3GL1A

Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
383
Chain Sequence
AEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein SSB1
publication title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 124
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3gl1A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3gl1A04
5EX5A 1RFQA 3GBTA 2CGKA 4FWQA 4ISGA 2OANA 3VGKA 1T44A 2E1ZA 3LDOA 4BRQA 2YJEA 1YVNA 2VYPA 1GLLO 1BO5O 1GLDG 4FOIA 3BP8A 5AQQA 3SJHA 1BDGA 3EZWA 1RDWX 2GTDA 3DXKB 3LL3A 4BG8A 4EHUA 5AQTA 1GLEG 2J4RA 5AQKA 4CZLA 2P9SB 4IXCA 2YCHA 3VEVA 5BN9A 3EN9A 3KVGA 1TUUA 1NGFA 4FPBA 2E20A 1P8ZA 4ISFA 3CQXA 3O08A 4BGAA 4BRDA 1TYQA 3ATUA 4YDUA 3HZ6A 4B1VA 2ZGYA 3WQTA 2CH5A 2EWSA 4CZJA 3WXKA 2GEMA 1J6ZA 3O1WA 5BRHA 1BOTO 3IUCA 3MN7A 4CD1A 1EQYA 3IFRA 1X9JA 3VGLA 5FPEA 2V52B 4DQ8A 5AQOA 5JMVA 5AZJA 1ZC6A 4BR9A 3HI0A 1E4FT 3WEEB 2ASMA 4JHDA 1NM1A 4FOEA 4KBOA 3HBTA 3LDQA 4PKHA 4FWOA 3VEZA 4I6MB 4BRHA 3A5NC 4FWLA 1HKCA 2YHWA 4JN4A 5BPNA 1QZ6A 1U2VA 4EFHA 2Q36A 4MO4A 3M6GA 2E88A 3HTVA 4CBUA 3H1VX 4BRFA 5AQJA 1BU6O 3A0IX 3EKUA 3M3ZA 3FLCO 1S22A 3UE5A 4O5FA 2FXUA 4FWSA 2YHXA 3ZETB 1V4SA 4H0VB 5BPLA 2FLOA 3EL2A 5KQDA 3AARA 3O6WA 3U4LA 4FL9A 4XH1A 2FF3B 2Q0UA 4B1ZA 2IVOA 3ENHA 3SK3A 1QZ5A 4H0TB 2D4WA 3D2FB 3OHRA 5TKYA 2IIRA 4IJNA 4CZKA 5AQHA 3CI5A 5E84A 3JS6A 1NLVA 3U9DA 3B8AX 3O80A 4O8KA 2HOEA 4FPAA 3SLCA 1BWFO 3VETA 3BF3A 1GLCG 2D0OA 1E4GT 5EXWA 3CJ7A 4MLEA 4WQ4C 3J8AA 2CGLA 3GDQA 5AQRA 2A42A 1ESVA 5AZIA 4FWKA 1NGGA 5AQMA 4CBWA 4CZEA 4NO7A 4H5VA 2P9IA 1Z6RA 1ZXOA 3UKUB 4BC5A 2ASOA 1YAGA 1HJOA 3CIPA 2A5XA 1NBWA 3AAPA 3F9MA 3UB5A 2W41A 4DCHA 3CJCA 1NGHA 1HKBA 1WUAA 3QFPA 4H5TA 1NWKA 2GELA 5LJVA 1Y64A 1X3NA 3U9ZA 5BRDA 4DB3A 3MN5A 2P9IB 2P9LB 3FZFA 1CZAN 4WQ5A 3ID8A 5CE3A 4BC4A 3CQYA 5FPNA 1DKGD 4CI6A 5AQIA 2WUSA 4CBXA 3DAWA 3MN6A 5AQFA 5JICA 5LY3A 4M63C 5I9EB 4A2BA 2QWNA 3LDLA 3O1BA 4HTLA 1XQSC 1BA0A 2AA4A 1ATRA 4FO0A 3FR0A 3L4IA 2BTFA 5BPMA 2ZF5O 3VF6A 4BVPA 5BRFA 4IO8A 3A8YA 4K41A 5BN8A 1H1VA 2PAVA 3R6MA 3G25A 1QHAA 4WQ4A 1QQNA 1ATSA 1TYQB 4H0XB 3DJCA 4JNEA 3VESA 4J8FA 5ADXH 2QXLA 3KHYA 3P4IA 3QDKA 1NGBA 3A5LC 3KZBA 2QWLA 4H0OA 4PKGA 1IG8A 5F0XA 4CJ7A 2D1KA 3UKRA 4JD2A 2VWBA 2QWPA 4Y0WA 3ZX3A 1HLUA 1NGJA 2A41A 4BRMA 5F2RA 3ZEUA 1K8KA 1NGDA 2QM1A 4WYBA 3VF2A 4IZ9A 5F1XA 3H45C 4K25A 1QQOA 2GUPA 3TU5A 3VEOA 5AZJB 1MWKA 2W40A 4F9OA 3D2EA 4JHDB 3DXMA 4GNIA 4H5NA 4H0PA 4BR2A 3MDQA 1DGKN 4IJAA 3MCPA 1GLFO 3SMPA 2GWKA 4RWTA 1KAZA 1IJJA 3IMXA 3FGUA 2VCPA 1HKGA 4CZIA 3WQUA 5AFUA 5AQPA 2E2QA 3BUZB 2FSJA 1V4TA 4BR4A 3LDNA 1BG3A 1U2VB 3H46O 2V7YA 4EIAA 4H0YB 4WQ5C 3GOIA 4BRGA 4QS8A 1XUPO 3FE1A 5AQUA 5AQXA 4Z94A 1JCEA 1KAXA 4QS7A 1JCFA 4XH4A 3ENOA 4EAHD 2NZTA 2BUPA 4B1WB 2Q2RA 2YJFA 2UYTA 4XEIA 1MDUB 3QBWA 5ELZA 4BQZA 1KAYA 1D4XA 1NMDA 3RSEA 5E26A 1GLJO 4FWMA 3O8MA 1Q18A 3I33A 4EHTA 3H6EA 3ZX2A 4BR5A 4B1UB 3U8XA 3HM8A 3QFUA 3CJAA 3FFKB 1GLAG 4JAXA 4BVOA 4MLHA 3W3DA 1OKJA 3VGMA 3GG4A 4BRLA 3HSCA 1MA9B 1HUXA 5AFUH 2YI1A 4H03B 2E2PA 2E1YA 2IVPA 3L6QA 2P9UA 3EKSA 1R59O 4BRAA 4RTFD 4L3QA 1LCUA 2F9TA 2ITMA 4BRIA 5KPZA 2P9NA 1SZ2A 4LC9B 1QQMA 3FZMA 2ZGZA 5AZIB 2QWOA 5ADXA 5LJWA 5EVZA 3H3NO 4BRPA 3LM2A 2P9PA 5BREA 5B8HA 4K43A 1YXQA 3CJ1A 5EY4A 2A40A 2ASPA 2Q1NA 3I8BA 2QWMA 2NLXA 1HPMA 2Q97A 4E1JA 3DXKA 3CHWA 5FPDA 2P9KA 4FWPA 4A62A 1GLBG 4M7YA 2I7NA 2P9SA 3GE1A 2P9PB 4FWRA 3O5BA 3EO3A 4HWIA 4M7XA 4H5WA 5EOYA 1T6DA 1JCGA 3WXJA 4AM6A 1NGIA 2FSNA 4BREA 5AQLA 2YHYA 2P9KB 1RGIA 3R8EA 1WOQA 2KHOA 4QS9A 3VEXA 2H3GX 4XH5A 4CZFA 3CJ9A 