2N2QA

Nmr solution structure of hsafp1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
54
structure length
54
Chain Sequence
DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein 1
publication title Synergistic Activity of the Plant Defensin HsAFP1 and Caspofungin against Candida albicans Biofilms and Planktonic Cultures.
pubmed doi rcsb
source organism Heuchera sanguinea
molecule tags Antifungal protein
total genus 10
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n2qA00
2LY5A 2KJAA 4AAZA 2MZ0A 2E3GA 1VNAA 2N2QA 2YBRC 1SNBA 1LQHA 1JZAA 1PX9A 1NH5A 1P0AA 1PE4A 1CHZA 4HE7A 5CY0A 1I6GA 1N4NA 1I6FA 1AHOA 2I61A 1ZUTA 1TI5A 2KBHA 1DQ7A 2M8BB 1BK8A 1JXCA 1ZYVA 1SN4A 1DJTA 2ATBA 1NRBA 2LT8A 2KBKA 1ZFUA 2KSKA 4V1DC 1L4VA 1NE5A 1ZU3A 4HHFA 2LKBA 1ZVGA 1T1TA 2N66A 4CQKA 1ZYWA 1NRAA 1T7EA 1GPTA 2KBJA 1FH3A 1ZVEA 1BRZA 1B3CA 2LJMA 2YEOA 4UJ0A 1GPSA 1SN1A 1B7DA 2NY8X 1T7BA 1P00A 2YC1C 2BRZA 1MR4A 2KYQA 1WT7A 1BCGA 2LJ7A 2NY9X 4KYPA 2N69A 1OMYA 2LR3A 2LY6A 3E7RL 2SN3A 1LQQA 1OZZA 4AB0A 3PSMA 1SEGA 2A7TA 2GL1A 2N2RA 1WWNA 1JZBA 1CN2A 1KV0A 1AYJA 1VNBA 1C56A 1T0ZA 1WMTA 1BMRA 2ASCA 2B3CA 2B68A 2KGQA 4AEIA 1I2VA 1JKZA 1ICAA 3E7UX 1MYNA 5KK4A 2KPYA 2E0HA 1I2UA 1PTXA 1T7AA 1LQIA 2LI7A 1C55A 2E3FA 1NPIA
chains in the Genus database with same CATH superfamily
2QW9A 3ATVA 4H5TA 2LY5A 3KOXA 1NGAA 2E8AA 2V7ZA 2KJAA 3QFPA 2MZ0A 2E3GA 1VNAA 2N2QA 4AAZA 2YBRC 5AR0A 4H5RA 1SNBA 1LQHA 2GMOA 1JZAA 1PX9A 3ATUA 3LDLA 1NH5A 1P0AA 3KP1A 1PE4A 1CHZA 4HE7A 5CY0A 1I6GA 2QXLA 3FZLA 5F0XA 3L56A 3L4IA 1N4NA 1I6FA 1AHOA 2I61A 1BA1A 5AQQA 1KAZA 3KP0A 1ZUTA 1BUPA 1TI5A 5AQKA 2KBHA 3KHWA 1DQ7A 1KAXA 2M8BB 2MN5A 2QWRA 5BPLA 5F1XA 1BK8A 4KBOA 1JXCA 3QMLA 1ZYVA 3KOZA 1QQOA 4H5WA 5AQTA 2QWQA 1SN4A 5EX5A 2QWNA 1DJTA 1DKGD 3LDPA 1HPMA 3FZMA 2YIPA 2ATBA 1YUWA 1NGEA 1NRBA 2LT8A 5AQXA 2KBKA 1ZFUA 2KSKA 5AQVA 4UAEF 4V1DC 1NGIA 3FE1A 1L4VA 1NE5A 1ZU3A 4HHFA 2QWLA 4UADE 5FPMA 2LKBA 1NGBA 1T1TA 1ZVGA 1NGDA 3A8YA 5AQNA 2N66A 5AQFA 1POIA 2E2FA 2KHOA 5AQZA 5AQHA 4CQKA 1NGCA 3M3ZA 1S3XA 1ZYWA 3L6QA 1NRAA 1KAYA 1HJOA 1T7EA 3QFUA 1GPTA 5FPDA 2KBJA 2QWOA 1FH3A 4IO8A 1ZVEA 3KVGA 1BRZA 3QI7A 1B3CA 1K8BA 1NGJA 2LJMA 2YEOA 5EXWA 4UJ0A 5AQMA 1BA0A 2QWMA 3FZFA 5AQIA 1GPSA 3BK3C 