2KSKA

Solution structure of sugarcane defensin 5
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
HTPTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKRERAAATLRWPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugarcane defensin 5
publication title Portrayal of Complex Dynamic Properties of Sugarcane Defensin 5 by NMR: Multiple Motions Associated with Membrane Interaction.
pubmed doi rcsb
source organism Saccharum officinarum
molecule tags Antimicrobial protein
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kskA00
1B7DA 1JKZA 1LQIA 3PSMA 1JZBA 2MZ0A 1ICAA 2LJ7A 2M8BB 1BMRA 1NPIA 4CQKA 2LY6A 1SNBA 2KJAA 2KPYA 2N66A 1T7AA 2GL1A 1I6GA 1JXCA 1WT7A 2KSKA 2LJMA 1BCGA 1PTXA 1ZVGA 1CN2A 1DJTA 1AHOA 1ZUTA 2E0HA 2I61A 1MYNA 1T1TA 1ZYVA 1FH3A 2E3GA 4AB0A 2LKBA 5KK4A 1SEGA 1BK8A 1LQQA 1NRBA 1ZVEA 2NY8X 2YC1C 1SN1A 2KBJA 1MR4A 4AAZA 1OMYA 1T7EA 2B3CA 2LR3A 4AEIA 2A7TA 1OZZA 1ZYWA 1N4NA 2KYQA 4V1DC 1SN4A 1WWNA 1ZU3A 2NY9X 1CHZA 1L4VA 2N69A 2KGQA 3E7RL 2N2RA 1I2VA 1I6FA 2E3FA 1DQ7A 2N2QA 4HHFA 2YEOA 2SN3A 2BRZA 2KBKA 1BRZA 2ASCA 2YBRC 1NE5A 2LY5A 1VNAA 1ZFUA 1T0ZA 2LT8A 4KYPA 1P0AA 3E7UX 2ATBA 1C56A 1TI5A 1P00A 2KBHA 4HE7A 1PX9A 1LQHA 4UJ0A 1AYJA 1NRAA 1NH5A 1PE4A 1WMTA 1C55A 1KV0A 2LI7A 2B68A 1I2UA 1JZAA 1GPSA 1GPTA 5CY0A 1VNBA 1T7BA 1B3CA
chains in the Genus database with same CATH superfamily
3KVGA 1B7DA 1JKZA 3L6QA 1LQIA 3PSMA 2QWMA 1JZBA 1K8BA 2MZ0A 3LDOA 3C7NB 1UGLA 5BPLA 2YILA 1ICAA 2LJ7A 1QQNA 5FPNA 3LDQA 1BUPA 5AQMA 2M8BB 1BMRA 1NGIA 1NPIA 1S3XA 3GKUA 2LN8A 2LY6A 4CQKA 1SNBA 3KOWA 3D2FB 2KJAA 4H5TA 2KPYA 2N66A 2QW9A 4KBOA 1KAZA 1T7AA 2GL1A 4H5VA 3KOYA 3FZKA 4UAEF 1BA1A 1I6GA 5AQUA 1JXCA 1NGHA 5AQVA 1WT7A 2BUPA 4UADE 5EX5A 1NGAA 2KSKA 2LJMA 1BCGA 2QWRA 1PTXA 1HX1A 1ZVGA 2QWPA 3FZHA 1DJTA 3IUCA 1AHOA 1CN2A 4H5NA 5AQNA 1ZUTA 2E0HA 2I61A 1MYNA 1T1TA 4UAFE 1ZYVA 1FH3A 1NGFA 2E3GA 5AQPA 5AQSA 4AB0A 3ATUA 5AQZA 2LKBA 4H5RA 1YUWA 5AQKA 5BPNA 5F0XA 3ATVA 5KK4A 1SEGA 1BK8A 1LQQA 1BA0A 1NRBA 1ZVEA 3QFPA 4IO8A 5EXWA 1ATRA 1NGJA 2NY8X 2YC1C 1SN1A 2D56A 2KBJA 1MR4A 3FZFA 4AAZA 1OMYA 1T7EA 2B3CA 2LR3A 3AY9A 2QWQA 2QWLA 3QFUA 3FZMA 3L56A 3LDNA 2A7TA 1OZZA 5AQQA 5AQYA 1ZYWA 4AEIA 1N4NA 2YIOA 5BN8A 2KYQA 3HSCA 4V1DC 1SN4A 1WWNA 2QXLA 2V7ZA 