1X3MA 5BR9A 4BC2A 3DWLA 4IWVA 4NB4A 4GY2B 3WUHA 5AQNA 3VF4A 1HX1A 4BG9A 2E2OA 4BRNA 2Q0RA 5AQYA 2A6AA 1BA1A 1C0FA 1U6ZA 5KPRA 2HF4A 1YUWA 4B9QA 4CD3A 3WEEA 3QMLA 3MN9A 2DPNA 3VPZA 1SQKA 3D7EO 5KQ8A 2E8AA 3QBXA 3BF1A 3W0LA 4BRCA 2FSKA 3IDHA 1XC3A 3UKRB 4H5RA 4JD2B 5AQVA 4I6MA 1MWMA 4PKIA 1S3XA 4BROA 3QICA 2CH6A 3CETA 3C7NA 3A5MC 3ZEUB 1K8KB 4BQLA 4B1YB 3WXLA 3QB0A 4C23A 2QW9A 1NGAA 1C0GA 4BGBA 4RCHA 5AQGA 3S41A 3VEYA 5JLHA 3JXUA 3D2EB 3DXMB 5AQZA 2V7ZA 4BC3A 3ZETA 3C7NB 4BR7A 5FPMA 5JLFA 4MO5A 4FSVA 3WT0A 3H3OB 2CGJA 4B1XB 2IVNA 3MMVA 4DHYA 4K42A 2A3ZA 1Z05A 2QWRA 2D0PA 3SMSA 3ULEA 4CZHA 3D2FA 2GWJA 3M1FA 1SAZA 3CERA 3VENA 4CZGA 5AR0A 2HF3A 3A5OC 3C0BA 4A61A 1G99A 3H1QA 2ZWHA 4BRKA 3VERA 2HMPA 1ZBSA 3ULEB 1ATNA 2PBDA 1T6CA 2AP1A 1NGCA 3AY9A 3RSEB 5AQWA 1BUPA 1DEJA 4PL8A 3WXIA 4PL7A 2FF6A 2QWQA 2V51B 3MK6A 4YDUC 1TUYA 4FWNA 3UKUA 4AM7A 3VOVA 4A2AA 3FZLA 2NRHA 2Q31A 4CZMA 2F9WA 3ZX0A 3LM9A 4ISEA 3R9PA 1NGEA 3L0QA 3LDPA 2P9UB 3TPQA 3BEXA 3O4WA 3VEWA 1LOTB 3GL1A 2P9LA 3AAQA 5KPTA 2E2NA 1KXPA 3FZHA 4BR0A 2P9NB 3CJBA 2I7PA 5AQSA 3FZKA 3ATVA
chains in the Genus database with same CATH superfamily
3VTIA 3KIOA 1Q86O 2G8HA 4LFBK 3HP9A 1C0MA 1M90O 3ZSOA 2KTQA 4CEEA 4OO1J 2E1ZA 4CFBA 1ZBLA 3QEWA 3WNHA 1ITGA 4CJWA 1WB9A 5AJ3K 2ZD1A 1X9WA 3E7UX 3NH1A 3EZWA 5GAGP 4CCHA 4BG8A 5AQTA 2J4RA 5AQKA 1SS6A 3AVIA 1TKXA 3O3GA 2YNIA 4IXCA 3VEVA 4Z0UA 3A2FA 1P8ZA 3AVBA 3ZSRA 3O08A 4CGFA 4YHHK 3TTFA 4FJ9A 4DQRA 2ZGYA 4K0KK 4CZJA 3TAGA 1JLGA 1CZBA 4JK7A 4YOWA 1NJYA 1S6QA 4QOZB 4DTPA 1JLCA 3PX4A 1S9EA 3IUCA 4CD1A 4E1MA 4E89A 1EQYA 3OS2A 1X9MA 3K5MA 5FPEA 2V52B 4LF4K 3T1AA 5AQOA 1XHXA 3RR8A 4Z4FA 1ZC6A 4BR9A 5GADP 3MEGA 4FM0A 1T03A 4DTRA 4FOEA 2UU9K 3BGRA 4KBOA 4DSFA 4FZXC 3LDQA 1HPZA 4PKHA 1SKWA 2LJMA 3A5NC 4FWLA 4KFBA 2YHWA 4FJIA 1R0AA 1ZFUA 4CF9A 3EKUA 3M3ZA 3VQEA 1K73O 4HUGA 3OW2M 4FWSA 1YTAA 3ZETB 4H0VB 5BPLA 2FLOA 1J9AA 1RT6A 5KQDA 5J1EA 1WWNA 4FL9A 4XH1A 2FF3B 3SK3A 1Q81O 1K6YA 2ZM6K 3CFRA 3AVNA 2IIRA 5M1PA 1DQ7A 5AQHA 2OYQA 3KHWA 1BQNA 3O80A 4E7KA 1VQ5N 5LMNK 4GV3A 5FLXO 4FPAA 4OGCA 2G8KA 4QCLA 3BF3A 1GLCG 2D0OA 3MWPA 4LSLA 3QEIA 3CJ7A 5GAHP 3J8AA 1IH7A 2C1GA 1RTJA 1ESVA 5AZIA 4CBWA 1UA1A 4NO7A 1TVRA 3NGZA 3SF4D 1Z6RA 1ICAA 1YAGA 4IDHA 4CVNE 1NOYA 1RDDA 3UB5A 4DG1A 4DV3K 4CEZA 3V4IA 1JLQA 1TL1A 3O4QA 2GELA 1EX4A 1X3NA 5HBMA 3PLAA 4Y1DA 3FZFA 1LAVA 3ID8A 1SEGA 3L56A 2NY9X 3CQYA 5FPNA 5C2FA 4CI6A 4ZHRA 3J7ZO 1VQMN 3DAWA 3MN6A 4M63C 1VQKN 3T3FA 3LDLA 4HTLA 4IOCL 1NK8A 2GMOA 1BA0A 2F8TA 2BTFA 4K41A 4DTJA 1I2UA 4FJ5A 5BN8A 2PAVA 4BACA 3G25A 1QHAA 3B6OA 3RTVA 4WQ4A 1ASWA 1KVBA 1BCMA 4H0XB 1N5YA 4JNEA 4C8MA 3Q7BA 4GV9A 2X6SA 5ADXH 1QVFM 2K35A 1VSJA 1NGBA 4JKGB 4KH4A 1NKCA 4FLZA 2D5RA 5F0XA 2NY8X 2IC3A 1OH7A 2VWBA 4YY3K 3OYCA 1WMTA 2R7YA 4FLWA 2QM1A 1IV0A 5M1KA 5F1XA 2P1JA 2GUPA 3VEOA 4CHPA 4W5OA 2ZJQL 5AZJB 1I6FA 2W40A 4DV4K 4ILHA 4JHDB 3DXMA 4KHYA 5CZ2A 1UGLA 1C1BA 4A5BA 1A5VA 3SMPA 3OYJA 2B6AA 1KAZA 3PIPL 3ZT3A 3NGIA 3IMXA 1GPSA 2VCPA 5FDLA 1HKGA 4CZIA 1I2VA 3WQUA 4PWDA 2ITGA 4PA1A 3IKMA 3AO1A 4BR4A 1WLJA 3KD5E 3LDNA 3CG7A 4I2PA 1U2VB 4M3ZA 2VWJA 4EIAA 1J5EK 4H0YB 5HRNA 5CYQA 4BRGA 2VGMA 4M3YA 5T7BA 1A5XA 4ID5A 3TAPA 3CCEN 1TI5A 1VSIA 1D9FA 1WN7A 4EAHD 4ELVA 1IBMK 2O8DA 4B1WB 3O3FA 4BQZA 1MDUB 5ELZA 4DV5K 4CJVA 4NLCA 1NMDA 1RBRA 1RTIA 3RSEA 1FJGK 3ZSYA 1L3VA 1Q18A 3I33A 3H6EA 1JL1A 1KD1O 5M1FA 1BQMA 4NXNK 4WE1A 5C10A 3V6DA 3DLKA 4BRLA 4JI4K 3PSMA 1HUXA 2AJQA 2IVPA 1JL2A 3PIOL 1RT4A 2HB5A 4H4MA 3QLHA 4AF1A 4IEIA 2BH1A 1LCUA 4BRIA 2P9NA 1IO2A 1GOCA 