4UAFE

Importin alpha 1 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
ESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Importin subunit alpha-1
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 10
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uafE00
3R2VA 3KC6A 3KHWA 3L56A 2JDQD 2GMOA 3CW4A 4UAFE 2VY6A 4UAEF 4UADE
chains in the Genus database with same CATH superfamily
2QWNA 1P0AA 1ZVEA 3GKUA 5AQOA 2G2KA 2NY9X 1KAYA 1SNBA 1NGJA 1QQOA 5FPDA 1NGDA 1NGIA 4H5TA 3E7RL 1NGGA 4UAEF 5EXWA 2KPYA 5AQZA 3CQXA 1POIA 2LR3A 5AQKA 1BA1A 3QFUA 1ZFUA 4AB0A 1BA0A 1NGEA 5AQLA 1WMTA 3E7UX 3KP0A 3QI7A 5AQTA 1TI5A 3FZFA 3PSMA 5AQJA 3LDLA 1DQ7A 5F2RA 1VNAA 2QWLA 2KHOA 1FH3A 1GPTA 1NGAA 2E8AA 3BK3C 5FPEA 3FZLA 1AYJA 4UJ0A 5AQXA 1BCGA 3A8YA 3GDQA 3I33A 1ICAA 3GL1A 4H5WA 1I2UA 2E2FA 3FZHA 1KV0A 3D2FB 3FZKA 3C7NA 3KP1A 4H5RA 1JXCA 5AQPA 1HX1A 1T1TA 2KGQA 3KOYA 1NRAA 2LJMA 4AAZA 5BN8A 2JDQD 1P00A 5AQMA 1N4NA 1ZYVA 5FPMA 2YIPA 2E0HA 1PE4A 3QMLA 1C55A 4KYPA 4CQKA 4GNIA 2ATBA 2SN3A 3KHWA 5EY4A 1ZYWA 1AHOA 3CW4A 5AQNA 3LDNA 1NGHA 2KBHA 1BRZA 2MZ0A 1NH5A 3FE1A 3FZMA 5AQHA 2NY8X 3ATVA 1DKGD 2KBKA 2LN8A 1NGFA 4H5VA 1ATSA 5AR0A 5AQSA 3KOWA 1K8BA 3D2EA 3QFPA 1YUWA 3SF4D 3AY9A 2A7TA 2YC1C 3LDOA 5EX5A 3L56A 1KAXA 1QQMA 2LKBA 1LQQA 5BPNA 1WT7A 1T0ZA 1UGLA 2GL1A 2B68A 1MR4A 1MYNA 2E3FA 2N2QA 3IUCA 5AQVA 1I6FA 2E3GA 2MBKA 3KOXA 1CN2A 1NE5A 1NGCA 2N2RA 5AQYA 4UAFE 2D56A 2QWOA 4FL9A 2LY6A 3HSCA 5BPMA 5KK4A 5AQIA 5F1XA 1I6GA 1ZUTA 3ATUA 2V7ZA 3LDPA 2YBRC 3L6QA 5EVZA 5AQRA 4AEIA 5BPLA 2KJAA 1L4VA 2QWRA 1JZBA 5AQUA 4V1DC 2ASCA 2BRZA 2LY5A 1I2VA 1S3XA 1NPIA 1JZAA 1T7BA 2E88A 2KSKA 2YEOA 3D2FA 1ZU3A 2KBJA 3KVGA 4UADE 4KBOA 1HJOA 2QWMA 1DJTA 2LT8A 3KC6A 1BMRA 1GPSA 2QWQA 5AQFA 4FSVA 2GMOA 1B3CA 1JKZA 1T7EA 3L4IA 3KOZA 1CHZA 2YIOA 4HE7A 3R2VA 3JXUA 4IO8A 2LI7A 5BN9A 4HWIA 2MN5A 5AQWA 3C7NB 4H5NA 5AQGA 1LQIA 1ATRA 3M3ZA 1PX9A 1WWNA 2I61A 5AQQA 1C56A 1QQNA 2QXLA 5FPNA 5CY0A 1XRSB 2YILA 1NGBA 2N66A 2BUPA 1LQHA 2B3CA 2K35A 1SEGA 2N69A 2QW9A 3LDQA 1PTXA 1ZVGA 1T7AA 1SN1A 2QWPA 2KYQA 2VY6A 1OMYA 1NRBA 1KAZA 1HPMA 4HHFA 1VNBA 2LJ7A 1OZZA 1BUPA 1BK8A 1SN4A 1B7DA 5F0XA 2M8BB 3D2EB
chains in the Genus database with same CATH topology
