1WT7A

Solution structure of butx-mtx: a butantoxin-maurotoxin chimera
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
41
structure length
41
Chain Sequence
WCSTCLDLACTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BuTX-MTX
publication title Increasing the molecular contacts between maurotoxin and Kv1.2 channel augments ligand affinity.
pubmed doi rcsb
molecule tags Toxin
total genus 6
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2004-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1wt7A00
2E0HA 4AAZA 1NRAA 5CY0A 1ZUTA 2YC1C 1MR4A 1I2UA 2LR3A 2YEOA 1I6FA 1VNBA 2B68A 1ZYVA 2MZ0A 2NY8X 1NH5A 1BMRA 1C55A 1T7AA 1VNAA 2LY6A 1ICAA 1GPTA 1JZBA 2KBHA 1LQQA 1L4VA 2KYQA 1MYNA 1ZYWA 1I2VA 1FH3A 1WWNA 1PX9A 1BRZA 1AHOA 1N4NA 4V1DC 1DJTA 4HHFA 1T7BA 2KBKA 2LY5A 4UJ0A 1CN2A 2B3CA 2N2RA 1B7DA 1JZAA 1P0AA 1B3CA 1JXCA 1ZVGA 2M8BB 1WMTA 2N2QA 2KSKA 2ASCA 2LT8A 1AYJA 1JKZA 2ATBA 1SN1A 2N66A 1SNBA 1SEGA 2YBRC 4AB0A 1T7EA 2I61A 2LJMA 2SN3A 1KV0A 2GL1A 2KPYA 3PSMA 5KK4A 1PTXA 1T0ZA 1P00A 3E7RL 2LJ7A 4KYPA 2KGQA 1LQHA 1ZFUA 4HE7A 1OMYA 2BRZA 3E7UX 4CQKA 1TI5A 2E3FA 2E3GA 2N69A 1ZU3A 1BCGA 1CHZA 1T1TA 1I6GA 1C56A 1OZZA 2A7TA 1BK8A 2LI7A 1PE4A 1LQIA 2NY9X 2KJAA 1SN4A 1DQ7A 4AEIA 1NPIA 2KBJA 1NRBA 2LKBA 1NE5A 1WT7A 1GPSA 1ZVEA
chains in the Genus database with same CATH superfamily
2E0HA 2VY6A 4AAZA 1NRAA 3IUCA 2YILA 5CY0A 1ZUTA 1QQNA 5EXWA 5AQXA 1XRSB 2YC1C 1ATRA 3CW4A 1MR4A 3ATUA 1I2UA 5AQIA 2LR3A 2YEOA 5F2RA 1I6FA 1VNBA 2GMOA 5FPDA 3QI7A 2B68A 4H5NA 1ZYVA 2QWOA 2E8AA 2MZ0A 1NGJA 1HPMA 1NH5A 2NY8X 3D2EA 5FPMA 1BMRA 3FZHA 1HX1A 3SF4D 3JXUA 1YUWA 1T7AA 1VNAA 1C55A 5AQLA 2LY6A 2MN5A 3KVGA 1BUPA 2YIPA 1UGLA 1ICAA 4KBOA 1GPTA 1JZBA 5AQQA 2QWLA 2KBHA 2QXLA 1LQQA 1DKGD 5AQZA 5AQGA 1L4VA 3HSCA 4IO8A 5AQVA 3FZMA 2KYQA 1NGHA 1MYNA 1ZYWA 3A8YA 3C7NA 1I2VA 2QWNA 3KOZA 4H5TA 1FH3A 1WWNA 1PX9A 1BRZA 1HJOA 1ATSA 1AHOA 3FZLA 1N4NA 2KHOA 4V1DC 1DJTA 3L6QA 5AQYA 5BN8A 5F0XA 4HHFA 1T7BA 2V7ZA 4UAFE 5AQPA 1QQOA 2JDQD 2KBKA 4GNIA 1K8BA 3QFPA 5FPEA 2LY5A 5EVZA 5AQMA 3I33A 3CQXA 5EY4A 4UJ0A 2B3CA 1CN2A 1S3XA 2N2RA 1B7DA 1JZAA 5F1XA 1P0AA 2E88A 1NGBA 1JXCA 1B3CA 3D2EB 1ZVGA 2M8BB 5AQTA 3LDQA 3D2FA 3LDPA 1BA1A 2G2KA 1WMTA 1POIA 2BUPA 2KSKA 2ASCA 2N2QA 2QWPA 