1HNZK 5C24A 3KP1A 2UXDK 3L2VA 3SUOA 3HYFA 2QWOA 4PQUA 4YOUA 5LJWA 5EVZA 3KK1A 2P9PA 4DV6K 1KFDA 4K43A 4DSLA 4YOTA 2X6NA 2ASPA 4CE9A 3VQBA 1K8AO 3LZJA 2LN8A 2E3FA 4BY9C 4BDPA 2P9KA 3BY5A 1XMOK 4HCCA 2I7NA 5J2QA 2P9SA 3RRHA 1RILA 3GE1A 2P9PB 3O5BA 2QTDA 4HWIA 2RHKA 4H5WA 3V81A 3NHGA 3TSUA 5EOYA 4BDYA 1U47A 1HJRA 1XRSB 5C12A 2FSNA 1QSYA 1J53A 4BREA 3ID6A 1LW2A 2P9KB 1WOQA 2KHOA 4HUEA 1X3MA 5BR9A 1Q7YO 4IWVA 4NB4A 4R5PA 3LPTA 3WUHA 3NMUA 2XY7A 1KVCA 2QEXN 3M8QA 3IRXA 5I42A 3HPOA 1IKYA 3K5NA 3MAQA 1C0FA 1U6ZA 5KPRA 3SYZA 3O9UA 4AAZA 1KTQA 3SQ4A 1HNVA 3D45A 4YNQA 5LMUK 3C65A 5MLCQ 1SQKA 4V1DC 4BE1A 2JDQD 3D7EO 4JK9A 2E8AA 1WSJA 1S1UA 3BF1A 1KVAA 1JXBA 3NBPA 4E7LA 1T8EA 4NXMK 2Z1JA 1XC3A 3UKRB 5H1SQ 3KWIA 4FJJA 1MWMA 4PKIA 2O8EB 2CH6A 3CETA 3A5MC 2PYLA 1K8KB 3K2PA 4BQLA 1VNBA 4KHPK 5M1NA 4UAFE 4RCHA 5AQGA 3S41A 3VEYA 5JLHA 1T7AA 2YHBA 2Z1GA 2QI2A 3JXUA 4KHSA 1TV6A 4FCYA 2ZJRL 2V7ZA 4BC3A 4FSVA 1NJXA 4CW7B 4YOVA 3OS1A 3CC2N 4RW8A 2F7TA 4FLVA 1W9HA 3NH2A 4CZHA 2Y1JA 1SAZA 4Z4CA 4DV2K 5AR0A 3KD1E 3A5OC 1WSGA 1GPTA 5HOOA 2W6KA 3KLEA 5J2MA 2KW4A 4BRKA 2HMPA 2O8BA 4B9SA 2PBDA 2HHSA 4FJMA 3ZSXA 1OVQA 2GV9A 1O13A 1BUPA 1RCHA 4E3SA 3WXIA 4PL7A 4DFJA 3T69A 1VQ9N 3MK6A 3U3YA 2RN2A 1U04A 3AVJA 4AM7A 2YNGA 1JLBA 4JKEA 4QAGA 5HP1A 4DSKA 2O8BB 3DRSA 2Q31A 4DR6K 4CZMA 1S1TA 1HNWK 4B9UA 3LM9A 4N5SA 3R9PA 3L0QA 3SAFA 2O8FA 2OPRA 4HTUA 3TPQA 4R79A 3VEWA 1FKPA 1ASVA 3GL1A 1Q82O 2OZSA 2P9LA 3TWHA 4KKOA 3FZHA 1OH5A 1HYZA 3ATVA 4X65K 2F4VK 2PYJA 1Q8IA 1X1PA 4OPAA 2OANA 2O8FB 2UUBK 4FYDA 4BRQA 4CJUA 1BIZA 4FOIA 4KI4A 3BP8A 1BDGA 2E2FA 5GAEP 4UJ0A 4LFCK 3LL3A 1KFSA 4DQIA 1N32K 1HQUA 3EN9A 1QSLA 3KVGA 4FPBA 2E20A 2PFUA 4M41A 4OJRA 1LV5A 3CQXA 4RW9A 4BGAA 4B9MA 3NH0A 4KB0A 1ZBHA 1TYQA 3HZ6A 4B1VA 1IKXA 4FJNA 2LSNA 4CFAA 2HBKA 2BE2A 1W97L 4JI7K 1BI4A 3NVKA 2BANA 2XRIA 3LAKA 2GEMA 1D9DA 3SCXA 3EZ5A 3AGKA 4NCAA 3SI6A 4Y1CA 1BK8A 4DQ8A 1KRPA 1HQEA 3HI0A 4DSIA 3DM2A 1JXEA 1TKZA 3WEEB 2ASMA 1NM1A 3V9XA 4H4OA 4IDKA 1SNBA 1KLNA 4FWOA 2KYQA 4IO9L 3MEEA 1T7BA 3RWUA 1OMYA 1HKCA 4JN4A 3TAMA 1RT1A 1DTTA 3DLGA 1NPIA 2W00A 4GMJB 4HVJA 3LP1A 2W6LA 4G1QA 4MO4A 2E88A 4DTOA 4BRFA 1PX9A 2XY6A 1VQNN 1S22A 1YJWN 3I56N 2RPIA 2FXUA 1BISA 4XIUA 3EL2A 4PY5A 3MCAB 4LSNA 1SL2A 3AARA 1IKVA 4DS5A 3C6AA 2IVOA 3ENHA 1VRUA 2D4WA 4DF8A 4DR4K 3D2FB 3OHRA 5TKYA 4IJNA 3M8SA 3CI5A 1B9FA 3E9OA 3JS6A 4JRQA 3RR7A 3B6PA 5IT9O 3CF5L 4AEIA 3SJJA 3THWA 1CZ9A 4KTQA 4MDBA 5HRPA 3MXIA 1ZVEA 1E4GT 1S6PA 1NK5A 3CQ8A 3GDQA 1ZBIA 3E1YA 4CJKA 1NGGA 3UIQA 4H5VA 3KLHA 3AVLA 3UKUB 4BC5A 2OTJN 1NK4A 2O8CA 1HJOA 3SUNA 3EYZA 2LY6A 1ZVGA 3M8RA 2LJ7A 4CHQA 4IG0A 2KQ2A 3ASMA 1K9MO 4HUFA 3I0SA 1NGHA 1HKBA 3CPWM 4H5TA 5LJVA 3OYFA 3TI0A 1Y64A 4CIGA 3NF7A 5BRDA 4DB3A 1HYSA 3MN5A 4YFUA 1RT5A 5CE3A 4BC4A 3OA9A 2P51A 2UXCK 3MWTA 5AQIA 1ASUA 3KK7A 3PX0A 3CCLN 4GV6A 5JICA 1RBVA 5LY3A 3AVMA 2HBMA 3CXCM 4A2BA 3ZSVA 4ILGB 2G8WA 4KHQA 3L4IA 3VF6A 3CC4N 2KZMA 4KHUA 4IO8A 5HLFA 4DU3A 5A2QO 3R6MA 5JENA 2B5JA 3K59A 2YEOA 4B9VA 3AA4A 4ELUA 4DLGA 1VSHA 3DJCA 3O3HA 3CYMA 3R3LA 4AHTA 1EKEA 1VQ6N 3BZCA 2QXLA 3KHYA 1BMRA 3C95A 2HMIA 4PKGA 3SQ1A 1YVUA 3ZSWA 4CJ7A 1WAJA 4G9ZA 4BWJA 4WFAL 2NRXA 1KC8O 4GW6A 4DTNA 1AYJA 3QERA 1LQQA 3ZEUA 4Z4GA 1NGDA 3VF2A 3I55N 4IZ9A 1NRAA 4IG3A 5C0YA 1ZYVA 3EY1A 3V9WA 3NFAA 1MWKA 3KWGA 4F9OA 4CEQA 4CHZA 4L8RB 1B92A 3ZT1A 4BR2A 3MDQA 1CLQA 3CCMN 4WFNL 4Z4IA 1NKBA 1GLFO 2GWKA 5JS2A 4J2AA 3C94A 3AA2A 3L4QA 3F73A 3BUZB 2E2QA 2FSJA 2Q3SA 3OYEA 4BE2A 3M8PA 4CJFA 4N56A 1U45A 4KH5A 3H46O 2VQFK 4J2EA 4QS8A 