1SN4A

Structure of scorpion neurotoxin bmk m4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKPENCVYHCAGNEGCNKLCTDNGAESGYCQWGGRYGNACWCIKLPDDVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NEUROTOXIN BMK M4)
publication title Crystal structures of two alpha-like scorpion toxins: non-proline cis peptide bonds and implications for new binding site selectivity on the sodium channel.
pubmed doi rcsb
molecule tags Toxin
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1sn4A00
1T7BA 4AAZA 1WMTA 1BK8A 1ICAA 2LY5A 2E3GA 2N66A 1T7EA 1JXCA 1LQHA 1ZVEA 1KV0A 1AYJA 1ZYVA 1NRBA 1OZZA 1PTXA 1ZFUA 2E3FA 1SEGA 1BMRA 1NE5A 1T1TA 4AB0A 1N4NA 1NH5A 1B7DA 1SN4A 4AEIA 1SN1A 1MYNA 1T0ZA 1T7AA 1I2VA 1BRZA 2LI7A 2KSKA 1DJTA 1I2UA 2YEOA 4KYPA 1DQ7A 2GL1A 1PE4A 1WT7A 1C56A 1I6GA 1ZUTA 2BRZA 2SN3A 2B68A 2N2QA 3E7RL 2KBKA 1L4VA 2MZ0A 1PX9A 1FH3A 1VNBA 1MR4A 4HHFA 2ASCA 1VNAA 5CY0A 1NRAA 1LQIA 2NY8X 1C55A 2E0HA 4UJ0A 2LKBA 2LY6A 3PSMA 1TI5A 2LJMA 1NPIA 2B3CA 2LR3A 4CQKA 2N2RA 1SNBA 2I61A 1JZAA 2NY9X 2KJAA 2N69A 3E7UX 1ZYWA 2ATBA 1ZU3A 1ZVGA 2KBJA 1P0AA 1JZBA 1LQQA 1AHOA 2YBRC 1WWNA 2A7TA 1I6FA 1JKZA 2YC1C 1BCGA 5KK4A 1CN2A 1GPTA 2KYQA 1B3CA 1GPSA 2LT8A 2LJ7A 1P00A 2KGQA 1OMYA 4HE7A 1CHZA 4V1DC 2KPYA 2M8BB 2KBHA
chains in the Genus database with same CATH superfamily
3CQXA 1T7BA 3GKUA 4AAZA 1WMTA 5BN8A 3FZKA 3BK3C 1BK8A 2K35A 1ICAA 2LY5A 1QQOA 2E3GA 4UAFE 3GL1A 2VY6A 2N66A 1T7EA 1JXCA 3IUCA 5FPMA 5F1XA 3KOYA 1LQHA 1HX1A 1ZVEA 1KV0A 3QFUA 5AQQA 1AYJA 3D2FA 1ZYVA 5AQYA 1NRBA 2YILA 2QWRA 1OZZA 3LDPA 1NGBA 1NGHA 4H5TA 1PTXA 1ZFUA 2E3FA 2QW9A 1SEGA 1BMRA 1NE5A 1T1TA 4GNIA 4AB0A 2E88A 1N4NA 3FZMA 1NH5A 5AR0A 3D2EB 2V7ZA 1B7DA 3L56A 1K8BA 1SN4A 4AEIA 1S3XA 1SN1A 1MYNA 1T0ZA 3FZFA 3JXUA 2GMOA 1T7AA 5FPDA 1I2VA 1BRZA 2LI7A 1BA1A 1KAZA 2KSKA 3GDQA 1DJTA 2QWNA 1I2UA 2YEOA 1NGFA 3R2VA 1BA0A 5BN9A 3LDNA 5EVZA 4KYPA 4H5RA 5AQTA 3I33A 3QFPA 5AQRA 3QMLA 1DQ7A 2GL1A 1PE4A 1HPMA 1NGCA 3KP1A 1WT7A 3KHWA 3QI7A 1C56A 5BPMA 3KP0A 1I6GA 1ZUTA 3KC6A 4UAEF 3L6QA 2D56A 4UADE 5AQHA 2BRZA 2SN3A 2QWMA 3A8YA 3ATVA 3C7NB 2QWPA 2B68A 1NGEA 5AQPA 2N2QA 3AY9A 5AQVA 3E7RL 2KBKA 1L4VA 2MZ0A 1PX9A 3CW4A 1FH3A 5BPNA 1VNBA 2QWLA 1MR4A 4H5NA 2ASCA 4HHFA 5AQUA 1VNAA 2MN5A 5CY0A 