1ZVEA

Crystal structure of mutant k8g of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIAGPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zveA00
1BMRA 1SN1A 4AAZA 1C55A 1ZYVA 2ASCA 1MR4A 2N2QA 1ZYWA 1VNBA 2KSKA 1FH3A 2GL1A 2B68A 4AB0A 1GPTA 2LY6A 2YC1C 4HE7A 1LQQA 2ATBA 2NY8X 4HHFA 1C56A 2LR3A 1NRAA 3E7UX 1SN4A 2I61A 1T7EA 2LI7A 1N4NA 2NY9X 1JZBA 1B7DA 1NH5A 2N2RA 1P00A 2KPYA 2YBRC 1NPIA 1BCGA 2E3FA 1JKZA 1KV0A 1DJTA 1GPSA 1ZU3A 2KBJA 2LJ7A 1ZVGA 1ICAA 1I2VA 1CHZA 2M8BB 1BK8A 1L4VA 2LJMA 1AYJA 1SNBA 1LQIA 1ZFUA 1PE4A 1CN2A 2E3GA 1T0ZA 1WMTA 3PSMA 2N66A 1I6FA 1AHOA 2SN3A 4KYPA 1JZAA 2KYQA 4AEIA 2N69A 1SEGA 1WWNA 1MYNA 2KJAA 2BRZA 1ZVEA 1OMYA 1LQHA 1NE5A 1VNAA 1OZZA 4CQKA 1WT7A 2KBHA 1I6GA 1NRBA 1ZUTA 1I2UA 2B3CA 1TI5A 2KGQA 2MZ0A 1T7BA 4UJ0A 1T1TA 2A7TA 2E0HA 5KK4A 4V1DC 2LT8A 1PTXA 1JXCA 1DQ7A 1PX9A 1BRZA 3E7RL 2LKBA 5CY0A 1T7AA 1P0AA 2YEOA 1B3CA 2LY5A 2KBKA
chains in the Genus database with same CATH superfamily
1BMRA 1SN1A 2QWOA 4AAZA 5BPLA 1C55A 2QWQA 3A8YA 2QWMA 1ZYVA 5AQOA 2ASCA 1MR4A 3I33A 2N2QA 3HSCA 1NGEA 1ZYWA 3QFPA 1VNBA 2KSKA 1S3XA 3FZFA 1FH3A 2GL1A 2B68A 4AB0A 3LDQA 2LY6A 5AQIA 1GPTA 2D56A 3FE1A 3M3ZA 1NGFA 3ATUA 2YC1C 4HE7A 1LQQA 2E8AA 2ATBA 2NY8X 2G2KA 4HHFA 5AQUA 2QWLA 1KAZA 3C7NA 3FZMA 1C56A 1NGAA 2LR3A 1NRAA 1NGHA 1NGJA 3FZKA 3KC6A 4H5WA 3E7UX 5BN8A 1SN4A 1HJOA 2I61A 1T7EA 1BUPA 2LI7A 4UAFE 1N4NA 5EVZA 5AR0A 2NY9X 1JZBA 1DKGD 1B7DA 1NH5A 2GMOA 2N2RA 1P00A 2KPYA 5AQMA 4UAEF 2YBRC 3KP0A 3LDLA 4UJ0A 1UGLA 1NPIA 3GKUA 2VY6A 1BCGA 3CQXA 4H5TA 3KOYA 2K35A 3C7NB 5AQNA 5AQSA 2E3FA 4UADE 4IO8A 5AQTA 3SF4D 1JKZA 1KV0A 1DJTA 3QI7A 5AQWA 1GPSA 1ZU3A 2E88A 2KBJA 2LJ7A 1ZVGA 1ICAA 3LDPA 1KAYA 2V7ZA 1CHZA 2M8BB 1I2VA 1BK8A 1L4VA 2YIOA 3FZHA 1QQMA 4FL9A 3CW4A 3D2EA 3QMLA 2LJMA 1HX1A 4KBOA 1AYJA 1SNBA 1POIA 1LQIA 2LN8A 5AQKA 1ATRA 3ATVA 5FPNA 1ZFUA 1PE4A 1CN2A 4H5NA 5AQFA 1NGDA 2E3GA 1T0ZA 1WMTA 3PSMA 4GNIA 2N66A 3L6QA 1I6FA 5F0XA 1XRSB 5EXWA 4H5VA 3D2FA 1AHOA 2MBKA 3FZLA 5AQLA 2SN3A 5FPDA 5FPEA 5AQYA 4HWIA 1QQNA 4KYPA 1JZAA 2KYQA 1ATSA 3D2EB 3LDOA 4FSVA 4AEIA 2N69A 2YIPA 5F1XA 2QXLA 3KOZA 1SEGA 1WWNA 1NGCA 1MYNA 2QWRA 5EY4A 1HPMA 