4UAFE

Importin alpha 1 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
b'ESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Importin subunit alpha-1
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 10
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uafE00
3KHWA 2GMOA 2VY6A 4UAFE 4UAEF 2JDQD 3L56A 3KC6A 3R2VA 4UADE 3CW4A
chains in the Genus database with same CATH superfamily
1NGBA 1PE4A 3M3ZA 4AAZA 1ZFUA 1ZUTA 3FZFA 2K35A 1SNBA 2E88A 2QWMA 2LI7A 1YUWA 1HPMA 1NGGA 3CW4A 3LDNA 1QQMA 1SN1A 1NPIA 1ZYVA 3KHWA 1KV0A 3QI7A 2NY8X 3C7NB 3GKUA 1HX1A 2LT8A 1MR4A 2KHOA 4AB0A 1N4NA 5FPNA 1WWNA 2KYQA 3D2FA 3C7NA 1BK8A 3CQXA 1LQIA 2YBRC 2NY9X 1ZU3A 3KP1A 1K8BA 5BN9A 2A7TA 5AQOA 5AQGA 5BPNA 5FPEA 2QWLA 2KBJA 2LY5A 3KOZA 3KOWA 4H5TA 2N2RA 4H5WA 1BA0A 1UGLA 3L4IA 2E3FA 5F2RA 2M8BB 2G2KA 5AQIA 1NGEA 4H5VA 2LN8A 2LJ7A 1T7AA 2N2QA 5AQSA 1I2UA 2KBHA 4IO8A 1POIA 5EXWA 3D2EB 2I61A 1TI5A 3R2VA 1MYNA 3LDLA 3SF4D 1LQHA 1JKZA 5F0XA 1B3CA 4AEIA 2N69A 3D2EA 3KP0A 5FPMA 1GPSA 3QFPA 3KC6A 1NGFA 5BPLA 1ZYWA 5AQTA 1KAXA 1NGCA 1NGHA 1ATRA 1P0AA 3I33A 3JXUA 3LDPA 2GL1A 2VY6A 5EY4A 1DJTA 1C56A 1NRAA 1LQQA 5AQLA 5AQFA 4UJ0A 4FSVA 2QW9A 2D56A 1BCGA 1HJOA 2KGQA 2N66A 1ZVGA 4H5NA 1C55A 1BA1A 2QWPA 1JXCA 1FH3A 2KPYA 3FZMA 4KYPA 1DQ7A 5AQKA 3FZHA 5KK4A 3KOYA 3LDOA 1T7EA 1NE5A 2E3GA 5EVZA 1NGJA 1XRSB 2MBKA 3FZKA 4GNIA 2QWNA 1ATSA 2YC1C 4KBOA 5FPDA 1NRBA 5AQQA 2KSKA 2QWQA 1JZBA 2V7ZA 2MN5A 1L4VA 2QXLA 1SEGA 5AQYA 1QQOA 3A8YA 5BN8A 1ZVEA 1B7DA 1AHOA 2ATBA 2LY6A 3ATUA 2KJAA 3GL1A 1T1TA 2E0HA 2LKBA 3L6QA 1BMRA 1ICAA 2ASCA 2YEOA 4V1DC 1JZAA 1BRZA 1NGIA 5F1XA 4HE7A 2GMOA 3KOXA 4UAFE 1CHZA 4UAEF 2LJMA 4HWIA 5AQHA 3KVGA 5AQWA 1I6FA 1NH5A 1NGDA 4CQKA 2BUPA 1OZZA 2B68A 3FE1A 3GDQA 1VNAA 5AQRA 1WT7A 5AQUA 1I2VA 2JDQD 5AQPA 3E7RL 4HHFA 5AQNA 5AQXA 3D2FB 1T0ZA 1T7BA 2QWOA 5AR0A 5CY0A 3BK3C 1I6GA 1P00A 3QMLA 1S3XA 1OMYA 2B3CA 2YILA 3ATVA 3LDQA 5AQMA 2KBKA 5BPMA 5AQVA 1BUPA 2LR3A 1GPTA 1DKGD 2QWRA 1QQNA 2YIPA 3PSMA 3AY9A 3FZLA 1WMTA 3E7UX 5EX5A 3L56A 3QFUA 4UADE 2BRZA 1CN2A 2MZ0A 5AQZA 1PTXA 4H5RA 1PX9A 3IUCA 1KAZA 1KAYA 5AQJA 1NGAA 1AYJA 3HSCA 1VNBA 2E8AA 4FL9A 2E2FA 1SN4A 2SN3A 2YIOA
chains in the Genus database with same CATH topology
