 2N66A 1T0ZA 3FE1A
chains in the Genus database with same CATH topology
1NRAA 1I6GA 2LJMA 1I2UA 2KBKA 1WT7A 2NY8X 1FH3A 2I61A 1SNBA 2YC1C 2N69A 1WWNA 2KPYA 4AB0A 2LI7A 1BK8A 2LY5A 1N4NA 1ZU3A 1LQHA 1AYJA 1L4VA 4AEIA 1SN4A 5CY0A 1I6FA 2BRZA 1SEGA 4HHFA 1JKZA 1GPTA 2N2RA 1T7EA 1OMYA 5KK4A 1VNAA 1WMTA 4CQKA 3E7UX 1PE4A 2KJAA 3E7RL 1T7BA 1P0AA 1ZFUA 4UJ0A 2LY6A 1C55A 1JZBA 1DJTA 2MZ0A 1NPIA 1NH5A 4HE7A 2KBJA 2N2QA 1CHZA 2LKBA 1ZVGA 2KBHA 1C56A 1OZZA 1ZYVA 2A7TA 2NY9X 1VNBA 2M8BB 2E3FA 2B68A 2YBRC 1ZUTA 1JZAA 1BRZA 1MR4A 2KGQA 1NE5A 2B3CA 2E0HA 1B7DA 1JXCA 2KSKA 1ZYWA 1KV0A 1PTXA 4KYPA 1T0ZA 1T7AA 1LQIA 1ICAA 1GPSA 2ASCA 1P00A 2ATBA 1BCGA 2LR3A 1NRBA 1BMRA 2GL1A 3PSMA 2SN3A 1SN1A 1DQ7A 2YEOA 1CN2A 1ZVEA 2E3GA 2KYQA 1B3CA 1AHOA 1PX9A 2LJ7A 1I2VA 1MYNA 1LQQA 1TI5A 4AAZA 4V1DC 1T1TA 2N66A 2LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRA A;  1I6G A;  2LJM A;  1I2U A;  2KBK A;  1WT7 A;  2NY8 X;  1FH3 A;  2I61 A;  1SNB A;  2YC1 C;  2N69 A;  1WWN A;  2KPY A;  4AB0 A;  2LI7 A;  1BK8 A;  2LY5 A;  1N4N A;  1ZU3 A;  1LQH A;  1AYJ A;  1L4V A;  4AEI A;  1SN4 A;  5CY0 A;  1I6F A;  2BRZ A;  1SEG A;  4HHF A;  1JKZ A;  1GPT A;  2N2R A;  1T7E A;  1OMY A;  5KK4 A;  1VNA A;  1WMT A;  4CQK A;  3E7U X;  1PE4 A;  2KJA A;  3E7R L;  1T7B A;  1P0A A;  1ZFU A;  4UJ0 A;  2LY6 A;  1C55 A;  1JZB A;  1DJT A;  2MZ0 A;  1NPI A;  1NH5 A;  4HE7 A;  2KBJ A;  2N2Q A;  1CHZ A;  2LKB A;  1ZVG A;  2KBH A;  1C56 A;  1OZZ A;  1ZYV A;  2A7T A;  2NY9 X;  1VNB A;  2M8B B;  2E3F A;  2B68 A;  2YBR C;  1ZUT A;  1JZA A;  1BRZ A;  1MR4 A;  2KGQ A;  1NE5 A;  2B3C A;  2E0H A;  1B7D A;  1JXC A;  2KSK A;  1ZYW A;  1KV0 A;  1PTX A;  4KYP A;  1T0Z A;  1T7A A;  1LQI A;  1ICA A;  1GPS A;  2ASC A;  1P00 A;  2ATB A;  1BCG A;  2LR3 A;  1NRB A;  1BMR A;  2GL1 A;  3PSM A;  2SN3 A;  1SN1 A;  1DQ7 A;  2YEO A;  1CN2 A;  1ZVE A;  2E3G A;  2KYQ A;  1B3C A;  1AHO A;  1PX9 A;  2LJ7 A;  1I2V A;  1MYN A;  1LQQ A;  1TI5 A;  4AAZ A;  4V1D C;  1T1T A;  2N66 A;  2LT8 A; 