2YIPA 5EXWA 1ATRA 5AQIA 2YIOA 5AQFA 5AQZA 5AQKA 3KOZA 5AQLA 1KAYA 1LQIA 1NRAA 2NY8X 1C55A 1YUWA 2E0HA 4UJ0A 2LKBA 5EY4A 3ATUA 2LY6A 3PSMA 1TI5A 3D2EA 4HWIA 2LJMA 3FZHA 4FSVA 1NPIA 2B3CA 2LR3A 5F2RA 4CQKA 2N2RA 1SNBA 1UGLA 5FPNA 5EX5A 2I61A 2KHOA 1JZAA 3LDLA 2E2FA 3KOWA 4FL9A 2JDQD 2NY9X 2KJAA 2N69A 5AQJA 3E7UX 2G2KA 5FPEA 1NGJA 1ZYWA 2ATBA 4IO8A 1NGGA 1ZU3A 1ZVGA 2KBJA 1P0AA 1JZBA 2BUPA 1DKGD 1LQQA 1AHOA 2QWQA 1XRSB 2YBRC 3D2FB 1WWNA 2A7TA 4H5VA 1I6FA 3KOXA 1ATSA 1JKZA 2YC1C 3L4IA 3C7NA 1BCGA 1POIA 5KK4A 2QXLA 5AQWA 5BPLA 1QQNA 1CN2A 3SF4D 2KYQA 1GPTA 1QQMA 1B3CA 2LN8A 5F0XA 3LDQA 1GPSA 2LT8A 3FE1A 4H5WA 1KAXA 3M3ZA 2QWOA 2MBKA 2LJ7A 3KVGA 1P00A 2KGQA 5AQMA 5AQNA 1OMYA 5AQXA 3LDOA 3FZLA 1NGIA 1NGAA 4HE7A 2E8AA 3HSCA 1CHZA 4KBOA 5AQOA 1BUPA 1NGDA 4V1DC 5AQSA 5AQGA 2KPYA 2M8BB 2KBHA 1HJOA
chains in the Genus database with same CATH topology
1T7BA 4AAZA 1WMTA 1BK8A 1ICAA 2LY5A 2E3GA 2N66A 1T7EA 1JXCA 1LQHA 1ZVEA 1KV0A 1AYJA 1ZYVA 1NRBA 1OZZA 1PTXA 1ZFUA 2E3FA 1SEGA 1BMRA 1NE5A 1T1TA 4AB0A 1N4NA 1NH5A 1B7DA 1SN4A 4AEIA 1SN1A 1MYNA 1T0ZA 1T7AA 1I2VA 1BRZA 2LI7A 2KSKA 1DJTA 1I2UA 2YEOA 4KYPA 1DQ7A 2GL1A 1PE4A 1WT7A 1C56A 1I6GA 1ZUTA 2BRZA 2SN3A 2B68A 2N2QA 3E7RL 2KBKA 1L4VA 2MZ0A 1PX9A 1FH3A 1VNBA 1MR4A 4HHFA 2ASCA 1VNAA 5CY0A 1NRAA 1LQIA 2NY8X 1C55A 2E0HA 4UJ0A 2LKBA 2LY6A 3PSMA 1TI5A 2LJMA 1NPIA 2B3CA 2LR3A 4CQKA 2N2RA 1SNBA 2I61A 1JZAA 2NY9X 2KJAA 2N69A 3E7UX 1ZYWA 2ATBA 1ZU3A 1ZVGA 2KBJA 1P0AA 1JZBA 1LQQA 1AHOA 2YBRC 1WWNA 2A7TA 1I6FA 1JKZA 2YC1C 1BCGA 5KK4A 1CN2A 1GPTA 2KYQA 1B3CA 1GPSA 2LT8A 2LJ7A 1P00A 2KGQA 1OMYA 4HE7A 1CHZA 4V1DC 2KPYA 2M8BB 2KBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7B A;  4AAZ A;  1WMT A;  1BK8 A;  1ICA A;  2LY5 A;  2E3G A;  2N66 A;  1T7E A;  1JXC A;  1LQH A;  1ZVE A;  1KV0 A;  1AYJ A;  1ZYV A;  1NRB A;  1OZZ A;  1PTX A;  1ZFU A;  2E3F A;  1SEG A;  1BMR A;  1NE5 A;  1T1T A;  4AB0 A;  1N4N A;  1NH5 A;  1B7D A;  1SN4 A;  4AEI A;  1SN1 A;  1MYN A;  1T0Z A;  1T7A A;  1I2V A;  1BRZ A;  2LI7 A;  2KSK A;  1DJT A;  1I2U A;  2YEO A;  4KYP A;  1DQ7 A;  2GL1 A;  1PE4 A;  1WT7 A;  1C56 A;  1I6G A;  1ZUT A;  2BRZ A;  2SN3 A;  2B68 A;  2N2Q A;  3E7R L;  2KBK A;  1L4V A;  2MZ0 A;  1PX9 A;  1FH3 A;  1VNB A;  