3CW4A 3CQXA 5AQOA 5AQRA 5AQXA 5AQFA 1HJOA 1KAYA 1QQMA 1ZU3A 1KAXA 2NY9X 3FE1A 3D2FA 1NGGA 2K35A 1CHZA 1L4VA 2N69A 2E2FA 2KGQA 3E7RL 3SF4D 5FPEA 5AQTA 2N2RA 2QWOA 1I2VA 1I6FA 2E3FA 1DQ7A 2E88A 2E8AA 4FSVA 5AR0A 2N2QA 4HHFA 3D2EA 2YEOA 2SN3A 3LDLA 3A8YA 1HPMA 2BRZA 2KBKA 1BRZA 5AQWA 5AQJA 3BK3C 1NGCA 2ASCA 2YBRC 3I33A 1NE5A 2LY5A 3KP0A 5BPMA 2QWNA 1VNAA 3C7NA 3GDQA 1ZFUA 1T0ZA 2LT8A 3KOZA 1P0AA 4KYPA 1POIA 5EY4A 3E7UX 2VY6A 2ATBA 5AQLA 3LDPA 3JXUA 3FZLA 1C56A 1TI5A 1P00A 2KBHA 3R2VA 4HE7A 3M3ZA 5BN9A 1NGDA 1QQOA 3QMLA 4H5WA 4HWIA 1PX9A 1LQHA 4UJ0A 1AYJA 5AQHA 5F1XA 1NGEA 1NRAA 4FL9A 3KC6A 1NGBA 3KHWA 5AQGA 1DKGD 1NH5A 2JDQD 1PE4A 1WMTA 2MN5A 1KV0A 1C55A 5AQIA 2YIPA 2LI7A 1XRSB 2G2KA 3L4IA 2B68A 2KHOA 4GNIA 5FPMA 2MBKA 3QI7A 5F2RA 1I2UA 3KOXA 5EVZA 1JZAA 3KP1A 1GPSA 3D2EB 2GMOA 5CY0A 1GPTA 5FPDA 3GL1A 1VNBA 1T7BA 1ATSA 1B3CA
chains in the Genus database with same CATH topology
1B7DA 1JKZA 1LQIA 3PSMA 1JZBA 2MZ0A 1ICAA 2LJ7A 2M8BB 1BMRA 1NPIA 4CQKA 2LY6A 1SNBA 2KJAA 2KPYA 2N66A 1T7AA 2GL1A 1I6GA 1JXCA 1WT7A 2KSKA 2LJMA 1BCGA 1PTXA 1ZVGA 1CN2A 1DJTA 1AHOA 1ZUTA 2E0HA 2I61A 1MYNA 1T1TA 1ZYVA 1FH3A 2E3GA 4AB0A 2LKBA 5KK4A 1SEGA 1BK8A 1LQQA 1NRBA 1ZVEA 2NY8X 2YC1C 1SN1A 2KBJA 1MR4A 4AAZA 1OMYA 1T7EA 2B3CA 2LR3A 4AEIA 2A7TA 1OZZA 1ZYWA 1N4NA 2KYQA 4V1DC 1SN4A 1WWNA 1ZU3A 2NY9X 1CHZA 1L4VA 2N69A 2KGQA 3E7RL 2N2RA 1I2VA 1I6FA 2E3FA 1DQ7A 2N2QA 4HHFA 2YEOA 2SN3A 2BRZA 2KBKA 1BRZA 2ASCA 2YBRC 1NE5A 2LY5A 1VNAA 1ZFUA 1T0ZA 2LT8A 4KYPA 1P0AA 3E7UX 2ATBA 1C56A 1TI5A 1P00A 2KBHA 4HE7A 1PX9A 1LQHA 4UJ0A 1AYJA 1NRAA 1NH5A 1PE4A 1WMTA 1C55A 1KV0A 2LI7A 2B68A 1I2UA 1JZAA 1GPSA 1GPTA 5CY0A 1VNBA 1T7BA 1B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7D A;  1JKZ A;  1LQI A;  3PSM A;  1JZB A;  2MZ0 A;  1ICA A;  2LJ7 A;  2M8B B;  1BMR A;  1NPI A;  4CQK A;  2LY6 A;  1SNB A;  2KJA A;  2KPY A;  2N66 A;  1T7A A;  2GL1 A;  1I6G A;  1JXC A;  1WT7 A;  2KSK A;  2LJM A;  1BCG A;  1PTX A;  1ZVG A;  1CN2 A;  1DJT A;  1AHO A;  1ZUT A;  2E0H A;  2I61 A;  1MYN A;  1T1T A;  1ZYV A;  1FH3 A;  2E3G A;  4AB0 A;  2LKB A;  5KK4 A;  1SEG A;  1BK8 A;  1LQQ A;  1NRB A;  1ZVE A;  2NY8 X;  2YC1 C;  1SN1 A;  2KBJ A;  1MR4 A;  4AAZ A;  1OMY A;  1T7E A;  2B3C A;  2LR3 A;  4AEI A;  