1ZVEA

Crystal structure of mutant k8g of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
b'NSVRDAYIAGPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zveA00
2SN3A 1T1TA 2KBJA 2MZ0A 5CY0A 2KPYA 1GPTA 4KYPA 1DJTA 1AYJA 1BRZA 2YC1C 2M8BB 2KYQA 1N4NA 1FH3A 1GPSA 1WWNA 2LR3A 2N66A 1WT7A 4HHFA 2LKBA 1ZU3A 2KBHA 1JZAA 1T7EA 2KSKA 2LJMA 1VNAA 1ZFUA 1I2UA 2B68A 4HE7A 2KGQA 1LQIA 4AAZA 2LY5A 1ICAA 1LQQA 1LQHA 1C55A 2ASCA 1TI5A 1OMYA 3PSMA 1DQ7A 1P0AA 2BRZA 1PX9A 1P00A 1B7DA 1KV0A 1NRBA 2NY9X 2E3FA 2A7TA 2KJAA 2E0HA 1BCGA 1PTXA 1ZVGA 1BK8A 2B3CA 1CHZA 2YBRC 1VNBA 1SN4A 1T7AA 1JZBA 1BMRA 4CQKA 2NY8X 1NE5A 2LT8A 1JXCA 2YEOA 1NRAA 1ZUTA 1ZVEA 3E7RL 1SEGA 5KK4A 2E3GA 1MYNA 2KBKA 1CN2A 1MR4A 1T7BA 1NPIA 1T0ZA 1I6GA 3E7UX 1AHOA 1I6FA 1SN1A 4UJ0A 2LI7A 1WMTA 2N2RA 1B3CA 1ZYWA 1NH5A 1C56A 1I2VA 2LY6A 1JKZA 2N2QA 4AB0A 4AEIA 1SNBA 1ZYVA 2ATBA 1PE4A 2N69A 1L4VA 2I61A 1OZZA 2GL1A 2LJ7A 4V1DC
chains in the Genus database with same CATH superfamily
2SN3A 1T1TA 3GL1A 2KBJA 3HSCA 5AQJA 1ATRA 2MZ0A 5CY0A 2E8AA 3FZLA 2KPYA 3GKUA 1GPTA 4KYPA 1DJTA 5AQUA 5F1XA 1AYJA 1BRZA 2YC1C 2M8BB 2KYQA 3FZKA 1N4NA 3R2VA 3LDQA 1FH3A 1GPSA 1WWNA 2MBKA 5AQIA 2LR3A 4H5TA 3KP0A 5F2RA 2QWOA 1S3XA 2N66A 1BA0A 5FPNA 1WT7A 3QI7A 2QWRA 4HHFA 4GNIA 3SF4D 1NGBA 3KOZA 2LKBA 1ZU3A 2KBHA 3ATVA 1JZAA 5AQOA 1T7EA 2KSKA 2LJMA 4FSVA 1YUWA 5AQSA 3KOWA 3M3ZA 1VNAA 5F0XA 5FPDA 1ZFUA 1QQOA 5AQQA 1DKGD 2BUPA 3FE1A 1HPMA 3LDPA 1I2UA 1KAZA 2B68A 5EVZA 5AQMA 4HE7A 2KGQA 1LQIA 2QW9A 3KP1A 3A8YA 4AAZA 3JXUA 3LDLA 3FZMA 3KOYA 1NGJA 2LY5A 1ICAA 1LQQA 1LQHA 1POIA 1C55A 1NGDA 5EX5A 2ASCA 3C7NA 2QXLA 1TI5A 1OMYA 3PSMA 1DQ7A 2QWLA 2YIOA 5AQTA 1P0AA 1NGEA 2BRZA 3D2FA 1PX9A 3CW4A 3GDQA 1P00A 1B7DA 1BA1A 3ATUA 5FPEA 2GMOA 2LN8A 1KV0A 4UAEF 1NRBA 2JDQD 1HX1A 5AQNA 2NY9X 2VY6A 5EY4A 2E3FA 5AQYA 4H5RA 2A7TA 1QQNA 2KJAA 3QMLA 2E0HA 2MN5A 3KOXA 1BCGA 1PTXA 1ZVGA 1NGGA 2KHOA 1BK8A 1QQMA 3BK3C 5AQFA 3FZFA 2B3CA 1CHZA 2YBRC 5AQPA 1VNBA 1HJOA 1SN4A 1T7AA 2QWPA 1JZBA 3KHWA 1BMRA 1K8BA 1UGLA 4CQKA 2V7ZA 5BN8A 2NY8X 4IO8A 1XRSB 3L56A 4FL9A 1KAYA 2QWQA 1NE5A 3L4IA 2LT8A 5BPMA 1JXCA 2YEOA 1NRAA 1ZUTA 3D2EA 1ZVEA 3E7RL 1SEGA 5AQKA 