3WNEA 1SL0A 1VSLA 3D0PA 3VQ6A 5AQUA 3KTQA 4AHRA 3MX5A 4Z94A 1KAXA 4AILC 2NRWA 4XH4A 3ENOA 2O4GA 4CEAA 3G4SN 3VQ7A 2Q2RA 3ENBA 2G8UA 4XEIA 4O0JA 1KAYA 1I3AA 2YKNA 1GLJO 2ATBA 1XNRK 3O8MA 4JI5K 4BR5A 3QIPA 4B1UB 3U8XA 3KK3A 4JAXA 4BVOA 2NUBA 3TR8A 5KRTA 3NCIA 3HSCA 1Q9XA 4FK2A 5DM7L 1MA9B 3E9PA 5AFUH 4B3SK 3ZYYX 3IG1A 2E1YA 4HCBA 1JLFA 4BRAA 4L3QA 2QKKA 2VGNA 1W0HA 2ITMA 4KYPA 2YC1C 1CXQA 3HVTA 3JYTA 1SZ2A 2OA8A 4LF9K 4CFCA 1QQMA 4CF2A 3L8BA 5JVHL 3FZMA 2ZGZA 1JXCA 3LP2A 5AZIB 4K8ZA 3PSIA 4F4KA 4PUOA 5KGXA 5EY4A 1VSDA 4W5RA 3I8BA 4DUZK 4DV1K 3NF8A 2Q97A 1B7DA 3DXKA 1LQHA 4JRPA 2RF2A 1FW6A 4H8KA 2D56A 4LF5K 1JKZA 3Q7CA 3CW4A 4M7XA 1LWFA 3KKRA 3ULDA 1C0UA 1T6DA 5GINA 1JCGA 2D0CA 2GX9A 3PV8A 2B4JA 3OYIA 1HMVA 2QXFA 4FLXA 4M45A 3O4NA 1U48A 1L3UA 4CZFA 2VY6A 2OTLN 3CM5A 3PUFA 5M1OA 1OH6A 3AO3A 4DQSA 4I7FA 4GY2B 5AQNA 3K9JA 4AQYK 2HHUA 5D3GA 4MDAA 3QEVA 2Q0RA 3L2WA 3HXMA 4N41A 2A6AA 1BA1A 4IOAL 4CHYA 3THVA 3MECA 4CD3A 2DPNA 2KBJA 3SQ2A 4V19S 3V9SA 5KQ8A 3W0LA 2FSKA 2D0AA 5EU7A 3IDHA 4I6MA 3HOTA 4B8CA 4BE0A 3QICA 1MYNA 1VAZA 5J2PA 3KOYA 2HHTA 1S72N 1C0GA 1NGAA 1EETA 2EHGA 2LY5A 3L2RA 4DTMA 3V1RA 4YOXA 3OYGA 3RMAA 2ATQA 2EX3A 3DXMB 5SWMA 2JWKA 2WTUA 1HRHA 3OBWA 4FZZA 5KRSA 4IEEA 4B1XB 4DR7K 3MMVA 4O0IA 3P5JA 3TARA 1GOAA 2D0BA 3T1YK 3L3VA 1M1KO 4LY7A 3QNNA 1Z05A 2QWRA 1L3SA 3ULEA 1YTUA 5TKWA 1RDAA 1CHZA 1XC9A 2DFEA 3K9KA 2N2QA 1JLAA 1FKOA 3CERA 5GIPA 4KREA 4ID1A 3LP0A 3C0BA 3QIOA 3L2QA 4A61A 1YF5L 4GKJK 3VQ4A 3VERA 3GKUA 3ULEB 2O8DB 1ATNA 2BDPA 4E7JA 4EP5A 1ZBFA 3RSEB 5C25A 4PL8A 2FF6A 4JS4A 2QWQA 2V51B 4N47A 2FBTA 3ZSZA 4YDUC 2GUIA 4NLBA 4BDZA 1FXXA 3VOVA 4X64K 3SZ2A 3KLIA 3MX2A 2F9WA 3ZX0A 5IWAK 3AV9A 4I9QA 2IGIA 1RT3A 4CK1A 5FRMA 3O4WA 1S5JA 1TK5A 1LOTB 3AAQA 4FW1A 4DV7K 1NKEA 1REVA 2P9NB 3CJBA 2I7PA 5AQSA 4ILJA 1TK8A 1KV0A 3KC6A 2GL1A 4X66K 4CK3A 3GBTA 3F9KA 4ISGA 1Z26A 3I8DA 3VGKA 1J5OA 1D5AA 4F3OA 1QS4A 1OVYA 5KI6A 3LZIA 2YJEA 3SBTA 2VYPA 4B8AB 1GLDG 4CJSA 1WSFA 3SJHA 4NCGA 1X9SA 1W2BM 2GTDA 4EHUA 5LL6Z 1GLEG 3ZT2A 3CYGA 1T1TA 2P9SB 1BRZA 1DLOA 2YCHA 5BN9A 4CJ5A 1QSSA 3CD6N 1JJ2M 2OPPA 1B3CA 3ALYA 3DLEA 3ZSQA 4KHNA 2DY4A 3ATUA 3THXA 3E66A 2JLEA 4FLUA 1HNIA 1C1AA 4DTSA 2EWSA 4DU4A 2DFHA 4B08A 3CCQN 3QO9A 5M1QA 2YHAA 3DLRA 5BRHA 4CJLA 3IFRA 4GKKK 1X9JA 4LF7K 3VGLA 5KK4A 2WOMA 4FXDA 5JMVA 2HVIA 1E4FT 1SKSA 2LT8A 3KKSA 1PTXA 3HBTA 2B68A 2A7TA 4C8LA 2HNYA 3VEZA 4BRHA 1ILYA 3F5TA 2KPYA 4AHUA 5BPNA 4CHOA 1QZ6A 1POIA 3PO4A 4FJHA 3M6GA 2NNWA 5CR4A 2BRZA 5AQJA 1C55A 4KI6A 1SUQA 4CJTA 3UE5A 3WNGA 2YNHA 3SPYA 1V4SA 3OTOK 3DRPA 3J7AP 4BECA 1HYVA 3C6UA 2E3GA 3O6WA 3U4LA 4NYNA 4DR5K 1NK9A 2Q0UA 4B1ZA 1QZ5A 4H0TB 2Z1HA 3VN5A 4DR3K 3S5TA 2YX6A 1YIJN 4CZKA 1NJZA 5C2DA 3N4QA 3U9DA 3B8AX 4DTUA 2FBXA 4KTZA 1T0ZA 1VK0A 2LI7A 3KOWA 3SLCA 4ELTA 1BWFO 3VETA 2G8VA 2F8SA 3OYNA 4CF0A 5EXWA 4MLEA 2FC0A 2IDOA 2WONA 4LFAK 4CGDA 2HHQA 3KLGA 5AQRA 4FWKA 5AQMA 1ZXOA 2HNDA 2Y1IA 1C56A 2A1RA 3QESA 2ZJPL 1VSMA 5HROA 3NE6A 4KO0A 4J2BA 3SBGA 2W41A 2NRZA 4M42A 4E19A 2N69A 3LWMA 2HW3A 3QEXA 4UADE 3QFPA 1NWKA 2HNZA 4CGHA 4YOYA 4C1NK 1WBBA 1QHTA 4MQ3A 3S3MA 4DTXA 2P9LB 2UUCK 4WQ5A 4IFVA 4BEBA 3VQ9A 3C6HA 3V9ZA 2QK9A 4DSEA 1DKGD 2OPQA 1LW0A 4CBXA 4CF8A 2KJAA 5AQFA 3VQ8A 5DMRA 1QTMA 2QWNA 3O1BA 3OVNA 4FVUA 4FLTA 2AA4A 3V1QA 1EXQA 4FO0A 3AO5A 3CCUN 5HL7L 1XWLA 2ZF5O 1JLEA 4BVPA 5HRSA 1NOZA 4OPJA 3A8YA 1N36K 3QINA 4I9LA 3ZCMA 3SPZA 4OX9K 1HNXK 1H1VA 4F3TA 4O5BA 2KFNA 2ASCA 2KKZA 4A59A 1ZU3A 1VQ7N 3CCSN 3MEDA 1NK7A 4FJ7A 1P00A 1QQNA 3QI7A 1ZUTA 1TYQB 1NNEA 1DTQA 4F8RA 