2MBKA 2LT8A 3L4IA 1AYJA 1NGDA 4H5VA 1JKZA 5AQSA 2ATBA 1SN1A 3KOXA 2N66A 1BA0A 1SNBA 1SEGA 2YBRC 4AB0A 3QMLA 1T7EA 2I61A 2LJMA 2SN3A 4UADE 3M3ZA 1KV0A 2GL1A 1KAYA 3C7NB 2KPYA 3KOWA 3PSMA 5KK4A 5AQWA 1PTXA 3KC6A 1T0ZA 1NGAA 1P00A 1QQMA 2D56A 1KAZA 2QWMA 3E7RL 2LJ7A 3LDLA 2QWRA 4KYPA 5AQRA 2QW9A 1NGCA 2KGQA 1NGIA 1LQHA 1ZFUA 3FE1A 4HE7A 1OMYA 2BRZA 2E2FA 3E7UX 4CQKA 3QFUA 1TI5A 2E3FA 2E3GA 2N69A 3LDOA 4FL9A 3KOYA 5BPNA 3FZFA 5AQNA 5EX5A 1NGFA 1ZU3A 1BCGA 5AQJA 5AQUA 1CHZA 1T1TA 1I6GA 3LDNA 3D2FB 1C56A 2QWQA 3BK3C 3KHWA 3KP1A 1OZZA 2A7TA 1BK8A 1KAXA 4UAEF 3FZKA 1NGEA 5AQFA 3AY9A 3GKUA 2LI7A 3GDQA 4HWIA 1PE4A 1LQIA 3GL1A 4H5WA 4FSVA 3ATVA 2NY9X 5AQHA 5BPLA 2KJAA 1SN4A 5FPNA 1DQ7A 2YIOA 5AQKA 1NGGA 4AEIA 1NPIA 2K35A 5BPMA 5AQOA 2KBJA 3L56A 1NRBA 2LKBA 1NE5A 3KP0A 3R2VA 2LN8A 1WT7A 4H5RA 1GPSA 5BN9A 1ZVEA 5AR0A
chains in the Genus database with same CATH topology
2E0HA 4AAZA 1NRAA 5CY0A 1ZUTA 2YC1C 1MR4A 1I2UA 2LR3A 2YEOA 1I6FA 1VNBA 2B68A 1ZYVA 2MZ0A 2NY8X 1NH5A 1BMRA 1C55A 1T7AA 1VNAA 2LY6A 1ICAA 1GPTA 1JZBA 2KBHA 1LQQA 1L4VA 2KYQA 1MYNA 1ZYWA 1I2VA 1FH3A 1WWNA 1PX9A 1BRZA 1AHOA 1N4NA 4V1DC 1DJTA 4HHFA 1T7BA 2KBKA 2LY5A 4UJ0A 1CN2A 2B3CA 2N2RA 1B7DA 1JZAA 1P0AA 1B3CA 1JXCA 1ZVGA 2M8BB 1WMTA 2N2QA 2KSKA 2ASCA 2LT8A 1AYJA 1JKZA 2ATBA 1SN1A 2N66A 1SNBA 1SEGA 2YBRC 4AB0A 1T7EA 2I61A 2LJMA 2SN3A 1KV0A 2GL1A 2KPYA 3PSMA 5KK4A 1PTXA 1T0ZA 1P00A 3E7RL 2LJ7A 4KYPA 2KGQA 1LQHA 1ZFUA 4HE7A 1OMYA 2BRZA 3E7UX 4CQKA 1TI5A 2E3FA 2E3GA 2N69A 1ZU3A 1BCGA 1CHZA 1T1TA 1I6GA 1C56A 1OZZA 2A7TA 1BK8A 2LI7A 1PE4A 1LQIA 2NY9X 2KJAA 1SN4A 1DQ7A 4AEIA 1NPIA 2KBJA 1NRBA 2LKBA 1NE5A 1WT7A 1GPSA 1ZVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E0H A;  4AAZ A;  1NRA A;  5CY0 A;  1ZUT A;  2YC1 C;  1MR4 A;  1I2U A;  2LR3 A;  2YEO A;  1I6F A;  1VNB A;  2B68 A;  1ZYV A;  2MZ0 A;  2NY8 X;  1NH5 A;  1BMR A;  1C55 A;  1T7A A;  1VNA A;  2LY6 A;  1ICA A;  1GPT A;  1JZB A;  2KBH A;  1LQQ A;  1L4V A;  2KYQ A;  1MYN A;  1ZYW A;  1I2V A;  1FH3 A;  1WWN A;  1PX9 A;  1BRZ A;  1AHO A;  1N4N A;  4V1D C;  1DJT A;  4HHF A;  1T7B A;  2KBK A;  2LY5 A;  4UJ0 A;  1CN2 A;  2B3C A;  2N2R A;  1B7D A;  1JZA A;  1P0A A;  1B3C A;  1JXC A;  1ZVG A;  2M8B B;  1WMT A;  2N2Q A;  2KSK A;  2ASC