5AR0A 1ATSA 5KK4A 2E3GA 1MYNA 2KBKA 5AQVA 1CN2A 1NGFA 1MR4A 1T7BA 1NPIA 1T0ZA 3IUCA 4H5NA 3LDNA 2G2KA 5BPLA 1I6GA 5BPNA 4UAFE 2K35A 3FZHA 3E7UX 1AHOA 3CQXA 2YILA 5BN9A 5AQRA 1I6FA 1SN1A 5AQZA 4UJ0A 1NGIA 2LI7A 1KAXA 1WMTA 3L6QA 1NGCA 2N2RA 5AQHA 3C7NB 1NGAA 1B3CA 5AQWA 1ZYWA 3KC6A 1NH5A 3QFPA 3QFUA 2D56A 1C56A 3D2EB 3D2FB 2LY6A 5AQGA 5FPMA 1I2VA 5AQXA 2N2QA 1JKZA 1BUPA 2QWMA 4AB0A 4H5WA 4AEIA 1SNBA 1NGHA 5EXWA 3AY9A 3I33A 3KVGA 4KBOA 4HWIA 1ZYVA 2E2FA 2YIPA 2E88A 2ATBA 1PE4A 2N69A 4UADE 2I61A 4H5VA 2QWNA 1OZZA 2GL1A 1L4VA 5AQLA 2LJ7A 3LDOA 4V1DC
chains in the Genus database with same CATH topology
2SN3A 1T1TA 2KBJA 2MZ0A 5CY0A 2KPYA 1GPTA 4KYPA 1DJTA 1AYJA 1BRZA 2YC1C 2M8BB 2KYQA 1N4NA 1FH3A 1GPSA 1WWNA 2LR3A 2N66A 1WT7A 4HHFA 2LKBA 1ZU3A 2KBHA 1JZAA 1T7EA 2KSKA 2LJMA 1VNAA 1ZFUA 1I2UA 2B68A 4HE7A 2KGQA 1LQIA 4AAZA 2LY5A 1ICAA 1LQQA 1LQHA 1C55A 2ASCA 1TI5A 1OMYA 3PSMA 1DQ7A 1P0AA 2BRZA 1PX9A 1P00A 1B7DA 1KV0A 1NRBA 2NY9X 2E3FA 2A7TA 2KJAA 2E0HA 1BCGA 1PTXA 1ZVGA 1BK8A 2B3CA 1CHZA 2YBRC 1VNBA 1SN4A 1T7AA 1JZBA 1BMRA 4CQKA 2NY8X 1NE5A 2LT8A 1JXCA 2YEOA 1NRAA 1ZUTA 1ZVEA 3E7RL 1SEGA 5KK4A 2E3GA 1MYNA 2KBKA 1CN2A 1MR4A 1T7BA 1NPIA 1T0ZA 1I6GA 3E7UX 1AHOA 1I6FA 1SN1A 4UJ0A 2LI7A 1WMTA 2N2RA 1B3CA 1ZYWA 1NH5A 1C56A 1I2VA 2LY6A 1JKZA 2N2QA 4AB0A 4AEIA 1SNBA 1ZYVA 2ATBA 1PE4A 2N69A 1L4VA 2I61A 1OZZA 2GL1A 2LJ7A 4V1DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SN3 A;  1T1T A;  2KBJ A;  2MZ0 A;  5CY0 A;  2KPY A;  1GPT A;  4KYP A;  1DJT A;  1AYJ A;  1BRZ A;  2YC1 C;  2M8B B;  2KYQ A;  1N4N A;  1FH3 A;  1GPS A;  1WWN A;  2LR3 A;  2N66 A;  1WT7 A;  4HHF A;  2LKB A;  1ZU3 A;  2KBH A;  1JZA A;  1T7E A;  2KSK A;  2LJM A;  1VNA A;  1ZFU A;  1I2U A;  2B68 A;  4HE7 A;  2KGQ A;  1LQI A;  4AAZ A;  2LY5 A;  1ICA A;  1LQQ A;  1LQH A;  1C55 A;  2ASC A;  1TI5 A;  1OMY A;  3PSM A;  1DQ7 A;  1P0A A;  2BRZ A;  1PX9 A;  1P00 A;  1B7D A;  1KV0 A;  1NRB A;  2NY9 X;  2E3F A;  2A7T A;  2KJA A;  2E0H A;  1BCG A;  1PTX A;  1ZVG A;  1BK8 A;  2B3C A;  1CHZ A;  2YBR C;  1VNB A;  1SN4 A;  1T7A A;  1JZB A;  1BMR A;  4CQK A;  2NY8 X;  1NE5 A;  2LT8 A;  1JXC A;  2YEO A;  1NRA A;  