1NGBA 3M3ZA 3FZFA 2K35A 2E88A 2QWMA 1YUWA 1HPMA 1NGGA 3CW4A 3LDNA 1QQMA 3KHWA 4H5RA 3QI7A 3C7NB 1HX1A 2KHOA 5FPNA 3D2FA 3C7NA 3CQXA 5BN9A 5AQOA 5AQGA 5BPNA 5FPEA 2QWLA 4H5TA 4H5WA 1BA0A 3L4IA 5F2RA 5AQIA 1NGEA 4H5VA 2LN8A 5AQSA 4IO8A 1POIA 5EXWA 3D2EB 3R2VA 3LDLA 3SF4D 5F0XA 3D2EA 5FPMA 3QFPA 3KC6A 1NGFA 5BPLA 5AQTA 1KAXA 1NGCA 1NGHA 3I33A 1ATRA 3JXUA 3LDPA 2VY6A 5EY4A 5AQLA 5AQFA 4FSVA 2QW9A 2D56A 1HJOA 4H5NA 1BA1A 2QWPA 3FZMA 5AQKA 3FZHA 3LDOA 5EVZA 1NGJA 5FPDA 2MBKA 3FZKA 4GNIA 2QWNA 1ATSA 5AQQA 2QWQA 2V7ZA 2MN5A 2QXLA 5AQYA 1QQOA 3A8YA 5BN8A 3ATUA 3GL1A 3L6QA 4KBOA 1NGIA 5F1XA 2GMOA 4UAFE 4UAEF 4HWIA 5AQHA 3KVGA 5AQWA 1NGDA 2BUPA 3FE1A 3GDQA 5AQRA 5AQUA 2JDQD 5AQPA 5AQNA 5AQXA 3D2FB 2QWOA 5AR0A 3BK3C 3QMLA 1S3XA 2YILA 3ATVA 3LDQA 5AQMA 5BPMA 5AQVA 1BUPA 1DKGD 2QWRA 1QQNA 2YIPA 3AY9A 3FZLA 5EX5A 3L56A 3QFUA 4UADE 5AQZA 3IUCA 1KAZA 1KAYA 5AQJA 1NGAA 3HSCA 2E8AA 4FL9A 2E2FA 2YIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHW A;  2GMO A;  2VY6 A;  4UAF E;  4UAE F;  2JDQ D;  3L56 A;  3KC6 A;  3R2V A;  4UAD E;  3CW4 A; 
#chains in the Genus database with same CATH topology
 1NGB A;  1PE4 A;  3M3Z A;  4AAZ A;  1ZFU A;  1ZUT A;  3FZF A;  2K35 A;  1SNB A;  2E88 A;  2QWM A;  2LI7 A;  1YUW A;  1HPM A;  1NGG A;  3CW4 A;  3LDN A;  1QQM A;  1SN1 A;  1NPI A;  1ZYV A;  3KHW A;  1KV0 A;  3QI7 A;  2NY8 X;  3C7N B;  3GKU A;  1HX1 A;  2LT8 A;  1MR4 A;  2KHO A;  4AB0 A;  1N4N A;  5FPN A;  1WWN A;  2KYQ A;  3D2F A;  3C7N A;  1BK8 A;  3CQX A;  1LQI A;  2YBR C;  2NY9 X;  1ZU3 A;  3KP1 A;  1K8B A;  5BN9 A;  2A7T A;  5AQO A;  5AQG A;  5BPN A;  5FPE A;  2QWL A;  2KBJ A;  2LY5 A;  3KOZ A;  3KOW A;  4H5T A;  2N2R A;  4H5W A;  1BA0 A;  1UGL A;  3L4I A;  2E3F A;  5F2R A;  2M8B B;  2G2K A;  5AQI A;  1NGE A;  4H5V A;  2LN8 A;  2LJ7 A;  1T7A A;  2N2Q A;  5AQS A;  1I2U A;  2KBH A;  4IO8 A;  1POI A;  5EXW A;  3D2E B;  2I61 A;  1TI5 A;  3R2V A;  1MYN A;  3LDL A;  3SF4 D;  1LQH A;  1JKZ A;  5F0X A;  1B3C A;  4AEI A;  2N69 A;  3D2E A;  3KP0 A;  5FPM A;  1GPS A;  3QFP A;  3KC6 A;  1NGF A;  5BPL A;  1ZYW A;  5AQT A;  1KAX A;  1NGC A;  1NGH A;  1ATR A;  1P0A A;  3I33 A;  3JXU A;  3LDP A;  2GL1 A;  2VY6 A;  5EY4 A;  1DJT A;  1C56 A;  1NRA A;  1LQQ A;  5AQL A;  5AQF A;  4UJ0 A;  4FSV A;  2QW9 A;  2D56 A;  1BCG A;  1HJO A;  2KGQ A;  2N66 A;  1ZVG A;  4H5N A;  1C55 A;  1BA1 A;  2QWP A;  1JXC A;  1FH3 A;  2KPY A;  3FZM A;  4KYP A;  1DQ7 A;  5AQK A;  3FZH A;  5KK4 A;  3KOY A;  3LDO A;  1T7E A;  1NE5 A;  2E3G A;  5EVZ A;  1NGJ A;  1XRS B;  2MBK A;  3FZK A;  4GNI A;  2QWN A;  1ATS A;  2YC1 C;  4KBO A;  5FPD A;  1NRB A;  5AQQ A;  2KSK A;  2QWQ A;  1JZB A;  2V7Z A;  2MN5 A;  1L4V A;  2QXL A;  1SEG A;  5AQY A;  1QQO A;  3A8Y A;  5BN8 A;  1ZVE A;  1B7D A;  1AHO