A;  2LT8 A;  1AYJ A;  1JKZ A;  2ATB A;  1SN1 A;  2N66 A;  1SNB A;  1SEG A;  2YBR C;  4AB0 A;  1T7E A;  2I61 A;  2LJM A;  2SN3 A;  1KV0 A;  2GL1 A;  2KPY A;  3PSM A;  5KK4 A;  1PTX A;  1T0Z A;  1P00 A;  3E7R L;  2LJ7 A;  4KYP A;  2KGQ A;  1LQH A;  1ZFU A;  4HE7 A;  1OMY A;  2BRZ A;  3E7U X;  4CQK A;  1TI5 A;  2E3F A;  2E3G A;  2N69 A;  1ZU3 A;  1BCG A;  1CHZ A;  1T1T A;  1I6G A;  1C56 A;  1OZZ A;  2A7T A;  1BK8 A;  2LI7 A;  1PE4 A;  1LQI A;  2NY9 X;  2KJA A;  1SN4 A;  1DQ7 A;  4AEI A;  1NPI A;  2KBJ A;  1NRB A;  2LKB A;  1NE5 A;  1WT7 A;  1GPS A;  1ZVE A; 
#chains in the Genus database with same CATH topology
 2E0H A;  2VY6 A;  4AAZ A;  1NRA A;  3IUC A;  2YIL A;  5CY0 A;  1ZUT A;  1QQN A;  5EXW A;  5AQX A;  1XRS B;  2YC1 C;  1ATR A;  3CW4 A;  1MR4 A;  3ATU A;  1I2U A;  5AQI A;  2LR3 A;  2YEO A;  5F2R A;  1I6F A;  1VNB A;  2GMO A;  5FPD A;  3QI7 A;  2B68 A;  4H5N A;  1ZYV A;  2QWO A;  2E8A A;  2MZ0 A;  1NGJ A;  1HPM A;  1NH5 A;  2NY8 X;  3D2E A;  5FPM A;  1BMR A;  3FZH A;  1HX1 A;  3SF4 D;  3JXU A;  1YUW A;  1T7A A;  1VNA A;  1C55 A;  5AQL A;  2LY6 A;  2MN5 A;  3KVG A;  1BUP A;  2YIP A;  1UGL A;  1ICA A;  4KBO A;  1GPT A;  1JZB A;  5AQQ A;  2QWL A;  2KBH A;  2QXL A;  1LQQ A;  1DKG D;  5AQZ A;  5AQG A;  1L4V A;  3HSC A;  4IO8 A;  5AQV A;  3FZM A;  2KYQ A;  1NGH A;  1MYN A;  1ZYW A;  3A8Y A;  3C7N A;  1I2V A;  2QWN A;  3KOZ A;  4H5T A;  1FH3 A;  1WWN A;  1PX9 A;  1BRZ A;  1HJO A;  1ATS A;  1AHO A;  3FZL A;  1N4N A;  2KHO A;  4V1D C;  1DJT A;  3L6Q A;  5AQY A;  5BN8 A;  5F0X A;  4HHF A;  1T7B A;  2V7Z A;  4UAF E;  5AQP A;  1QQO A;  2JDQ D;  2KBK A;  4GNI A;  1K8B A;  3QFP A;  5FPE A;  2LY5 A;  5EVZ A;  5AQM A;  3I33 A;  3CQX A;  5EY4 A;  4UJ0 A;  2B3C A;  1CN2 A;  1S3X A;  2N2R A;  1B7D A;  1JZA A;  5F1X A;  1P0A A;  2E88 A;  1NGB A;  1JXC A;  1B3C A;  3D2E B;  1ZVG A;  2M8B B;  5AQT A;  3LDQ A;  3D2F A;  3LDP A;  1BA1 A;  2G2K A;  1WMT A;  1POI A;  2BUP A;  2KSK A;  2ASC A;  2N2Q A;  2QWP A;  2MBK A;  2LT8 A;  3L4I A;  1AYJ A;  1NGD A;  4H5V A;  1JKZ A;  5AQS A;  2ATB A;  1SN1 A;  3KOX A;  2N66 A;  1BA0 A;  1SNB A;  1SEG A;  2YBR C;  4AB0 A;  3QML A;  1T7E A;  2I61 A;  2LJM A;  2SN3 A;  4UAD E;  3M3Z A;  1KV0 A;  2GL1 A;  1KAY A;  3C7N