2QA4N 2HHVA 4J8FA 2RKIA 3CCVN 3KZBA 1BI4B 2X78A 4O4GA 2G2KA 2D1KA 4JD2A 4CF1A 2QWPA 4DU1A 1IKWA 3ZX3A 1HLUA 2A41A 5JVGL 3U6FA 4HE7A 3HP6A 3AVFA 3CFPA 4M3RA 3VTHA 4KHWA 3TU5A 2UUAK 3EE8A 3D2EA 4GNIA 1P0AA 4H5NA 1VSKA 1DGKN 4OVLA 4IJAA 5SZTA 3OS0A 3LWLA 2IOCA 2WBNA 4UQGA 4F2SA 4IKFA 1YITN 3HVRA 4DLEA 4JK8A 1RDBA 4IFEA 3DRRA 4WQ5C 3V1OA 1XUPO 5AQXA 4LH4A 1CN2A 4JKAA 1EWRA 5DM6L 4CEFA 1JCFA 4C8KA 2KGQA 2NZTA 5KTQA 4C8OA 4FLYA 4OPHA 2YJFA 2UYTA 3QBWA 3OYDA 1N34K 3L3UA 1D4XA 1VSFA 2E6MA 3NVMA 3IS9A 5E26A 4YORA 1W7AA 4CGJA 4LF6K 1EO1A 3ZX2A 3F2KA 1VSEA 3LP3A 3FFKB 3NF6A 1GLAG 3K5LA 1WSHA 1N8RO 3W3DA 3HPHA 3LALA 1RBSA 5I3UA 3G0ZA 1RT2A 2YI1A 4H03B 1XHZA 3L6QA 2P9UA 3EKSA 3OYAA 3THWB 3LPUA 1R59O 4E0DA 4RTFD 4B9LA 3J81O 4FJLA 3AO4A 5KPZA 4LC9B 3ZT0A 4UAEF 4CEOA 4A57A 4ZTFA 3H3NO 2F96A 4JI3K 1VQPN 5B8HA 4IOXA 4CERA 1YXQA 4M3WA 2O8CB 3CJ1A 4JKCA 2A40A 1HR0K 1GOBA 3E01A 1WNSA 2QWMA 1KLMA 2NLXA 4DQQA 3ISNC 3CHWA 5FPDA 1SKRA 4FWPA 2RE2A 4M7YA 1BIUA 4FM2A 2E0HA 4FWRA 5DK5A 2B3CA 4CJ4A 3TTCA 1NK6A 2VG7A 1ZYWA 4O55A 3S9HA 3PSFA 4AM6A 1NGIA 4FJXA 2HVHA 5AQLA 2HHHK 4DMNA 3AO2A 3R8EA 4IBNA 5BR8K 4BC2A 2HHWA 3KJVA 1UAXA 1C0TA 3TANA 1HX1A 3HT3A 1TK0A 3G71N 1C6VA 1B9DA 1JZBA 3DOKA 4RW4A 5AQYA 1J54A 3QNOA 3CPEA 4FJGA 3CC7N 3MXMA 1YUWA 4B9QA 5E41A 3DLLL 3MN9A 2HHIA 3EEQA 1U4BA 3VA3A 2WC9A 4JI8K 4OKJA 3J80O 3ZT4A 1N33K 4BRCA 2ZE2A 1WBDA 2VG6A 1PE4A 4H5RA 1LWEA 1WT7A 5AQVA 1WAFA 4C8NA 4U67L 5FRNA 4BROA 2BGGA 3C7NA 4HHTA 4GVMA 3ZEUB 3P31A 1OZZA 3WXLA 3TAQA 5CHIA 1QVGM 4C23A 2YIPA 4M3XA 4JI6K 2N2RA 3SV3A 1KSPA 2DTUA 1NE5A 4BGBA 2OPSA 4KB1A 1MR4A 1FK9A 5AQZA 3ZETA 3C7NB 4AHSA 4BR7A 2KFZA 4MO5A 3P83D 4CJEA 1TKTA 3WT0A 4CIEA 3H3OB 1Q9YA 4FJKA 2IVNA 4BE7B 2A3ZA 1XMQK 3KOZA 2C1IA 2GWJA 3M1FA 4DS4A 3C6TA 4FZYA 4CZGA 3RMBA 2VG5A 2HF3A 2W42A 1DT9A 3H1QA 4CESA 3K0SA 1ZBSA 3D6RA 2NRVA 3SAHA 3RVCA 1T6CA 3AY9A 1XI1A 5AQWA 1XNQK 1DEJA 2QKBA 3AVAA 4E7IA 1TUYA 4FWNA 3I0RA 4DR1K 1RTHA 3KLFA 4B3MK 2NRHA 4OGEA 1EWQA 4ISEA 3CMAN 4EP4A 4CFDA 1NGEA 3AA3A 4JKBA 1K8BA 3BEXA 3ITHA 5JS1A 4O44A 4FVMA 2E2NA 1LAWA 4DFPA 5EX5A 1RFQA 5CYMA 2YKMA 2CGKA 4FWQA 4LF8K 1T44A 1VHXA 3U3GA 3LDOA 1YVNA 1GLLO 1BO5O 3BDPA 5AQQA 1S1XA 2N66A 1RDWX 3DXKB 4CZLA 3HSTB 1YHQN 2NRRA 1TUUA 1NGFA 1BL3A 4AHCA 3AVKA 4ISFA 2G8FA 2LKBA 3KOXA 5J2NA 4FJ8A 3HM9A 3TSPA 3O9RA 4BRDA 2PZSA 4YDUA 3SUQA 1JKHA 1VRTA 1DJTA 1NMNA 3WQTA 4JKGA 2CH5A 5CY4A 2SN3A 3WXKA 4CK2A 3TABA 3LAMA 1J6ZA 4WF9L 4HHFA 3O1WA 1E3MA 4FK4A 2XY5A 1BOTO 3MN7A 4JV5K 4DF4A 4PHTX 1ZYQA 5HRRA 5AZJA 4KAZA 2FBVA 2ETJA 3FFIA 3OYHA 1NK0A 4JHDA 2I5JA 1NJIO 4JKDA 4NYFA 2GBZA 1RBUA 2YNFA 1OH8A 2YIOA 4I6MB 4A5AA 4B3TK 1S9GA 1Y97A 3RRGA 4CJRA 1U2VA 1UOCA 4EFHA 2LR3A 2Q36A 3T19A 3OBYA 2G8IA 3O9SA 4BWMA 3HTVA 4CBUA 4CEDA 3AA5X 4CHNA 3H1VX 3AVGA 1C1CA 1BU6O 4GVEA 3A0IX 3G6EN 1SV5A 3OYLA 4Z4HA 3FLCO 4XJXA 3O9TA 3R1XA 3VQPA 4CJPA 1YT3A 1UWBA 4O5FA 2YHXA 3EE9A 2KLAA 1P90A 4DQPA 4I2QA 5CZ1A 2M8BB 1RNHA 3DLBA 5E84A 1NLVA 4J2DA 1TGOA 2YILA 4JI0K 4CQKA 4O8KA 1NU0A 2HOEA 3OYBA 2VQEK 2HBJA 2E5LK 1S1WA 3VMFB 1O1WA 4FW2A 4B9NA 4O8UA 1NH5A 4FM1A 3PY8A 1LWCA 3HOSA 3OJSA 4WQ4C 5C42A 3O9QA 4ZTJA 2CGLA 2A42A 4RG8A 1SN4A 4CZEA 1N4NA 3TAEA 2P9IA 1T7EA 2ASOA 3S3OA 3VQCA 4Z4EA 3CIPA 2A5XA 1RTDA 1NBWA 4EZ9A 3AAPA 3F9MA 4DCHA 3DLHA 5KGWA 3DYAA 5GIOA 1T05A 3CJCA 1WUAA 4JKHA 4TSXA 1WSEA 3U9ZA 4DFKA 2P9IB 1L3TA 4W5NA 1CZAN 3WXMB 3WNFA 2WUSA 4Q5VA 4OLBA 4AHVA 2XO7A 2P5OA 3OJUA 3VQDA 5I9EB 3E7RL 1A5WA 2KSKA 4E1NA 4CGGA 1XQSC 1ATRA 3FR0A 5BPMA 3S3NA 5BRFA 2WFBA 3PX6A 4JKFA 