2MN5A 2KJAA 5AQVA 2BRZA 1ZVEA 5AQJA 1LQHA 1OMYA 3BK3C 5BPMA 1NE5A 3GDQA 1VNAA 1OZZA 2JDQD 3GL1A 2YILA 1WT7A 2KBHA 4CQKA 3KVGA 3D2FB 3AY9A 2QWNA 1NRBA 5FPMA 1I6GA 2KHOA 3KOWA 1ZUTA 1I2UA 3R2VA 1NGBA 1K8BA 2B3CA 1TI5A 1YUWA 2KGQA 1BA0A 3LDNA 2QW9A 4H5RA 2MZ0A 1T7BA 3KHWA 5AQPA 2BUPA 3IUCA 1T1TA 2A7TA 3QFUA 2E0HA 5AQGA 5KK4A 4V1DC 3JXUA 1NGGA 2LT8A 1PTXA 1JXCA 1DQ7A 1PX9A 5BN9A 1BRZA 3E7RL 5F2RA 2LKBA 3L56A 5BPNA 5AQXA 3KOXA 5AQZA 5CY0A 1T7AA 1BA1A 5EX5A 1NGIA 1KAXA 1P0AA 2E2FA 2QWPA 2YEOA 3KP1A 3L4IA 1QQOA 5AQHA 5AQRA 5AQQA 1B3CA 2LY5A 2KBKA
chains in the Genus database with same CATH topology
1BMRA 1SN1A 4AAZA 1C55A 1ZYVA 2ASCA 1MR4A 2N2QA 1ZYWA 1VNBA 2KSKA 1FH3A 2GL1A 2B68A 4AB0A 1GPTA 2LY6A 2YC1C 4HE7A 1LQQA 2ATBA 2NY8X 4HHFA 1C56A 2LR3A 1NRAA 3E7UX 1SN4A 2I61A 1T7EA 2LI7A 1N4NA 2NY9X 1JZBA 1B7DA 1NH5A 2N2RA 1P00A 2KPYA 2YBRC 1NPIA 1BCGA 2E3FA 1JKZA 1KV0A 1DJTA 1GPSA 1ZU3A 2KBJA 2LJ7A 1ZVGA 1ICAA 1I2VA 1CHZA 2M8BB 1BK8A 1L4VA 2LJMA 1AYJA 1SNBA 1LQIA 1ZFUA 1PE4A 1CN2A 2E3GA 1T0ZA 1WMTA 3PSMA 2N66A 1I6FA 1AHOA 2SN3A 4KYPA 1JZAA 2KYQA 4AEIA 2N69A 1SEGA 1WWNA 1MYNA 2KJAA 2BRZA 1ZVEA 1OMYA 1LQHA 1NE5A 1VNAA 1OZZA 4CQKA 1WT7A 2KBHA 1I6GA 1NRBA 1ZUTA 1I2UA 2B3CA 1TI5A 2KGQA 2MZ0A 1T7BA 4UJ0A 1T1TA 2A7TA 2E0HA 5KK4A 4V1DC 2LT8A 1PTXA 1JXCA 1DQ7A 1PX9A 1BRZA 3E7RL 2LKBA 5CY0A 1T7AA 1P0AA 2YEOA 1B3CA 2LY5A 2KBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMR A;  1SN1 A;  4AAZ A;  1C55 A;  1ZYV A;  2ASC A;  1MR4 A;  2N2Q A;  1ZYW A;  1VNB A;  2KSK A;  1FH3 A;  2GL1 A;  2B68 A;  4AB0 A;  1GPT A;  2LY6 A;  2YC1 C;  4HE7 A;  1LQQ A;  2ATB A;  2NY8 X;  4HHF A;  1C56 A;  2LR3 A;  1NRA A;  3E7U X;  1SN4 A;  2I61 A;  1T7E A;  2LI7 A;  1N4N A;  2NY9 X;  1JZB A;  1B7D A;  1NH5 A;  2N2R A;  1P00 A;  2KPY A;  2YBR C;  1NPI A;  1BCG A;  2E3F A;  1JKZ A;  1KV0 A;  1DJT A;  1GPS A;  1ZU3 A;  2KBJ A;  2LJ7 A;  1ZVG A;  1ICA A;  1I2V A;  1CHZ A;  2M8B B;  1BK8 A;  1L4V A;  2LJM A;  1AYJ A;  1SNB A;  1LQI A;  1ZFU A;  1PE4 A;  1CN2 A;  2E3G A;  1T0Z A;  1WMT A;  3PSM A;  2N66 A;  1I6F A;  1AHO A;  2SN3 A;  4KYP A;  1JZA A;  2KYQ A;  4AEI A;  2N69 A;  1SEG A;  1WWN