#chains in the Genus database with same CATH topology
 5AQM A;  1NRA A;  1YUW A;  1I6G A;  2YIP A;  3KC6 A;  1NGG A;  2LJM A;  5AQR A;  1QQM A;  1I2U A;  1K8B A;  1NGJ A;  2KBK A;  1NGE A;  1BA1 A;  1WT7 A;  3D2E B;  3LDQ A;  2G2K A;  2NY8 X;  3LDL A;  1FH3 A;  2I61 A;  2D56 A;  3C7N A;  3GKU A;  2JDQ D;  1SNB A;  2YC1 C;  5AQG A;  3IUC A;  5BPL A;  2N69 A;  3FZK A;  5AQS A;  1WWN A;  2KPY A;  1NGF A;  3BK3 C;  4AB0 A;  3D2F A;  2KHO A;  2LI7 A;  5AQF A;  1BK8 A;  3QFP A;  2LY5 A;  2E88 A;  3D2F B;  1DKG D;  5AQX A;  3LDO A;  5AQT A;  1N4N A;  1ZU3 A;  4UAD E;  1LQH A;  1ATR A;  4UAE F;  5AR0 A;  2BUP A;  1AYJ A;  1L4V A;  3KVG A;  2E8A A;  1KAY A;  4AEI A;  1SN4 A;  3QML A;  5CY0 A;  3LDN A;  4H5T A;  1I6F A;  3JXU A;  2BRZ A;  1SEG A;  4HHF A;  5AQJ A;  1XRS B;  2N2R A;  1HPM A;  2QWN A;  2YIL A;  1JKZ A;  1KAX A;  3R2V A;  5BPM A;  1T7E A;  5AQV A;  1OMY A;  2K35 A;  1HX1 A;  2QW9 A;  5BN9 A;  3L56 A;  5KK4 A;  5EVZ A;  1VNA A;  3GL1 A;  4H5N A;  1BA0 A;  1WMT A;  2QWQ A;  4CQK A;  3E7U X;  1PE4 A;  2KJA A;  3SF4 D;  3E7R L;  3L6Q A;  3C7N B;  5FPD A;  1T7B A;  5AQN A;  1P0A A;  1ZFU A;  5FPN A;  4UJ0 A;  4FL9 A;  3M3Z A;  4H5W A;  1GPT A;  2GMO A;  2LY6 A;  1C55 A;  1JZB A;  1DJT A;  3KHW A;  2V7Z A;  2MZ0 A;  1QQN A;  2MN5 A;  1NPI A;  5AQQ A;  1NH5 A;  3ATU A;  1KAZ A;  4HE7 A;  3KOX A;  2KBJ A;  4FSV A;  2N2Q A;  1CHZ A;  2E2F A;  2LKB A;  1ZVG A;  2KBH A;  3KOY A;  2QWL A;  1C56 A;  1NGB A;  1OZZ A;  1UGL A;  1ZYV A;  1NGC A;  3KP1 A;  2LN8 A;  4H5R A;  2A7T A;  5FPM A;  5F0X A;  1NGI A;  4KBO A;  5AQZ A;  2QXL A;  3I33 A;  2NY9 X;  3KP0 A;  5EXW A;  3L4I A;  1VNB A;  2M8B B;  2E3F A;  2B68 A;  2YBR C;  5BN8 A;  5FPE A;  1NGD A;  3LDP A;  3FZF A;  3GDQ A;  1ZUT A;  1JZA A;  5F1X A;  1BRZ A;  1MR4 A;  2KGQ A;  5AQU A;  1NE5 A;  3KOZ A;  2B3C A;  2E0H A;  5AQI A;  1B7D A;  1JXC A;  2KSK A;  2VY6 A;  5BPN A;  1ZYW A;  5AQK A;  1ATS A;  1BUP A;  1KV0 A;  1PTX A;  4H5V A;  4KYP A;  2YIO A;  1T7A A;  1LQI A;  5AQY A;  5EX5 A;  4GNI A;  1NGH A;  3HSC A;  1ICA A;  1GPS A;  3D2E A;  5AQW A;  2ASC A;  1P00 A;  2ATB A;  5EY4 A;  3FZH A;  1BCG A;  1POI A;  2QWP A;  2LR3 A;  1NRB A;  4HWI A;  2GL1 A;  3PSM A;  3QFU A;  2SN3 A;  5AQL A;  2QWM A;  3FZM A;  1BMR A;  1SN1 A;  3A8Y A;  3ATV A;  3AY9 A;  1DQ7 A;  5F2R A;  2YEO A;  1CN2 A;  5AQP A;  2QWR A;  3QI7 A;  1ZVE A;  2E3G A;  3KOW A;  1NGA A;  2KYQ A;  2MBK A;  1B3C A;  1AHO A;  1PX9 A;  2LJ7 A;  1I2V A;  3CQX A;  3FZL A;  1MYN A;  4IO8 A;  5AQO A;  1LQQ A;  1QQO A;  1TI5 A;  4AAZ A;  5AQH A;  2QWO A;  4V1D C;  1S3X A;  1T1T A;  1HJO A;  2LT8 A;  3CW4 A;  4UAF E;  2N66 A;  1T0Z A;  3FE1 A; 
#chains in the Genus database with same CATH homology
 1NRA A;  1I6G A;  2LJM A;  1I2U A;  2KBK A;  1WT7 A;  2NY8 X;  1FH3 A;  2I61 A;  1SNB A;  2YC1 C;  2N69 A;  1WWN A;  2KPY A;  4AB0 A;  2LI7 A;  1BK8 A;  2LY5 A;  1N4N A;  1ZU3 A;  1LQH A;  1AYJ A;  1L4V A;  4AEI A;  1SN4 A;  5CY0 A;  1I6F A;  2BRZ A;  1SEG A;  4HHF A;  1JKZ A;  1GPT A;  2N2R A;  1T7E A;  1OMY A;  5KK4 A;  1VNA A;  1WMT A;  4CQK A;  3E7U X;  1PE4 A;  2KJA A;  3E7R L;  1T7B A;  1P0A A;  1ZFU A;  4UJ0 A;  2LY6 A;  1C55 A;  1JZB A;  1DJT A;  2MZ0 A;  1NPI A;  1NH5 A;  4HE7 A;  2KBJ A;  2N2Q A;  1CHZ A;  2LKB A;  1ZVG A;  2KBH A;  1C56 A;  1OZZ A;  1ZYV A;  2A7T A;  2NY9 X;  1VNB A;  2M8B B;  2E3F A;  2B68 A;  2YBR C;  1ZUT A;  1JZA A;  1BRZ A;  1MR4 A;  2KGQ A;  1NE5 A;  2B3C A;  2E0H A;  1B7D A;  1JXC A;  2KSK A;  1ZYW A;  1KV0 A;  1PTX A;  4KYP A;  1T0Z A;  1T7A A;  1LQI A;  1ICA A;  1GPS A;  2ASC A;  1P00 A;  2ATB A;  1BCG A;  2LR3 A;  1NRB A;  1BMR A;  2GL1 A;  3PSM A;  2SN3 A;  1SN1 A;  1DQ7 A;  2YEO A;  1CN2 A;  1ZVE A;  2E3G A;  2KYQ A;  1B3C A;  1AHO A;  1PX9 A;  2LJ7 A;  1I2V A;  1MYN A;  1LQQ A;  1TI5 A;  4AAZ A;  4V1D C;  1T1T A;  2N66 A;  2LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...