4JI1K 4UY8O 3VQQA 1KQSM 2FBYA 3CCRN 1I94K 2KBHA 2KBKA 2YV0X 1ATSA 4JYAK 1JZAA 2DFFA 3THXB 4CIFA 3VESA 3BK3C 1L5UA 3VQ5A 3P4IA 3QDKA 3A5LC 4DSJA 2QWLA 4H0OA 4JI2K 1IG8A 3UKRA 3THYA 3T1HK 4RW7A 4Y0WA 2O8EA 1NGJA 1Z25A 4BRMA 5F2RA 3P39A 1K8KA 5K14A 1YJNN 4WYBA 1FH3A 2HBLA 1RDCA 3H45C 4K25A 4DV0K 1QQOA 3L2UA 2O4IA 3G10A 4E7HA 3SUPA 3N4PA 4KH6A 4DKWA 2JWLA 3THYB 4IFYA 4B9TA 4H0PA 2UXBK 5CY0A 3MCPA 3NF9A 4RWTA 2XHBA 4B3RK 2KZZA 1IJJA 1YJ9N 3CM6A 2IAJA 2VWKA 1TKDA 3FGUA 4EZ6A 3TSQA 3AGRA 5AFUA 5AQPA 1V4TA 3KP0A 5C15A 1BG3A 3K5OA 4JLHA 2V7YA 3RMDA 3DMJA 3GOIA 4M3UA 3MXJA 3TTDA 4CGIA 3FE1A 1JCEA 4QS7A 1NJWA 1LQIA 1BCGA 2BUPA 3P38A 4K8XA 5FROA 1EP4A 4DUYK 4F2RA 3M5RA 1QE1A 4FWMA 4EHTA 1VQ8N 3HM8A 3QFUA 3CJAA 1RDUA 2HSTA 4MLHA 1OKJA 3VGMA 3GG4A 1VQLN 3R2VA 3ZLJA 4AH9A 1UA0A 3SNNA 2A1SA 4DR2K 2E2PA 1QQCA 3AVHA 3SV4A 1BCOA 1RT7A 2E6LA 2F9TA 4OPKA 2NRTA 2YBRC 4C1NI 5ADXA 2P5GA 4BRPA 3LM2A 5BREA 1N6QA 1VQ4N 4MFBA 2Q1NA 1CXUA 1HPMA 4E1JA 2MBKA 4A62A 4CJQA 1GLBG 3NAEA 1ZBUA 1F21A 3EO3A 1AHOA 1BHLA 2OCEA 3JAMO 4DWIA 3WXJA 3TAFA 1VQON 3K57A 3LDSA 2YHYA 1BGXT 1D8YA 1RGIA 1KCFA 4QS9A 3VEXA 2H3GX 4XH5A 1NRBA 3P1GA 3NDKA 3CJ9A 2JGUA 3HK2A 3JSMA 3DWLA 3HL8A 1I6GA 4FK0A 2MN5A 4E72A 3VF4A 4BG9A 3SQ0A 4ICLA 1IBLK 3PO5A 2E2OA 4BRNA 1SL1A 3BZKA 1NG9A 1MU2A 3SAGA 4LD0A 2HF4A 3WEEA 3QMLA 4OLAA 3VPZA 2OZMA 3E9LA 3OY9A 3QBXA 3CCJN 4U7BA 3DI6A 4Q0BA 4JD2B 4AB0A 1S3XA 4OKEA 1IG9A 2XY8A 2E4LA 4NCBA 1SN1A 1T3VA 1U49A 1IBKK 4B1YB 1TAQA 3HPGA 2IS3A 3HJFA 3QB0A 4JEPA 2QW9A 3VA0A 3DOLA 3D2EB 2ZQBA 4N76A 4OKKA 3NGYA 4KRFA 3VQAA 5FPMA 5JLFA 2I61A 2CGJA 1YI2N 4LH5A 4DHYA 4K42A 3RMCA 2D0PA 3SMSA 3D2FA 4CJ3A 1L4VA 2HHXA 1I39A 3VENA 3T7ZA 2MZ0A 4X62K 3HRGA 2X74A 4RW6A 1G99A 1RBTA 2ZWHA 3CMEN 4WFBL 1TAUA 3CFOA 2PY5A 1S1VA 3QEPA 3OYMA 4KV8A 4CEBA 2AP1A 3HO1A 1NGCA 4B3OA 3K58A 3V9UA 1WSIA 3LANA 4DFMA 4W5QA 3J7YP 4WCEL 3UKUA 3KK2A 4A2AA 3FZLA 2Z1IA 3OYKA 3QETA 4CECA 4KPYA 1VNAA 3LDPA 2P9UB 3AVCA 3IAYA 1G15A 3H08A 4KTWA 5KPTA 1KXPA 4BR0A 4W5TA 1TL3A 4JS5A 1T7PA 3FZKA 4M3TA
chains in the Genus database with same CATH topology
5EX5A 1RFQA 3GBTA 3VTIA 2CGKA 4FWQA 4ISGA 4OPAA 1Q86O 2OANA 3VGKA 1T44A 1M90O 1OVYA 4OO1J 2E1ZA 3LDOA 4BRQA 2YJEA 3SBTA 1YVNA 2VYPA 1GLLO 1BO5O 1GLDG 4FOIA 3BP8A 5AQQA 3SJHA 1BDGA 2E2FA 3EZWA 5GAEP 5GAGP 1RDWX 2GTDA 1W2BM 3DXKB 3LL3A 4BG8A 4EHUA 5AQTA 1GLEG 2J4RA 5AQKA 4ILJA 4CZLA 1SS6A 1YHQN 2P9SB 2NRRA 2YCHA 4IXCA 5BN9A 3EN9A 3VEVA 3KVGA 1TUUA 1NGFA 4FPBA 3CD6N 2E20A 2PFUA 1P8ZA 1JJ2M 4ISFA 3CQXA 3O08A 4BGAA 3TTFA 3TSPA 3O9RA 1TYQA 3ATUA 4BRDA 3E66A 3HZ6A 4YDUA 4B1VA 2ZGYA 2HBKA 3WQTA 1W97L 4JKGA 2CH5A 2EWSA 3NVKA 4CZJA 4JK7A 3WXKA 4YOWA 2GEMA 3CCQN 5M1QA 1J6ZA 3AGKA 4WF9L 3O1WA 5BRHA 1BOTO 3IUCA 3MN7A 4CD1A 1EQYA 3IFRA 4PHTX 1X9JA 3VGLA 5FPEA 2V52B 4DQ8A 5AQOA 5JMVA 5AZJA 1ZC6A 4BR9A 3HI0A 5GADP 1E4FT 3WEEB 2ASMA 4JHDA 1NM1A 1NJIO 4FOEA 4JKDA 4KBOA 3HBTA 3LDQA 4PKHA 4FWOA 4IO9L 3VEZA 2YIOA 4I6MB 4A5AA 4BRHA 3A5NC 1ILYA 4FWLA 3F5TA 1HKCA 2YHWA 4JN4A 5BPNA 1QZ6A 1POIA 1U2VA 4EFHA 2W00A 2Q36A 4MO4A 3OBYA 3M6GA 2NNWA 3O9SA 2E88A 3HTVA 5CR4A 4CBUA 3H1VX 4BRFA 5AQJA 1BU6O 4GVEA 3A0IX 3EKUA 3G6EN 4XJXA 3M3ZA 3FLCO 1K73O 3O9TA 3R1XA 1VQNN 1S22A 3OW2M 1YJWN 3I56N 3UE5A 4O5FA 2FXUA 4FWSA 2YHXA 3EE9A 3ZETB 1V4SA 4H0VB 5BPLA 2KLAA 2FLOA 3EL2A 1P90A 5KQDA 4BECA 3MCAB 3AARA 3O6WA 3U4LA 4FL9A 4XH1A 2FF3B 3C6AA 2Q0UA 4B1ZA 2IVOA 3ENHA 3SK3A 1QZ5A 4H0TB 1Q81O 2D4WA 3D2FB 3OHRA 2YX6A 5TKYA 1YIJN 5M1PA 2IIRA 4IJNA 4CZKA 5C2DA 5AQHA 3N4QA 3CI5A 3E9OA 5E84A 3KHWA 