4FSVA 1SN1A 5FPEA 1NGGA 1B7DA 2NY8X 1T7BA 3SF4D 1P00A 1NGFA 4H5VA 2YC1C 5AQPA 2YILA 1NGHA 3FZKA 2MBKA 3KC6A 5AQSA 2BRZA 5BN9A 1MR4A 1ATSA 1XRSB 3R2VA 3I33A 2KYQA 2VY6A 1WT7A 5AQGA 3GL1A 1BCGA 2QWPA 2LJ7A 3AY9A 5AQLA 5EY4A 4FL9A 2NY9X 3D2EB 3GDQA 4KYPA 5AQYA 2N69A 3HSCA 1OMYA 2E88A 2D56A 2LR3A 5AQOA 3C7NB 1QQMA 3D2EA 1HX1A 5AQWA 3KOWA 2LY6A 3E7RL 2SN3A 1LQQA 1OZZA 2K35A 2G2KA 2JDQD 3C7NA 4AB0A 5BPMA 1ATRA 3PSMA 5EVZA 3IUCA 1SEGA 2A7TA 2GL1A 1QQNA 2N2RA 1WWNA 1JZBA 2LN8A 1KV0A 3LDQA 5AQRA 5F2RA 1CN2A 3CW4A 1AYJA 1VNBA 1C56A 1T0ZA 5AQUA 1WMTA 3JXUA 1UGLA 2ASCA 1BMRA 3CQXA 2B3CA 3LDNA 2B68A 2KGQA 4AEIA 1I2VA 4HWIA 1JKZA 1ICAA 3LDOA 4GNIA 3E7UX 5BN8A 5BPNA 1MYNA 5AQJA 5KK4A 2KPYA 2E0HA 3FZHA 1PTXA 1T7AA 1LQIA 3D2FB 3GKUA 3KOYA 1I2UA 2LI7A 1C55A 3D2FA 5FPNA 2E3FA 2YIOA 2BUPA 4UAFE 1NPIA 4H5NA
chains in the Genus database with same CATH topology
2LY5A 2KJAA 4AAZA 2MZ0A 2E3GA 1VNAA 2N2QA 2YBRC 1SNBA 1LQHA 1JZAA 1PX9A 1NH5A 1P0AA 1PE4A 1CHZA 4HE7A 5CY0A 1I6GA 1N4NA 1I6FA 1AHOA 2I61A 1ZUTA 1TI5A 2KBHA 1DQ7A 2M8BB 1BK8A 1JXCA 1ZYVA 1SN4A 1DJTA 2ATBA 1NRBA 2LT8A 2KBKA 1ZFUA 2KSKA 4V1DC 1L4VA 1NE5A 1ZU3A 4HHFA 2LKBA 1ZVGA 1T1TA 2N66A 4CQKA 1ZYWA 1NRAA 1T7EA 1GPTA 2KBJA 1FH3A 1ZVEA 1BRZA 1B3CA 2LJMA 2YEOA 4UJ0A 1GPSA 1SN1A 1B7DA 2NY8X 1T7BA 1P00A 2YC1C 2BRZA 1MR4A 2KYQA 1WT7A 1BCGA 2LJ7A 2NY9X 4KYPA 2N69A 1OMYA 2LR3A 2LY6A 3E7RL 2SN3A 1LQQA 1OZZA 4AB0A 3PSMA 1SEGA 2A7TA 2GL1A 2N2RA 1WWNA 1JZBA 1CN2A 1KV0A 1AYJA 1VNBA 1C56A 1T0ZA 1WMTA 1BMRA 2ASCA 2B3CA 2B68A 2KGQA 4AEIA 1I2VA 1JKZA 1ICAA 3E7UX 1MYNA 5KK4A 2KPYA 2E0HA 1I2UA 1PTXA 1T7AA 1LQIA 2LI7A 1C55A 2E3FA 1NPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LY5 A;  2KJA A;  4AAZ A;  2MZ0 A;  2E3G A;  1VNA A;  2N2Q A;  2YBR C;  1SNB A;  1LQH A;  1JZA A;  1PX9 A;  1NH5 A;  1P0A A;  1PE4 A;  1CHZ A;  4HE7 A;  5CY0 A;  1I6G A;  1N4N A;  1I6F A;  1AHO A;  2I61 A;  1ZUT A;  1TI5 A;  2KBH A;  1DQ7 A;  2M8B B;  1BK8 A;  1JXC A;  1ZYV A;  1SN4 A;  1DJT A;  2ATB A;  1NRB A;  2LT8 A;  2KBK A;  1ZFU A;  2KSK A;  4V1D C;  1L4V A;  1NE5 A;  1ZU3 A;  4HHF A;  2LKB A;  1ZVG A;  1T1T A;  2N66 A;  4CQK A;  1ZYW A;  1NRA A;  1T7E A;  1GPT A;  2KBJ A;  1FH3 A;  1ZVE A;  1BRZ A;  1B3C A;  2LJM A;  2YEO A;  