1MR4 A;  4HHF A;  2ASC A;  1VNA A;  5CY0 A;  1NRA A;  1LQI A;  2NY8 X;  1C55 A;  2E0H A;  4UJ0 A;  2LKB A;  2LY6 A;  3PSM A;  1TI5 A;  2LJM A;  1NPI A;  2B3C A;  2LR3 A;  4CQK A;  2N2R A;  1SNB A;  2I61 A;  1JZA A;  2NY9 X;  2KJA A;  2N69 A;  3E7U X;  1ZYW A;  2ATB A;  1ZU3 A;  1ZVG A;  2KBJ A;  1P0A A;  1JZB A;  1LQQ A;  1AHO A;  2YBR C;  1WWN A;  2A7T A;  1I6F A;  1JKZ A;  2YC1 C;  1BCG A;  5KK4 A;  1CN2 A;  1GPT A;  2KYQ A;  1B3C A;  1GPS A;  2LT8 A;  2LJ7 A;  1P00 A;  2KGQ A;  1OMY A;  4HE7 A;  1CHZ A;  4V1D C;  2KPY A;  2M8B B;  2KBH A; 
#chains in the Genus database with same CATH topology
 3CQX A;  1T7B A;  3GKU A;  4AAZ A;  1WMT A;  5BN8 A;  3FZK A;  3BK3 C;  1BK8 A;  2K35 A;  1ICA A;  2LY5 A;  1QQO A;  2E3G A;  4UAF E;  3GL1 A;  2VY6 A;  2N66 A;  1T7E A;  1JXC A;  3IUC A;  5FPM A;  5F1X A;  3KOY A;  1LQH A;  1HX1 A;  1ZVE A;  1KV0 A;  3QFU A;  5AQQ A;  1AYJ A;  3D2F A;  1ZYV A;  5AQY A;  1NRB A;  2YIL A;  2QWR A;  1OZZ A;  3LDP A;  1NGB A;  1NGH A;  4H5T A;  1PTX A;  1ZFU A;  2E3F A;  2QW9 A;  1SEG A;  1BMR A;  1NE5 A;  1T1T A;  4GNI A;  4AB0 A;  2E88 A;  1N4N A;  3FZM A;  1NH5 A;  5AR0 A;  3D2E B;  2V7Z A;  1B7D A;  3L56 A;  1K8B A;  1SN4 A;  4AEI A;  1S3X A;  1SN1 A;  1MYN A;  1T0Z A;  3FZF A;  3JXU A;  2GMO A;  1T7A A;  5FPD A;  1I2V A;  1BRZ A;  2LI7 A;  1BA1 A;  1KAZ A;  2KSK A;  3GDQ A;  1DJT A;  2QWN A;  1I2U A;  2YEO A;  1NGF A;  3R2V A;  1BA0 A;  5BN9 A;  3LDN A;  5EVZ A;  4KYP A;  4H5R A;  5AQT A;  3I33 A;  3QFP A;  5AQR A;  3QML A;  1DQ7 A;  2GL1 A;  1PE4 A;  1HPM A;  1NGC A;  3KP1 A;  1WT7 A;  3KHW A;  3QI7 A;  1C56 A;  5BPM A;  3KP0 A;  1I6G A;  1ZUT A;  3KC6 A;  4UAE F;  3L6Q A;  2D56 A;  4UAD E;  5AQH A;  2BRZ A;  2SN3 A;  2QWM A;  3A8Y A;  3ATV A;  3C7N B;  2QWP A;  2B68 A;  1NGE A;  5AQP A;  2N2Q A;  3AY9 A;  5AQV A;  3E7R L;  2KBK A;  1L4V A;  2MZ0 A;  1PX9 A;  3CW4 A;  1FH3 A;  5BPN A;  1VNB A;  2QWL A;  1MR4 A;  4H5N A;  2ASC A;  4HHF A;  5AQU A;  1VNA A;  2MN5 A;  5CY0 A;  2YIP A;  5EXW A;  1ATR A;  5AQI A;  2YIO A;  5AQF A;  5AQZ A;  5AQK A;  3KOZ A;  5AQL A;  1KAY A;  1LQI A;  1NRA A;  2NY8 X;  1C55 A;  1YUW A;  2E0H A;  4UJ0 A;  2LKB A;  5EY4 A;  3ATU A;  2LY6 A;  3PSM A;  1TI5 A;  3D2E A;  4HWI