2QWNA 5AQOA 1KAYA 1NGJA 1QQOA 5FPDA 1NGDA 1NGIA 4H5TA 5EXWA 1NGGA 4UAEF 5AQZA 3CQXA 1POIA 5AQKA 1BA1A 3QFUA 1BA0A 1NGEA 5AQLA 5AQTA 3QI7A 3FZFA 5AQJA 3LDLA 5F2RA 2QWLA 2KHOA 1NGAA 2E8AA 3BK3C 5FPEA 3FZLA 5AQXA 3A8YA 3GDQA 3I33A 3GL1A 4H5WA 2E2FA 3FZHA 3D2FB 3FZKA 3C7NA 4H5RA 5AQPA 1HX1A 5BN8A 2JDQD 5AQMA 5FPMA 2YIPA 3QMLA 4GNIA 3KHWA 5EY4A 3CW4A 5AQNA 3LDNA 1NGHA 3FE1A 5AQHA 3FZMA 3ATVA 1DKGD 2LN8A 1NGFA 4H5VA 1ATSA 5AR0A 5AQSA 3D2EA 3QFPA 1YUWA 3SF4D 3AY9A 3LDOA 5EX5A 3L56A 1KAXA 1QQMA 5BPNA 3IUCA 5AQVA 2MBKA 1NGCA 5AQYA 4UAFE 2D56A 2QWOA 4FL9A 3HSCA 5BPMA 5AQIA 5F1XA 3ATUA 2V7ZA 3LDPA 3L6QA 5EVZA 5AQRA 5BPLA 2QWRA 5AQUA 1S3XA 2E88A 3D2FA 3KVGA 4UADE 4KBOA 1HJOA 2QWMA 3KC6A 2QWQA 5AQFA 4FSVA 2GMOA 3L4IA 2YIOA 3R2VA 3JXUA 4IO8A 5BN9A 4HWIA 2MN5A 5AQWA 3C7NB 4H5NA 5AQGA 1ATRA 3M3ZA 5AQQA 5FPNA 1QQNA 2QXLA 2YILA 1NGBA 2BUPA 2K35A 2QW9A 3LDQA 2QWPA 2VY6A 1KAZA 1HPMA 1BUPA 5F0XA 3D2EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2V A;  3KC6 A;  3KHW A;  3L56 A;  2JDQ D;  2GMO A;  3CW4 A;  4UAF E;  2VY6 A;  4UAE F;  4UAD E; 
#chains in the Genus database with same CATH topology
 2QWN A;  1P0A A;  1ZVE A;  3GKU A;  5AQO A;  2G2K A;  2NY9 X;  1KAY A;  1SNB A;  1NGJ A;  1QQO A;  5FPD A;  1NGD A;  1NGI A;  4H5T A;  3E7R L;  1NGG A;  4UAE F;  5EXW A;  2KPY A;  5AQZ A;  3CQX A;  1POI A;  2LR3 A;  5AQK A;  1BA1 A;  3QFU A;  1ZFU A;  4AB0 A;  1BA0 A;  1NGE A;  5AQL A;  1WMT A;  3E7U X;  3KP0 A;  3QI7 A;  5AQT A;  1TI5 A;  3FZF A;  3PSM A;  5AQJ A;  3LDL A;  1DQ7 A;  5F2R A;  1VNA A;  2QWL A;  2KHO A;  1FH3 A;  1GPT A;  1NGA A;  2E8A A;  3BK3 C;  5FPE A;  3FZL A;  1AYJ A;  4UJ0 A;  5AQX A;  1BCG A;  3A8Y A;  3GDQ A;  3I33 A;  1ICA A;  3GL1 A;  4H5W A;  1I2U A;  2E2F A;  3FZH A;  1KV0 A;  3D2F B;  3FZK A;  3C7N A;  3KP1 A;  4H5R A;  1JXC A;  5AQP A;  1HX1 A;  1T1T A;  2KGQ A;  3KOY A;  1NRA A;  2LJM A;  4AAZ A;  5BN8 A;  2JDQ D;  1P00 A;  5AQM A;  1N4N A;  1ZYV A;  5FPM A;  2YIP A;  2E0H A;  1PE4 A;  3QML A;  1C55 A;  4KYP A;  4CQK A;  4GNI A;  2ATB A;  2SN3 A;  3KHW A;  5EY4 A;  1ZYW A;  1AHO A;  3CW4 A;  5AQN A;  3LDN A;  1NGH A;  2KBH A;  1BRZ A;  2MZ0 A;  1NH5 A;  3FE1 A;  3FZM A;  5AQH A;  2NY8 X;  3ATV A;  1DKG D;  2KBK A;  2LN8 A;  1NGF A;  4H5V A;  1ATS A;  5AR0 A;  5AQS A;  3KOW A;  1K8B A;  3D2E A;  3QFP A;  1YUW A;  3SF4 D;  3AY9 A;  2A7T A;  2YC1 C;  3LDO A;  5EX5 A;  3L56 A;  1KAX A;  1QQM A;  2LKB A;  1LQQ A;  5BPN A;  1WT7 A;  1T0Z A;  1UGL A;  2GL1 A;  2B68 A;  1MR4 A;  1MYN A;  2E3F A;  2N2Q A;  3IUC A;  5AQV A;  1I6F A;  2E3G A;  2MBK A;  3KOX A;  1CN2 A;  1NE5 A;  1NGC A;  2N2R A;  5AQY A;  4UAF E;  2D56 A;  2QWO A;  4FL9 A;  2LY6 A;  3HSC A;  5BPM A;  5KK4 A;  5AQI A;  5F1X A;  1I6G A;  1ZUT A;  3ATU A;  2V7Z