4UJ0 A;  1GPS A;  1SN1 A;  1B7D A;  2NY8 X;  1T7B A;  1P00 A;  2YC1 C;  2BRZ A;  1MR4 A;  2KYQ A;  1WT7 A;  1BCG A;  2LJ7 A;  2NY9 X;  4KYP A;  2N69 A;  1OMY A;  2LR3 A;  2LY6 A;  3E7R L;  2SN3 A;  1LQQ A;  1OZZ A;  4AB0 A;  3PSM A;  1SEG A;  2A7T A;  2GL1 A;  2N2R A;  1WWN A;  1JZB A;  1CN2 A;  1KV0 A;  1AYJ A;  1VNB A;  1C56 A;  1T0Z A;  1WMT A;  1BMR A;  2ASC A;  2B3C A;  2B68 A;  2KGQ A;  4AEI A;  1I2V A;  1JKZ A;  1ICA A;  3E7U X;  1MYN A;  5KK4 A;  2KPY A;  2E0H A;  1I2U A;  1PTX A;  1T7A A;  1LQI A;  2LI7 A;  1C55 A;  2E3F A;  1NPI A; 
#chains in the Genus database with same CATH topology
 2QW9 A;  3ATV A;  4H5T A;  2LY5 A;  3KOX A;  1NGA A;  2E8A A;  2V7Z A;  2KJA A;  3QFP A;  2MZ0 A;  2E3G A;  1VNA A;  2N2Q A;  4AAZ A;  2YBR C;  5AR0 A;  4H5R A;  1SNB A;  1LQH A;  2GMO A;  1JZA A;  1PX9 A;  3ATU A;  3LDL A;  1NH5 A;  1P0A A;  3KP1 A;  1PE4 A;  1CHZ A;  4HE7 A;  5CY0 A;  1I6G A;  2QXL A;  3FZL A;  5F0X A;  3L56 A;  3L4I A;  1N4N A;  1I6F A;  1AHO A;  2I61 A;  1BA1 A;  5AQQ A;  1KAZ A;  3KP0 A;  1ZUT A;  1BUP A;  1TI5 A;  5AQK A;  2KBH A;  3KHW A;  1DQ7 A;  1KAX A;  2M8B B;  2MN5 A;  2QWR A;  5BPL A;  5F1X A;  1BK8 A;  4KBO A;  1JXC A;  3QML A;  1ZYV A;  3KOZ A;  1QQO A;  4H5W A;  5AQT A;  2QWQ A;  1SN4 A;  5EX5 A;  2QWN A;  1DJT A;  1DKG D;  3LDP A;  1HPM A;  3FZM A;  2YIP A;  2ATB A;  1YUW A;  1NGE A;  1NRB A;  2LT8 A;  5AQX A;  2KBK A;  1ZFU A;  2KSK A;  5AQV A;  4UAE F;  4V1D C;  1NGI A;  3FE1 A;  1L4V A;  1NE5 A;  1ZU3 A;  4HHF A;  2QWL A;  4UAD E;  5FPM A;  2LKB A;  1NGB A;  1T1T A;  1ZVG A;  1NGD A;  3A8Y A;  5AQN A;  2N66 A;  5AQF A;  1POI A;  2E2F A;  2KHO A;  5AQZ A;  5AQH A;  4CQK A;  1NGC A;  3M3Z A;  1S3X A;  1ZYW A;  3L6Q A;  1NRA A;  1KAY A;  1HJO A;  1T7E A;  3QFU A;  1GPT A;  5FPD A;  2KBJ A;  2QWO A;  1FH3 A;  4IO8 A;  1ZVE A;  3KVG A;  1BRZ A;  3QI7 A;  1B3C A;  1K8B A;  1NGJ A;  2LJM A;  2YEO A;  5EXW A;  4UJ0 A;  5AQM A;  1BA0 A;  2QWM A;  3FZF A;  5AQI A;  1GPS A;  3BK3 C;  4FSV A;  1SN1 A;  5FPE A;  1NGG A;  1B7D A;  2NY8 X;  1T7B A;  3SF4 D;  1P00 A;  1NGF A;  4H5V A;  2YC1 C;  5AQP A;  2YIL A;  1NGH A;  3FZK A;  2MBK A;  3KC6 A;  5AQS A;  2BRZ A;  5BN9 A;  1MR4 A;  1ATS A;  1XRS B;  3R2V A;  