A;  1MYN A;  2KJA A;  2BRZ A;  1ZVE A;  1OMY A;  1LQH A;  1NE5 A;  1VNA A;  1OZZ A;  4CQK A;  1WT7 A;  2KBH A;  1I6G A;  1NRB A;  1ZUT A;  1I2U A;  2B3C A;  1TI5 A;  2KGQ A;  2MZ0 A;  1T7B A;  4UJ0 A;  1T1T A;  2A7T A;  2E0H A;  5KK4 A;  4V1D C;  2LT8 A;  1PTX A;  1JXC A;  1DQ7 A;  1PX9 A;  1BRZ A;  3E7R L;  2LKB A;  5CY0 A;  1T7A A;  1P0A A;  2YEO A;  1B3C A;  2LY5 A;  2KBK A; 
#chains in the Genus database with same CATH topology
 1BMR A;  1SN1 A;  2QWO A;  4AAZ A;  5BPL A;  1C55 A;  2QWQ A;  3A8Y A;  2QWM A;  1ZYV A;  5AQO A;  2ASC A;  1MR4 A;  3I33 A;  2N2Q A;  3HSC A;  1NGE A;  1ZYW A;  3QFP A;  1VNB A;  2KSK A;  1S3X A;  3FZF A;  1FH3 A;  2GL1 A;  2B68 A;  4AB0 A;  3LDQ A;  2LY6 A;  5AQI A;  1GPT A;  2D56 A;  3FE1 A;  3M3Z A;  1NGF A;  3ATU A;  2YC1 C;  4HE7 A;  1LQQ A;  2E8A A;  2ATB A;  2NY8 X;  2G2K A;  4HHF A;  5AQU A;  2QWL A;  1KAZ A;  3C7N A;  3FZM A;  1C56 A;  1NGA A;  2LR3 A;  1NRA A;  1NGH A;  1NGJ A;  3FZK A;  3KC6 A;  4H5W A;  3E7U X;  5BN8 A;  1SN4 A;  1HJO A;  2I61 A;  1T7E A;  1BUP A;  2LI7 A;  4UAF E;  1N4N A;  5EVZ A;  5AR0 A;  2NY9 X;  1JZB A;  1DKG D;  1B7D A;  1NH5 A;  2GMO A;  2N2R A;  1P00 A;  2KPY A;  5AQM A;  4UAE F;  2YBR C;  3KP0 A;  3LDL A;  4UJ0 A;  1UGL A;  1NPI A;  3GKU A;  2VY6 A;  1BCG A;  3CQX A;  4H5T A;  3KOY A;  2K35 A;  3C7N B;  5AQN A;  5AQS A;  2E3F A;  4UAD E;  4IO8 A;  5AQT A;  3SF4 D;  1JKZ A;  1KV0 A;  1DJT A;  3QI7 A;  5AQW A;  1GPS A;  1ZU3 A;  2E88 A;  2KBJ A;  2LJ7 A;  1ZVG A;  1ICA A;  3LDP A;  1KAY A;  2V7Z A;  1CHZ A;  2M8B B;  1I2V A;  1BK8 A;  1L4V A;  2YIO A;  3FZH A;  1QQM A;  4FL9 A;  3CW4 A;  3D2E A;  3QML A;  2LJM A;  1HX1 A;  4KBO A;  1AYJ A;  1SNB A;  1POI A;  1LQI A;  2LN8 A;  5AQK A;  1ATR A;  3ATV A;  5FPN A;  1ZFU A;  1PE4 A;  1CN2 A;  4H5N A;  5AQF A;  1NGD A;  2E3G A;  1T0Z A;  1WMT A;  3PSM A;  4GNI A;  2N66 A;  3L6Q A;  1I6F A;  5F0X A;  1XRS B;  5EXW A;  4H5V A;  3D2F A;  1AHO A;  2MBK A;  3FZL A;  5AQL A;  2SN3 A;  5FPD A;  5FPE A;  5AQY A;  4HWI A;  1QQN A;  4KYP A;  1JZA A;  2KYQ A;  1ATS A;  3D2E B;  3LDO A;  4FSV A;  4AEI A;  2N69 A;  2YIP A;  5F1X A;  2QXL A;  3KOZ A;  1SEG A;  1WWN A;  1NGC A;  1MYN A;  2QWR A;  5EY4 A;  1HPM A;  2MN5 A;  2KJA A;  5AQV A;  2BRZ A;  1ZVE A;  5AQJ A;  1LQH A;  1OMY A;  3BK3 C;  5BPM A;  1NE5 A;  3GDQ A;  1VNA A;  1OZZ A;  2JDQ D;  3GL1 A;  2YIL A;  1WT7 A;  2KBH A;  4CQK A;  3KVG A;  3D2F B;  3AY9 A;  2QWN A;  1NRB A;  5FPM A;  1I6G A;  2KHO A;  3KOW A;  1ZUT A;  1I2U A;  3R2V A;  1NGB A;  1K8B A;  2B3C A;  1TI5 A;  1YUW A;  2KGQ A;  1BA0 A;  3LDN A;  2QW9 A;  4H5R A;  2MZ0 A;  1T7B A;  3KHW A;  5AQP A;  2BUP A;  3IUC A;  1T1T A;  2A7T A;  3QFU A;  2E0H A;  5AQG A;  5KK4 A;  4V1D C;  3JXU A;  1NGG A;  2LT8 A;  1PTX A;  1JXC A;  1DQ7 A;  1PX9 A;  5BN9 A;  1BRZ A;  3E7R L;  5F2R A;  2LKB A;  3L56 A;  5BPN A;  5AQX A;  3KOX A;  5AQZ A;  5CY0 A;  1T7A A;  1BA1 A;  5EX5 A;  1NGI A;  1KAX A;  1P0A A;  2E2F A;  2QWP A;  2YEO A;  3KP1 A;  3L4I A;  1QQO A;  5AQH A;  5AQR A;  5AQQ A;  1B3C A;  2LY5 A;  2KBK A; 
#chains in the Genus database with same CATH homology
 1BMR A;  1SN1 A;  4AAZ A;  1C55 A;  1ZYV A;  2ASC A;  1MR4 A;  2N2Q A;  1ZYW A;  1VNB A;  2KSK A;  1FH3 A;  2GL1 A;  2B68 A;  4AB0 A;  1GPT A;  2LY6 A;  2YC1 C;  4HE7 A;  1LQQ A;  2ATB A;  2NY8 X;  4HHF A;  1C56 A;  2LR3 A;  1NRA A;  3E7U X;  1SN4 A;  2I61 A;  1T7E A;  2LI7 A;  1N4N A;  2NY9 X;  1JZB A;  1B7D A;  1NH5 A;  2N2R A;  1P00 A;  2KPY A;  2YBR C;  1NPI A;  1BCG A;  2E3F A;  1JKZ A;  1KV0 A;  1DJT A;  1GPS A;  1ZU3 A;  2KBJ A;  2LJ7 A;  1ZVG A;  1ICA A;  1I2V A;  1CHZ A;  2M8B B;  1BK8 A;  1L4V A;  2LJM A;  1AYJ A;  1SNB A;  1LQI A;  1ZFU A;  1PE4 A;  1CN2 A;  2E3G A;  1T0Z A;  1WMT A;  3PSM A;  2N66 A;  1I6F A;  1AHO A;  2SN3 A;  4KYP A;  1JZA A;  2KYQ A;  4AEI A;  2N69 A;  1SEG A;  1WWN A;  1MYN A;  2KJA A;  2BRZ A;  1ZVE A;  1OMY A;  1LQH A;  1NE5 A;  1VNA A;  1OZZ A;  4CQK A;  1WT7 A;  2KBH A;  1I6G A;  1NRB A;  1ZUT A;  1I2U A;  2B3C A;  1TI5 A;  2KGQ A;  2MZ0 A;  1T7B A;  4UJ0 A;  1T1T A;  2A7T A;  2E0H A;  5KK4 A;  4V1D C;  2LT8 A;  1PTX A;  1JXC A;  1DQ7 A;  1PX9 A;  1BRZ A;  3E7R L;  2LKB A;  5CY0 A;  1T7A A;  1P0A A;  2YEO A;  1B3C A;  2LY5 A;  2KBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...