A;  2ATB A;  2LY6 A;  3ATU A;  2KJA A;  3GL1 A;  1T1T A;  2E0H A;  2LKB A;  3L6Q A;  1BMR A;  1ICA A;  2ASC A;  2YEO A;  4V1D C;  1JZA A;  1BRZ A;  1NGI A;  5F1X A;  4HE7 A;  2GMO A;  3KOX A;  4UAF E;  1CHZ A;  4UAE F;  2LJM A;  4HWI A;  5AQH A;  3KVG A;  5AQW A;  1I6F A;  1NH5 A;  1NGD A;  4CQK A;  2BUP A;  1OZZ A;  2B68 A;  3FE1 A;  3GDQ A;  1VNA A;  5AQR A;  1WT7 A;  5AQU A;  1I2V A;  2JDQ D;  5AQP A;  3E7R L;  4HHF A;  5AQN A;  5AQX A;  3D2F B;  1T0Z A;  1T7B A;  2QWO A;  5AR0 A;  5CY0 A;  3BK3 C;  1I6G A;  1P00 A;  3QML A;  1S3X A;  1OMY A;  2B3C A;  2YIL A;  3ATV A;  3LDQ A;  5AQM A;  2KBK A;  5BPM A;  5AQV A;  1BUP A;  2LR3 A;  1GPT A;  1DKG D;  2QWR A;  1QQN A;  2YIP A;  3PSM A;  3AY9 A;  3FZL A;  1WMT A;  3E7U X;  5EX5 A;  3L56 A;  3QFU A;  4UAD E;  2BRZ A;  1CN2 A;  2MZ0 A;  5AQZ A;  1PTX A;  4H5R A;  1PX9 A;  3IUC A;  1KAZ A;  1KAY A;  5AQJ A;  1NGA A;  1AYJ A;  3HSC A;  1VNB A;  2E8A A;  4FL9 A;  2E2F A;  1SN4 A;  2SN3 A;  2YIO A; 
#chains in the Genus database with same CATH homology
 1NGB A;  3M3Z A;  3FZF A;  2K35 A;  2E88 A;  2QWM A;  1YUW A;  1HPM A;  1NGG A;  3CW4 A;  3LDN A;  1QQM A;  3KHW A;  4H5R A;  3QI7 A;  3C7N B;  1HX1 A;  2KHO A;  5FPN A;  3D2F A;  3C7N A;  3CQX A;  5BN9 A;  5AQO A;  5AQG A;  5BPN A;  5FPE A;  2QWL A;  4H5T A;  4H5W A;  1BA0 A;  3L4I A;  5F2R A;  5AQI A;  1NGE A;  4H5V A;  2LN8 A;  5AQS A;  4IO8 A;  1POI A;  5EXW A;  3D2E B;  3R2V A;  3LDL A;  3SF4 D;  5F0X A;  3D2E A;  5FPM A;  3QFP A;  3KC6 A;  1NGF A;  5BPL A;  5AQT A;  1KAX A;  1NGC A;  1NGH A;  3I33 A;  1ATR A;  3JXU A;  3LDP A;  2VY6 A;  5EY4 A;  5AQL A;  5AQF A;  4FSV A;  2QW9 A;  2D56 A;  1HJO A;  4H5N A;  1BA1 A;  2QWP A;  3FZM A;  5AQK A;  3FZH A;  3LDO A;  5EVZ A;  1NGJ A;  5FPD A;  2MBK A;  3FZK A;  4GNI A;  2QWN A;  1ATS A;  5AQQ A;  2QWQ A;  2V7Z A;  2MN5 A;  2QXL A;  5AQY A;  1QQO A;  3A8Y A;  5BN8 A;  3ATU A;  3GL1 A;  3L6Q A;  4KBO A;  1NGI A;  5F1X A;  2GMO A;  4UAF E;  4UAE F;  4HWI A;  5AQH A;  3KVG A;  5AQW A;  1NGD A;  2BUP A;  3FE1 A;  3GDQ A;  5AQR A;  5AQU A;  2JDQ D;  5AQP A;  5AQN A;  5AQX A;  3D2F B;  2QWO A;  5AR0 A;  3BK3 C;  3QML A;  1S3X A;  2YIL A;  3ATV A;  3LDQ A;  5AQM A;  5BPM A;  5AQV A;  1BUP A;  1DKG D;  2QWR A;  1QQN A;  2YIP A;  3AY9 A;  3FZL A;  5EX5 A;  3L56 A;  3QFU A;  4UAD E;  5AQZ A;  3IUC A;  1KAZ A;  1KAY A;  5AQJ A;  1NGA A;  3HSC A;  2E8A A;  4FL9 A;  2E2F A;  2YIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...