B;  2KPY A;  3KOW A;  3PSM A;  5KK4 A;  5AQW A;  1PTX A;  3KC6 A;  1T0Z A;  1NGA A;  1P00 A;  1QQM A;  2D56 A;  1KAZ A;  2QWM A;  3E7R L;  2LJ7 A;  3LDL A;  2QWR A;  4KYP A;  5AQR A;  2QW9 A;  1NGC A;  2KGQ A;  1NGI A;  1LQH A;  1ZFU A;  3FE1 A;  4HE7 A;  1OMY A;  2BRZ A;  2E2F A;  3E7U X;  4CQK A;  3QFU A;  1TI5 A;  2E3F A;  2E3G A;  2N69 A;  3LDO A;  4FL9 A;  3KOY A;  5BPN A;  3FZF A;  5AQN A;  5EX5 A;  1NGF A;  1ZU3 A;  1BCG A;  5AQJ A;  5AQU A;  1CHZ A;  1T1T A;  1I6G A;  3LDN A;  3D2F B;  1C56 A;  2QWQ A;  3BK3 C;  3KHW A;  3KP1 A;  1OZZ A;  2A7T A;  1BK8 A;  1KAX A;  4UAE F;  3FZK A;  1NGE A;  5AQF A;  3AY9 A;  3GKU A;  2LI7 A;  3GDQ A;  4HWI A;  1PE4 A;  1LQI A;  3GL1 A;  4H5W A;  4FSV A;  3ATV A;  2NY9 X;  5AQH A;  5BPL A;  2KJA A;  1SN4 A;  5FPN A;  1DQ7 A;  2YIO A;  5AQK A;  1NGG A;  4AEI A;  1NPI A;  2K35 A;  5BPM A;  5AQO A;  2KBJ A;  3L56 A;  1NRB A;  2LKB A;  1NE5 A;  3KP0 A;  3R2V A;  2LN8 A;  1WT7 A;  4H5R A;  1GPS A;  5BN9 A;  1ZVE A;  5AR0 A; 
#chains in the Genus database with same CATH homology
 2E0H A;  4AAZ A;  1NRA A;  5CY0 A;  1ZUT A;  2YC1 C;  1MR4 A;  1I2U A;  2LR3 A;  2YEO A;  1I6F A;  1VNB A;  2B68 A;  1ZYV A;  2MZ0 A;  2NY8 X;  1NH5 A;  1BMR A;  1C55 A;  1T7A A;  1VNA A;  2LY6 A;  1ICA A;  1GPT A;  1JZB A;  2KBH A;  1LQQ A;  1L4V A;  2KYQ A;  1MYN A;  1ZYW A;  1I2V A;  1FH3 A;  1WWN A;  1PX9 A;  1BRZ A;  1AHO A;  1N4N A;  4V1D C;  1DJT A;  4HHF A;  1T7B A;  2KBK A;  2LY5 A;  4UJ0 A;  1CN2 A;  2B3C A;  2N2R A;  1B7D A;  1JZA A;  1P0A A;  1B3C A;  1JXC A;  1ZVG A;  2M8B B;  1WMT A;  2N2Q A;  2KSK A;  2ASC A;  2LT8 A;  1AYJ A;  1JKZ A;  2ATB A;  1SN1 A;  2N66 A;  1SNB A;  1SEG A;  2YBR C;  4AB0 A;  1T7E A;  2I61 A;  2LJM A;  2SN3 A;  1KV0 A;  2GL1 A;  2KPY A;  3PSM A;  5KK4 A;  1PTX A;  1T0Z A;  1P00 A;  3E7R L;  2LJ7 A;  4KYP A;  2KGQ A;  1LQH A;  1ZFU A;  4HE7 A;  1OMY A;  2BRZ A;  3E7U X;  4CQK A;  1TI5 A;  2E3F A;  2E3G A;  2N69 A;  1ZU3 A;  1BCG A;  1CHZ A;  1T1T A;  1I6G A;  1C56 A;  1OZZ A;  2A7T A;  1BK8 A;  2LI7 A;  1PE4 A;  1LQI A;  2NY9 X;  2KJA A;  1SN4 A;  1DQ7 A;  4AEI A;  1NPI A;  2KBJ A;  1NRB A;  2LKB A;  1NE5 A;  1WT7 A;  1GPS A;  1ZVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...