A;  3LDP A;  2YBR C;  3L6Q A;  5EVZ A;  5AQR A;  4AEI A;  5BPL A;  2KJA A;  1L4V A;  2QWR A;  1JZB A;  5AQU A;  4V1D C;  2ASC A;  2BRZ A;  2LY5 A;  1I2V A;  1S3X A;  1NPI A;  1JZA A;  1T7B A;  2E88 A;  2KSK A;  2YEO A;  3D2F A;  1ZU3 A;  2KBJ A;  3KVG A;  4UAD E;  4KBO A;  1HJO A;  2QWM A;  1DJT A;  2LT8 A;  3KC6 A;  1BMR A;  1GPS A;  2QWQ A;  5AQF A;  4FSV A;  2GMO A;  1B3C A;  1JKZ A;  1T7E A;  3L4I A;  3KOZ A;  1CHZ A;  2YIO A;  4HE7 A;  3R2V A;  3JXU A;  4IO8 A;  2LI7 A;  5BN9 A;  4HWI A;  2MN5 A;  5AQW A;  3C7N B;  4H5N A;  5AQG A;  1LQI A;  1ATR A;  3M3Z A;  1PX9 A;  1WWN A;  2I61 A;  5AQQ A;  1C56 A;  1QQN A;  2QXL A;  5FPN A;  5CY0 A;  1XRS B;  2YIL A;  1NGB A;  2N66 A;  2BUP A;  1LQH A;  2B3C A;  2K35 A;  1SEG A;  2N69 A;  2QW9 A;  3LDQ A;  1PTX A;  1ZVG A;  1T7A A;  1SN1 A;  2QWP A;  2KYQ A;  2VY6 A;  1OMY A;  1NRB A;  1KAZ A;  1HPM A;  4HHF A;  1VNB A;  2LJ7 A;  1OZZ A;  1BUP A;  1BK8 A;  1SN4 A;  1B7D A;  5F0X A;  2M8B B;  3D2E B; 
#chains in the Genus database with same CATH homology
 2QWN A;  5AQO A;  1KAY A;  1NGJ A;  1QQO A;  5FPD A;  1NGD A;  1NGI A;  4H5T A;  5EXW A;  1NGG A;  4UAE F;  5AQZ A;  3CQX A;  1POI A;  5AQK A;  1BA1 A;  3QFU A;  1BA0 A;  1NGE A;  5AQL A;  5AQT A;  3QI7 A;  3FZF A;  5AQJ A;  3LDL A;  5F2R A;  2QWL A;  2KHO A;  1NGA A;  2E8A A;  3BK3 C;  5FPE A;  3FZL A;  5AQX A;  3A8Y A;  3GDQ A;  3I33 A;  3GL1 A;  4H5W A;  2E2F A;  3FZH A;  3D2F B;  3FZK A;  3C7N A;  4H5R A;  5AQP A;  1HX1 A;  5BN8 A;  2JDQ D;  5AQM A;  5FPM A;  2YIP A;  3QML A;  4GNI A;  3KHW A;  5EY4 A;  3CW4 A;  5AQN A;  3LDN A;  1NGH A;  3FE1 A;  5AQH A;  3FZM A;  3ATV A;  1DKG D;  2LN8 A;  1NGF A;  4H5V A;  1ATS A;  5AR0 A;  5AQS A;  3D2E A;  3QFP A;  1YUW A;  3SF4 D;  3AY9 A;  3LDO A;  5EX5 A;  3L56 A;  1KAX A;  1QQM A;  5BPN A;  3IUC A;  5AQV A;  2MBK A;  1NGC A;  5AQY A;  4UAF E;  2D56 A;  2QWO A;  4FL9 A;  3HSC A;  5BPM A;  5AQI A;  5F1X A;  3ATU A;  2V7Z A;  3LDP A;  3L6Q A;  5EVZ A;  5AQR A;  5BPL A;  2QWR A;  5AQU A;  1S3X A;  2E88 A;  3D2F A;  3KVG A;  4UAD E;  4KBO A;  1HJO A;  2QWM A;  3KC6 A;  2QWQ A;  5AQF A;  4FSV A;  2GMO A;  3L4I A;  2YIO A;  3R2V A;  3JXU A;  4IO8 A;  5BN9 A;  4HWI A;  2MN5 A;  5AQW A;  3C7N B;  4H5N A;  5AQG A;  1ATR A;  3M3Z A;  5AQQ A;  5FPN A;  1QQN A;  2QXL A;  2YIL A;  1NGB A;  2BUP A;  2K35 A;  2QW9 A;  3LDQ A;  2QWP A;  2VY6 A;  1KAZ A;  1HPM A;  1BUP A;  5F0X A;  3D2E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...