A;  2LJM A;  3FZH A;  4FSV A;  1NPI A;  2B3C A;  2LR3 A;  5F2R A;  4CQK A;  2N2R A;  1SNB A;  1UGL A;  5FPN A;  5EX5 A;  2I61 A;  2KHO A;  1JZA A;  3LDL A;  2E2F A;  3KOW A;  4FL9 A;  2JDQ D;  2NY9 X;  2KJA A;  2N69 A;  5AQJ A;  3E7U X;  2G2K A;  5FPE A;  1NGJ A;  1ZYW A;  2ATB A;  4IO8 A;  1NGG A;  1ZU3 A;  1ZVG A;  2KBJ A;  1P0A A;  1JZB A;  2BUP A;  1DKG D;  1LQQ A;  1AHO A;  2QWQ A;  1XRS B;  2YBR C;  3D2F B;  1WWN A;  2A7T A;  4H5V A;  1I6F A;  3KOX A;  1ATS A;  1JKZ A;  2YC1 C;  3L4I A;  3C7N A;  1BCG A;  1POI A;  5KK4 A;  2QXL A;  5AQW A;  5BPL A;  1QQN A;  1CN2 A;  3SF4 D;  2KYQ A;  1GPT A;  1QQM A;  1B3C A;  2LN8 A;  5F0X A;  3LDQ A;  1GPS A;  2LT8 A;  3FE1 A;  4H5W A;  1KAX A;  3M3Z A;  2QWO A;  2MBK A;  2LJ7 A;  3KVG A;  1P00 A;  2KGQ A;  5AQM A;  5AQN A;  1OMY A;  5AQX A;  3LDO A;  3FZL A;  1NGI A;  1NGA A;  4HE7 A;  2E8A A;  3HSC A;  1CHZ A;  4KBO A;  5AQO A;  1BUP A;  1NGD A;  4V1D C;  5AQS A;  5AQG A;  2KPY A;  2M8B B;  2KBH A;  1HJO A; 
#chains in the Genus database with same CATH homology
 1T7B A;  4AAZ A;  1WMT A;  1BK8 A;  1ICA A;  2LY5 A;  2E3G A;  2N66 A;  1T7E A;  1JXC A;  1LQH A;  1ZVE A;  1KV0 A;  1AYJ A;  1ZYV A;  1NRB A;  1OZZ A;  1PTX A;  1ZFU A;  2E3F A;  1SEG A;  1BMR A;  1NE5 A;  1T1T A;  4AB0 A;  1N4N A;  1NH5 A;  1B7D A;  1SN4 A;  4AEI A;  1SN1 A;  1MYN A;  1T0Z A;  1T7A A;  1I2V A;  1BRZ A;  2LI7 A;  2KSK A;  1DJT A;  1I2U A;  2YEO A;  4KYP A;  1DQ7 A;  2GL1 A;  1PE4 A;  1WT7 A;  1C56 A;  1I6G A;  1ZUT A;  2BRZ A;  2SN3 A;  2B68 A;  2N2Q A;  3E7R L;  2KBK A;  1L4V A;  2MZ0 A;  1PX9 A;  1FH3 A;  1VNB A;  1MR4 A;  4HHF A;  2ASC A;  1VNA A;  5CY0 A;  1NRA A;  1LQI A;  2NY8 X;  1C55 A;  2E0H A;  4UJ0 A;  2LKB A;  2LY6 A;  3PSM A;  1TI5 A;  2LJM A;  1NPI A;  2B3C A;  2LR3 A;  4CQK A;  2N2R A;  1SNB A;  2I61 A;  1JZA A;  2NY9 X;  2KJA A;  2N69 A;  3E7U X;  1ZYW A;  2ATB A;  1ZU3 A;  1ZVG A;  2KBJ A;  1P0A A;  1JZB A;  1LQQ A;  1AHO A;  2YBR C;  1WWN A;  2A7T A;  1I6F A;  1JKZ A;  2YC1 C;  1BCG A;  5KK4 A;  1CN2 A;  1GPT A;  2KYQ A;  1B3C A;  1GPS A;  2LT8 A;  2LJ7 A;  1P00 A;  2KGQ A;  1OMY A;  4HE7 A;  1CHZ A;  4V1D C;  2KPY A;  2M8B B;  2KBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...