3JS6A 1NLVA 3U9DA 3B8AX 3O80A 2YILA 4O8KA 1VQ5N 2HOEA 4GV3A 2HBJA 3CF5L 4FPAA 3SLCA 3VMFB 1BWFO 4MDBA 3VETA 3BF3A 4O8UA 1GLCG 2D0OA 3HOSA 1E4GT 3MWPA 5EXWA 3CJ7A 4MLEA 4WQ4C 3O9QA 5GAHP 3J8AA 2CGLA 3GDQA 5AQRA 2A42A 2C1GA 3E1YA 1ESVA 5AZIA 4FWKA 1NGGA 5AQMA 4CBWA 4CZEA 4NO7A 4H5VA 3SF4D 2P9IA 1Z6RA 1ZXOA 3UKUB 4BC5A 2ASOA 2ZJPL 2OTJN 1YAGA 4IDHA 1HJOA 3CIPA 2A5XA 1NBWA 3SBGA 3AAPA 3F9MA 3UB5A 2W41A 4DCHA 2NRZA 5GIOA 1K9MO 3CJCA 1NGHA 1HKBA 1WUAA 4UADE 3QFPA 4H5TA 1NWKA 2GELA 4JKHA 4C1NK 5LJVA 1Y64A 4YOYA 3CPWM 1X3NA 3U9ZA 5BRDA 4DB3A 3PLAA 3MN5A 2P9IB 2P9LB 3FZFA 1CZAN 4WQ5A 3ID8A 3L56A 5CE3A 4BEBA 3WXMB 3OA9A 3C6HA 3CQYA 4BC4A 5FPNA 1DKGD 3MWTA 5C2FA 4CI6A 5AQIA 2WUSA 4CBXA 3J7ZO 3KK7A 1VQMN 3DAWA 3MN6A 3CCLN 4GV6A 5AQFA 5JICA 5LY3A 4M63C 2HBMA 3CXCM 5I9EB 4A2BA 1VQKN 2QWNA 3LDLA 3O1BA 4HTLA 4IOCL 4FVUA 1XQSC 2GMOA 1BA0A 2AA4A 4ILGB 1ATRA 4FO0A 3CCUN 3FR0A 3L4IA 5HL7L 2BTFA 5BPMA 2ZF5O 3VF6A 3CC4N 4BVPA 5BRFA 4IO8A 3A8YA 2WFBA 4K41A 4JKFA 5BN8A 1H1VA 2PAVA 3R6MA 4UY8O 3G25A 1QHAA 2KKZA 1KQSM 4WQ4A 4A59A 1VQ7N 3CCSN 3CCRN 1QQNA 1ATSA 3QI7A 1TYQB 4H0XB 3DJCA 4JNEA 2QA4N 3R3LA 3Q7BA 4GV9A 3VESA 4J8FA 3BK3C 2K35A 5ADXH 1QVFM 1VQ6N 2QXLA 3KHYA 3P4IA 3QDKA 3CCVN 1NGBA 3A5LC 4JKGB 4KH4A 3KZBA 2QWLA 4H0OA 4PKGA 1IG8A 5F0XA 4CJ7A 2D1KA 3UKRA 4JD2A 4G9ZA 2VWBA 2QWPA 4WFAL 2NRXA 4Y0WA 1KC8O 3ZX3A 1HLUA 1NGJA 2A41A 4BRMA 5JVGL 5F2RA 3P39A 1K8KA 3ZEUA 1YJNN 1NGDA 2QM1A 4WYBA 3VF2A 3I55N 4IZ9A 2HBLA 3VTHA 5M1KA 5F1XA 3H45C 4K25A 1QQOA 2GUPA 3TU5A 3VEOA 5C0YA 2ZJQL 5AZJB 1MWKA 2W40A 3EE8A 3KWGA 3N4PA 3D2EA 4KH6A 4ILHA 2JWLA 4JHDB 3DXMA 4DKWA 4F9OA 4GNIA 4H5NA 4H0PA 4BR2A 3MDQA 1DGKN 3CCMN 4IJAA 4WFNL 3MCPA 4A5BA 1GLFO 3SMPA 2GWKA 4RWTA 1KAZA 1IJJA 1YJ9N 3PIPL 3IMXA 3FGUA 3TSQA 2VCPA 2WBNA 3AGRA 1HKGA 3L4QA 4CZIA 3WQUA 5AFUA 5AQPA 2E2QA 3BUZB 2FSJA 1YITN 3IKMA 4JK8A 1V4TA 4BR4A 4IFEA 3LDNA 5C15A 4KH5A 1BG3A 1U2VB 3H46O 2V7YA 4EIAA 4H0YB 4WQ5C 3GOIA 4BRGA 2VGMA 4QS8A 1XUPO 3TTDA 3CCEN 3FE1A 5AQUA 5AQXA 3MX5A 4Z94A 1JCEA 4JKAA 1KAXA 4QS7A 2NRWA 5DM6L 1JCFA 4XH4A 3ENOA 4EAHD 2NZTA 3G4SN 2BUPA 3P38A 4B1WB 2Q2RA 3ENBA 4OPHA 2YJFA 2UYTA 4XEIA 1MDUB 3QBWA 5ELZA 4BQZA 1KAYA 1D4XA 3M5RA 3NVMA 4NLCA 1NMDA 3RSEA 5E26A 4YORA 1GLJO 4FWMA 3O8MA 1Q18A 3I33A 4EHTA 1EO1A 3H6EA 1VQ8N 3ZX2A 3F2KA 4BR5A 5M1FA 1KD1O 4B1UB 3U8XA 3HM8A 3QFUA 3CJAA 3FFKB 1GLAG 1RDUA 4JAXA 2HSTA 4MLHA 4BVOA 3W3DA 1N8RO 1OKJA 3VGMA 5C10A 3GG4A 1VQLN 4BRLA 3R2VA 3HSCA 5DM7L 1MA9B 1HUXA 3E9PA 5AFUH 2YI1A 4H03B 3ZYYX 2E2PA 2E1YA 2IVPA 3L6QA 2P9UA 3PIOL 3EKSA 4AF1A 4IEIA 1R59O 4BRAA 4RTFD 2BH1A 4L3QA 1LCUA 2F9TA 2VGNA 2ITMA 4BRIA 5KPZA 2P9NA 2NRTA 1SZ2A 4LC9B 4UAEF 1QQMA 5JVHL 3FZMA 2ZGZA 5AZIB 2QWOA 4A57A 4C1NI 5ADXA 4YOUA 5LJWA 5EVZA 3H3NO 4BRPA 3LM2A 2P9PA 5BREA 1VQPN 5B8HA 4IOXA 1VQ4N 4K43A 1YXQA 3CJ1A 4JKCA 4YOTA 5EY4A 2A40A 2ASPA 2Q1NA 1K8AO 3I8BA 2QWMA 2NLXA 2LN8A 1HPMA 2Q97A 4E1JA 3DXKA 2MBKA 3CHWA 4BY9C 5FPDA 2P9KA 4FWPA 4A62A 2RE2A 1GLBG 4M7YA 2I7NA 2D56A 2P9SA 3GE1A 2P9PB 4FWRA 3O5BA 2QTDA 3Q7CA 3CW4A 4HWIA 2RHKA 4H5WA 3EO3A 4M7XA 3TSUA 5EOYA 3TTCA 1T6DA 5GINA 1JCGA 2GX9A 5C12A 3WXJA 4AM6A 1NGIA 1VQON 2FSNA 4BREA 5AQLA 2YHYA 3ID6A 2P9KB 1RGIA 3R8EA 1WOQA 2KHOA 4QS9A 3VEXA 2H3GX 4XH5A 2VY6A 4CZFA 2OTLN 3CJ9A 1X3MA 5BR9A 1Q7YO 5M1OA 4BC2A 3DWLA 4IWVA 4NB4A 4GY2B 3WUHA 3NMUA 2MN5A 5AQNA 3VF4A 3K9JA 1HX1A 4BG9A 2QEXN 3G71N 2E2OA 4MDAA 4BRNA 2Q0RA 5AQYA 2A6AA 1BA1A 3CPEA 4IOAL 1C0FA 1U6ZA 5KPRA 3CC7N 3O9UA 3SAGA 2HF4A 1YUWA 4B9QA 4CD3A 3WEEA 3QMLA 3DLLL 3MN9A 2DPNA 3VPZA 