2A7T A;  1OZZ A;  1ZYW A;  1N4N A;  2KYQ A;  4V1D C;  1SN4 A;  1WWN A;  1ZU3 A;  2NY9 X;  1CHZ A;  1L4V A;  2N69 A;  2KGQ A;  3E7R L;  2N2R A;  1I2V A;  1I6F A;  2E3F A;  1DQ7 A;  2N2Q A;  4HHF A;  2YEO A;  2SN3 A;  2BRZ A;  2KBK A;  1BRZ A;  2ASC A;  2YBR C;  1NE5 A;  2LY5 A;  1VNA A;  1ZFU A;  1T0Z A;  2LT8 A;  4KYP A;  1P0A A;  3E7U X;  2ATB A;  1C56 A;  1TI5 A;  1P00 A;  2KBH A;  4HE7 A;  1PX9 A;  1LQH A;  4UJ0 A;  1AYJ A;  1NRA A;  1NH5 A;  1PE4 A;  1WMT A;  1C55 A;  1KV0 A;  2LI7 A;  2B68 A;  1I2U A;  1JZA A;  1GPS A;  1GPT A;  5CY0 A;  1VNB A;  1T7B A;  1B3C A; 
#chains in the Genus database with same CATH topology
 3KVG A;  1B7D A;  1JKZ A;  3L6Q A;  1LQI A;  3PSM A;  2QWM A;  1JZB A;  1K8B A;  2MZ0 A;  3LDO A;  3C7N B;  1UGL A;  5BPL A;  2YIL A;  1ICA A;  2LJ7 A;  1QQN A;  5FPN A;  3LDQ A;  1BUP A;  5AQM A;  2M8B B;  1BMR A;  1NGI A;  1NPI A;  1S3X A;  3GKU A;  2LN8 A;  2LY6 A;  4CQK A;  1SNB A;  3KOW A;  3D2F B;  2KJA A;  4H5T A;  2KPY A;  2N66 A;  2QW9 A;  4KBO A;  1KAZ A;  1T7A A;  2GL1 A;  4H5V A;  3KOY A;  3FZK A;  4UAE F;  1BA1 A;  1I6G A;  5AQU A;  1JXC A;  1NGH A;  5AQV A;  1WT7 A;  2BUP A;  4UAD E;  5EX5 A;  1NGA A;  2KSK A;  2LJM A;  1BCG A;  2QWR A;  1PTX A;  1HX1 A;  1ZVG A;  2QWP A;  3FZH A;  1DJT A;  3IUC A;  1AHO A;  1CN2 A;  4H5N A;  5AQN A;  1ZUT A;  2E0H A;  2I61 A;  1MYN A;  1T1T A;  4UAF E;  1ZYV A;  1FH3 A;  1NGF A;  2E3G A;  5AQP A;  5AQS A;  4AB0 A;  3ATU A;  5AQZ A;  2LKB A;  4H5R A;  1YUW A;  5AQK A;  5BPN A;  5F0X A;  3ATV A;  5KK4 A;  1SEG A;  1BK8 A;  1LQQ A;  1BA0 A;  1NRB A;  1ZVE A;  3QFP A;  4IO8 A;  5EXW A;  1ATR A;  1NGJ A;  2NY8 X;  2YC1 C;  1SN1 A;  2D56 A;  2KBJ A;  1MR4 A;  3FZF A;  4AAZ A;  1OMY A;  1T7E A;  2B3C A;  2LR3 A;  3AY9 A;  2QWQ A;  2QWL A;  3QFU A;  3FZM A;  3L56 A;  3LDN A;  2A7T A;  1OZZ A;  5AQQ A;  5AQY A;  1ZYW A;  4AEI A;  1N4N A;  2YIO A;  5BN8 A;  2KYQ A;  3HSC A;  4V1D C;  1SN4 A;  1WWN A;  2QXL A;  2V7Z A;  3CW4 A;  3CQX A;  5AQO A;  5AQR A;  5AQX A;  5AQF A;  1HJO A;  1KAY A;  1QQM A;  1ZU3 A;  1KAX A;  2NY9 X;  3FE1 A;  3D2F A;  1NGG A;  2K35 A;  1CHZ A;  1L4V A;  2N69 A;  2E2F A;  2KGQ A;  3E7R L;  3SF4 D;  5FPE A;  5AQT A;  2N2R A;  2QWO A;  1I2V A;  1I6F A;  2E3F A;  