3I33 A;  2KYQ A;  2VY6 A;  1WT7 A;  5AQG A;  3GL1 A;  1BCG A;  2QWP A;  2LJ7 A;  3AY9 A;  5AQL A;  5EY4 A;  4FL9 A;  2NY9 X;  3D2E B;  3GDQ A;  4KYP A;  5AQY A;  2N69 A;  3HSC A;  1OMY A;  2E88 A;  2D56 A;  2LR3 A;  5AQO A;  3C7N B;  1QQM A;  3D2E A;  1HX1 A;  5AQW A;  3KOW A;  2LY6 A;  3E7R L;  2SN3 A;  1LQQ A;  1OZZ A;  2K35 A;  2G2K A;  2JDQ D;  3C7N A;  4AB0 A;  5BPM A;  1ATR A;  3PSM A;  5EVZ A;  3IUC A;  1SEG A;  2A7T A;  2GL1 A;  1QQN A;  2N2R A;  1WWN A;  1JZB A;  2LN8 A;  1KV0 A;  3LDQ A;  5AQR A;  5F2R A;  1CN2 A;  3CW4 A;  1AYJ A;  1VNB A;  1C56 A;  1T0Z A;  5AQU A;  1WMT A;  3JXU A;  1UGL A;  2ASC A;  1BMR A;  3CQX A;  2B3C A;  3LDN A;  2B68 A;  2KGQ A;  4AEI A;  1I2V A;  4HWI A;  1JKZ A;  1ICA A;  3LDO A;  4GNI A;  3E7U X;  5BN8 A;  5BPN A;  1MYN A;  5AQJ A;  5KK4 A;  2KPY A;  2E0H A;  3FZH A;  1PTX A;  1T7A A;  1LQI A;  3D2F B;  3GKU A;  3KOY A;  1I2U A;  2LI7 A;  1C55 A;  3D2F A;  5FPN A;  2E3F A;  2YIO A;  2BUP A;  4UAF E;  1NPI A;  4H5N A; 
#chains in the Genus database with same CATH homology
 2LY5 A;  2KJA A;  4AAZ A;  2MZ0 A;  2E3G A;  1VNA A;  2N2Q A;  2YBR C;  1SNB A;  1LQH A;  1JZA A;  1PX9 A;  1NH5 A;  1P0A A;  1PE4 A;  1CHZ A;  4HE7 A;  5CY0 A;  1I6G A;  1N4N A;  1I6F A;  1AHO A;  2I61 A;  1ZUT A;  1TI5 A;  2KBH A;  1DQ7 A;  2M8B B;  1BK8 A;  1JXC A;  1ZYV A;  1SN4 A;  1DJT A;  2ATB A;  1NRB A;  2LT8 A;  2KBK A;  1ZFU A;  2KSK A;  4V1D C;  1L4V A;  1NE5 A;  1ZU3 A;  4HHF A;  2LKB A;  1ZVG A;  1T1T A;  2N66 A;  4CQK A;  1ZYW A;  1NRA A;  1T7E A;  1GPT A;  2KBJ A;  1FH3 A;  1ZVE A;  1BRZ A;  1B3C A;  2LJM A;  2YEO A;  4UJ0 A;  1GPS A;  1SN1 A;  1B7D A;  2NY8 X;  1T7B A;  1P00 A;  2YC1 C;  2BRZ A;  1MR4 A;  2KYQ A;  1WT7 A;  1BCG A;  2LJ7 A;  2NY9 X;  4KYP A;  2N69 A;  1OMY A;  2LR3 A;  2LY6 A;  3E7R L;  2SN3 A;  1LQQ A;  1OZZ A;  4AB0 A;  3PSM A;  1SEG A;  2A7T A;  2GL1 A;  2N2R A;  1WWN A;  1JZB A;  1CN2 A;  1KV0 A;  1AYJ A;  1VNB A;  1C56 A;  1T0Z A;  1WMT A;  1BMR A;  2ASC A;  2B3C A;  2B68 A;  2KGQ A;  4AEI A;  1I2V A;  1JKZ A;  1ICA A;  3E7U X;  1MYN A;  5KK4 A;  2KPY A;  2E0H A;  1I2U A;  1PTX A;  1T7A A;  1LQI A;  2LI7 A;  1C55 A;  2E3F A;  1NPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...