1ZUT A;  1ZVE A;  3E7R L;  1SEG A;  5KK4 A;  2E3G A;  1MYN A;  2KBK A;  1CN2 A;  1MR4 A;  1T7B A;  1NPI A;  1T0Z A;  1I6G A;  3E7U X;  1AHO A;  1I6F A;  1SN1 A;  4UJ0 A;  2LI7 A;  1WMT A;  2N2R A;  1B3C A;  1ZYW A;  1NH5 A;  1C56 A;  1I2V A;  2LY6 A;  1JKZ A;  2N2Q A;  4AB0 A;  4AEI A;  1SNB A;  1ZYV A;  2ATB A;  1PE4 A;  2N69 A;  1L4V A;  2I61 A;  1OZZ A;  2GL1 A;  2LJ7 A;  4V1D C; 
#chains in the Genus database with same CATH topology
 2SN3 A;  1T1T A;  3GL1 A;  2KBJ A;  3HSC A;  5AQJ A;  1ATR A;  2MZ0 A;  5CY0 A;  2E8A A;  3FZL A;  2KPY A;  3GKU A;  1GPT A;  4KYP A;  1DJT A;  5AQU A;  5F1X A;  1AYJ A;  1BRZ A;  2YC1 C;  2M8B B;  2KYQ A;  3FZK A;  1N4N A;  3R2V A;  3LDQ A;  1FH3 A;  1GPS A;  1WWN A;  2MBK A;  5AQI A;  2LR3 A;  4H5T A;  3KP0 A;  5F2R A;  2QWO A;  1S3X A;  2N66 A;  1BA0 A;  5FPN A;  1WT7 A;  3QI7 A;  2QWR A;  4HHF A;  4GNI A;  3SF4 D;  1NGB A;  3KOZ A;  2LKB A;  1ZU3 A;  2KBH A;  3ATV A;  1JZA A;  5AQO A;  1T7E A;  2KSK A;  2LJM A;  4FSV A;  1YUW A;  5AQS A;  3KOW A;  3M3Z A;  1VNA A;  5F0X A;  5FPD A;  1ZFU A;  1QQO A;  5AQQ A;  1DKG D;  2BUP A;  3FE1 A;  1HPM A;  3LDP A;  1I2U A;  1KAZ A;  2B68 A;  5EVZ A;  5AQM A;  4HE7 A;  2KGQ A;  1LQI A;  2QW9 A;  3KP1 A;  3A8Y A;  4AAZ A;  3JXU A;  3LDL A;  3FZM A;  3KOY A;  1NGJ A;  2LY5 A;  1ICA A;  1LQQ A;  1LQH A;  1POI A;  1C55 A;  1NGD A;  5EX5 A;  2ASC A;  3C7N A;  2QXL A;  1TI5 A;  1OMY A;  3PSM A;  1DQ7 A;  2QWL A;  2YIO A;  5AQT A;  1P0A A;  1NGE A;  2BRZ A;  3D2F A;  1PX9 A;  3CW4 A;  3GDQ A;  1P00 A;  1B7D A;  1BA1 A;  3ATU A;  5FPE A;  2GMO A;  2LN8 A;  1KV0 A;  4UAE F;  1NRB A;  2JDQ D;  1HX1 A;  5AQN A;  2NY9 X;  2VY6 A;  5EY4 A;  2E3F A;  5AQY A;  4H5R A;  2A7T A;  1QQN A;  2KJA A;  3QML A;  2E0H A;  2MN5 A;  3KOX A;  1BCG A;  1PTX A;  1ZVG A;  1NGG A;  2KHO A;  1BK8 A;  1QQM A;  3BK3 C;  5AQF A;  3FZF A;  2B3C A;  1CHZ A;  2YBR C;  5AQP A;  1VNB A;  1HJO A;  1SN4 A;  1T7A A;  2QWP A;  1JZB A;  3KHW A;  1BMR A;  1K8B A;  1UGL A;  4CQK A;  2V7Z A;  5BN8 A;  2NY8 X;  4IO8 A;  1XRS B;  3L56 A;  4FL9 A;  1KAY A;  2QWQ A;  1NE5 A;  3L4I A;  2LT8 A;  5BPM A;  1JXC A;  2YEO A;  1NRA