1DQ7 A;  2E88 A;  2E8A A;  4FSV A;  5AR0 A;  2N2Q A;  4HHF A;  3D2E A;  2YEO A;  2SN3 A;  3LDL A;  3A8Y A;  1HPM A;  2BRZ A;  2KBK A;  1BRZ A;  5AQW A;  5AQJ A;  3BK3 C;  1NGC A;  2ASC A;  2YBR C;  3I33 A;  1NE5 A;  2LY5 A;  3KP0 A;  5BPM A;  2QWN A;  1VNA A;  3C7N A;  3GDQ A;  1ZFU A;  1T0Z A;  2LT8 A;  3KOZ A;  1P0A A;  4KYP A;  1POI A;  5EY4 A;  3E7U X;  2VY6 A;  2ATB A;  5AQL A;  3LDP A;  3JXU A;  3FZL A;  1C56 A;  1TI5 A;  1P00 A;  2KBH A;  3R2V A;  4HE7 A;  3M3Z A;  5BN9 A;  1NGD A;  1QQO A;  3QML A;  4H5W A;  4HWI A;  1PX9 A;  1LQH A;  4UJ0 A;  1AYJ A;  5AQH A;  5F1X A;  1NGE A;  1NRA A;  4FL9 A;  3KC6 A;  1NGB A;  3KHW A;  5AQG A;  1DKG D;  1NH5 A;  2JDQ D;  1PE4 A;  1WMT A;  2MN5 A;  1KV0 A;  1C55 A;  5AQI A;  2YIP A;  2LI7 A;  1XRS B;  2G2K A;  3L4I A;  2B68 A;  2KHO A;  4GNI A;  5FPM A;  2MBK A;  3QI7 A;  5F2R A;  1I2U A;  3KOX A;  5EVZ A;  1JZA A;  3KP1 A;  1GPS A;  3D2E B;  2GMO A;  5CY0 A;  1GPT A;  5FPD A;  3GL1 A;  1VNB A;  1T7B A;  1ATS A;  1B3C A; 
#chains in the Genus database with same CATH homology
 1B7D A;  1JKZ A;  1LQI A;  3PSM A;  1JZB A;  2MZ0 A;  1ICA A;  2LJ7 A;  2M8B B;  1BMR A;  1NPI A;  4CQK A;  2LY6 A;  1SNB A;  2KJA A;  2KPY A;  2N66 A;  1T7A A;  2GL1 A;  1I6G A;  1JXC A;  1WT7 A;  2KSK A;  2LJM A;  1BCG A;  1PTX A;  1ZVG A;  1CN2 A;  1DJT A;  1AHO A;  1ZUT A;  2E0H A;  2I61 A;  1MYN A;  1T1T A;  1ZYV A;  1FH3 A;  2E3G A;  4AB0 A;  2LKB A;  5KK4 A;  1SEG A;  1BK8 A;  1LQQ A;  1NRB A;  1ZVE A;  2NY8 X;  2YC1 C;  1SN1 A;  2KBJ A;  1MR4 A;  4AAZ A;  1OMY A;  1T7E A;  2B3C A;  2LR3 A;  4AEI A;  2A7T A;  1OZZ A;  1ZYW A;  1N4N A;  2KYQ A;  4V1D C;  1SN4 A;  1WWN A;  1ZU3 A;  2NY9 X;  1CHZ A;  1L4V A;  2N69 A;  2KGQ A;  3E7R L;  2N2R A;  1I2V A;  1I6F A;  2E3F A;  1DQ7 A;  2N2Q A;  4HHF A;  2YEO A;  2SN3 A;  2BRZ A;  2KBK A;  1BRZ A;  2ASC A;  2YBR C;  1NE5 A;  2LY5 A;  1VNA A;  1ZFU A;  1T0Z A;  2LT8 A;  4KYP A;  1P0A A;  3E7U X;  2ATB A;  1C56 A;  1TI5 A;  1P00 A;  2KBH A;  4HE7 A;  1PX9 A;  1LQH A;  4UJ0 A;  1AYJ A;  1NRA A;  1NH5 A;  1PE4 A;  1WMT A;  1C55 A;  1KV0 A;  2LI7 A;  2B68 A;  1I2U A;  1JZA A;  1GPS A;  1GPT A;  5CY0 A;  1VNB A;  1T7B A;  1B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...