A;  1ZUT A;  3D2E A;  1ZVE A;  3E7R L;  1SEG A;  5AQK A;  5AR0 A;  1ATS A;  5KK4 A;  2E3G A;  1MYN A;  2KBK A;  5AQV A;  1CN2 A;  1NGF A;  1MR4 A;  1T7B A;  1NPI A;  1T0Z A;  3IUC A;  4H5N A;  3LDN A;  2G2K A;  5BPL A;  1I6G A;  5BPN A;  4UAF E;  2K35 A;  3FZH A;  3E7U X;  1AHO A;  3CQX A;  2YIL A;  5BN9 A;  5AQR A;  1I6F A;  1SN1 A;  5AQZ A;  4UJ0 A;  1NGI A;  2LI7 A;  1KAX A;  1WMT A;  3L6Q A;  1NGC A;  2N2R A;  5AQH A;  3C7N B;  1NGA A;  1B3C A;  5AQW A;  1ZYW A;  3KC6 A;  1NH5 A;  3QFP A;  3QFU A;  2D56 A;  1C56 A;  3D2E B;  3D2F B;  2LY6 A;  5AQG A;  5FPM A;  1I2V A;  5AQX A;  2N2Q A;  1JKZ A;  1BUP A;  2QWM A;  4AB0 A;  4H5W A;  4AEI A;  1SNB A;  1NGH A;  5EXW A;  3AY9 A;  3I33 A;  3KVG A;  4KBO A;  4HWI A;  1ZYV A;  2E2F A;  2YIP A;  2E88 A;  2ATB A;  1PE4 A;  2N69 A;  4UAD E;  2I61 A;  4H5V A;  2QWN A;  1OZZ A;  2GL1 A;  1L4V A;  5AQL A;  2LJ7 A;  3LDO A;  4V1D C; 
#chains in the Genus database with same CATH homology
 2SN3 A;  1T1T A;  2KBJ A;  2MZ0 A;  5CY0 A;  2KPY A;  1GPT A;  4KYP A;  1DJT A;  1AYJ A;  1BRZ A;  2YC1 C;  2M8B B;  2KYQ A;  1N4N A;  1FH3 A;  1GPS A;  1WWN A;  2LR3 A;  2N66 A;  1WT7 A;  4HHF A;  2LKB A;  1ZU3 A;  2KBH A;  1JZA A;  1T7E A;  2KSK A;  2LJM A;  1VNA A;  1ZFU A;  1I2U A;  2B68 A;  4HE7 A;  2KGQ A;  1LQI A;  4AAZ A;  2LY5 A;  1ICA A;  1LQQ A;  1LQH A;  1C55 A;  2ASC A;  1TI5 A;  1OMY A;  3PSM A;  1DQ7 A;  1P0A A;  2BRZ A;  1PX9 A;  1P00 A;  1B7D A;  1KV0 A;  1NRB A;  2NY9 X;  2E3F A;  2A7T A;  2KJA A;  2E0H A;  1BCG A;  1PTX A;  1ZVG A;  1BK8 A;  2B3C A;  1CHZ A;  2YBR C;  1VNB A;  1SN4 A;  1T7A A;  1JZB A;  1BMR A;  4CQK A;  2NY8 X;  1NE5 A;  2LT8 A;  1JXC A;  2YEO A;  1NRA A;  1ZUT A;  1ZVE A;  3E7R L;  1SEG A;  5KK4 A;  2E3G A;  1MYN A;  2KBK A;  1CN2 A;  1MR4 A;  1T7B A;  1NPI A;  1T0Z A;  1I6G A;  3E7U X;  1AHO A;  1I6F A;  1SN1 A;  4UJ0 A;  2LI7 A;  1WMT A;  2N2R A;  1B3C A;  1ZYW A;  1NH5 A;  1C56 A;  1I2V A;  2LY6 A;  1JKZ A;  2N2Q A;  4AB0 A;  4AEI A;  1SNB A;  1ZYV A;  2ATB A;  1PE4 A;  2N69 A;  1L4V A;  2I61 A;  1OZZ A;  2GL1 A;  2LJ7 A;  4V1D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...