3C65A 5MLCQ 1SQKA 3E9LA 2WC9A 2JDQD 3D7EO 4JK9A 5KQ8A 2E8AA 3QBXA 3CCJN 3BF1A 3W0LA 4U7BA 4BRCA 2FSKA 3IDHA 1XC3A 3UKRB 4H5RA 4JD2B 5AQVA 4U67L 3KWIA 4I6MA 1MWMA 5H1SQ 3HOTA 4PKIA 1S3XA 4BROA 3QICA 2CH6A 3CETA 3C7NA 3A5MC 1VAZA 3ZEUB 1K8KB 1T3VA 3P31A 4BQLA 4B1YB 3WXLA 5CHIA 1QVGM 1S72N 3QB0A 4C23A 2YIPA 4JEPA 2QW9A 1NGAA 1C0GA 5M1NA 4UAFE 4BGBA 4RCHA 5AQGA 3S41A 3VEYA 5JLHA 4YOXA 2QI2A 3JXUA 3D2EB 3DXMB 2JWKA 5AQZA 2ZJRL 2V7ZA 3OBWA 4BC3A 3ZETA 3C7NB 4BR7A 5FPMA 5JLFA 4IEEA 4FSVA 4MO5A 3WT0A 4YOVA 3H3OB 2CGJA 4B1XB 2IVNA 3MMVA 1YI2N 3CC2N 2F7TA 4BE7B 4DHYA 4K42A 2A3ZA 1M1KO 1Z05A 2QWRA 2D0PA 3SMSA 3ULEA 4CZHA 5TKWA 3D2FA 2C1IA 2GWJA 3M1FA 3K9KA 1SAZA 3CERA 5GIPA 3VENA 4CZGA 3T7ZA 5AR0A 2HF3A 3A5OC 3C0BA 3HRGA 5HOOA 4A61A 1G99A 1DT9A 1YF5L 3H1QA 2ZWHA 3CMEN 4BRKA 3VERA 2HMPA 4WFBL 1ZBSA 3ULEB 3D6RA 2NRVA 3SAHA 1ATNA 2PBDA 3RVCA 1T6CA 2AP1A 1NGCA 3AY9A 1O13A 5AQWA 3RSEB 1BUPA 1DEJA 4PL8A 3WXIA 4PL7A 2FF6A 1VQ9N 3T69A 2QWQA 2V51B 3MK6A 4WCEL 4YDUC 4NLBA 1TUYA 4FWNA 3UKUA 4AM7A 3VOVA 4JKEA 4A2AA 3FZLA 2NRHA 2Q31A 3MX2A 4CZMA 2F9WA 3ZX0A 3LM9A 4ISEA 3CMAN 3R9PA 1NGEA 3L0QA 3LDPA 4JKBA 2P9UB 3SAFA 3TPQA 4R79A 3BEXA 3O4WA 3VEWA 1LOTB 3GL1A 1Q82O 2P9LA 3AAQA 5KPTA 2E2NA 1KXPA 3FZHA 4BR0A 2P9NB 3CJBA 2I7PA 5AQSA 3FZKA 3ATVA 3KC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX5 A;  1RFQ A;  3GBT A;  2CGK A;  4FWQ A;  4ISG A;  2OAN A;  3VGK A;  1T44 A;  2E1Z A;  3LDO A;  4BRQ A;  2YJE A;  1YVN A;  2VYP A;  1GLL O;  1BO5 O;  1GLD G;  4FOI A;  3BP8 A;  5AQQ A;  3SJH A;  1BDG A;  3EZW A;  1RDW X;  2GTD A;  3DXK B;  3LL3 A;  4BG8 A;  4EHU A;  5AQT A;  1GLE G;  2J4R A;  5AQK A;  4CZL A;  2P9S B;  4IXC A;  2YCH A;  3VEV A;  5BN9 A;  3EN9 A;  3KVG A;  1TUU A;  1NGF A;  4FPB A;  2E20 A;  1P8Z A;  4ISF A;  3CQX A;  3O08 A;  4BGA A;  4BRD A;  1TYQ A;  3ATU A;  4YDU A;  3HZ6 A;  4B1V A;  2ZGY A;  3WQT A;  2CH5 A;  2EWS A;  4CZJ A;  3WXK A;  2GEM A;  1J6Z A;  3O1W A;  5BRH A;  1BOT O;  3IUC A;  3MN7 A;  4CD1 A;  1EQY A;  3IFR A;  1X9J A;  3VGL A;  5FPE A;  2V52 B;  4DQ8 A;  5AQO A;  5JMV A;  5AZJ A;  1ZC6 A;  4BR9 A;  3HI0 A;  1E4F T;  3WEE B;  2ASM A;  4JHD A;  1NM1 A;  4FOE A;  4KBO A;  3HBT A;  3LDQ A;  4PKH A;  4FWO A;  3VEZ A;  4I6M B;  4BRH A;  3A5N C;  4FWL A;  1HKC A;  2YHW A;  4JN4 A;  5BPN A;  1QZ6 A;  1U2V A;  4EFH A;  2Q36 A;  4MO4 A;  3M6G A;  2E88 A;  3HTV A;  4CBU A;  3H1V X;  4BRF A;  5AQJ A;  1BU6 O;  3A0I X;  3EKU A;  3M3Z A;  3FLC O;  1S22 A;  3UE5 A;  4O5F A;  2FXU A;  4FWS A;  2YHX A;  3ZET B;  1V4S A;  4H0V B;  5BPL A;  2FLO A;  3EL2 A;  5KQD A;  3AAR A;  3O6W A;  3U4L A;  4FL9 A;  4XH1 A;  2FF3 B;  2Q0U A;  4B1Z A;  2IVO A;  3ENH A;  3SK3 A;  1QZ5 A;  4H0T B;  2D4W A;  3D2F B;  3OHR A;  5TKY A;  2IIR A;  4IJN A;  4CZK A;  5AQH A;  3CI5 A;  5E84 A;  3JS6 A;  1NLV A;  3U9D A;  3B8A X;  3O80 A;  4O8K A;  2HOE A;  4FPA A;  3SLC A;  1BWF O;  3VET A;  3BF3 A;  1GLC G;  2D0O A;  1E4G T;  5EXW A;  3CJ7 A;  4MLE A;  4WQ4 C;  3J8A A;  2CGL A;  3GDQ A;  5AQR A;  2A42 A;  1ESV A;  5AZI A;  4FWK A;  1NGG A;  5AQM A;  4CBW A;  4CZE A;  4NO7 A;  4H5V A;  2P9I A;  1Z6R A;  1ZXO A;  3UKU B;  4BC5 A;  2ASO A;  1YAG A;  1HJO A;  3CIP A;  2A5X A;  1NBW A;  3AAP A;  3F9M A;  3UB5 A;  2W41 A;  4DCH A;  3CJC A;  1NGH A;  1HKB A;  1WUA A;  3QFP A;  4H5T A;  1NWK A;  2GEL A;  5LJV A;  1Y64 A;  1X3N A;  3U9Z A;  5BRD A;  4DB3 A;  3MN5 A;  2P9I B;  2P9L B;  3FZF A;  1CZA N;  4WQ5 A;  3ID8 A;  5CE3 A;  4BC4 A;  3CQY A;  5FPN A;  1DKG D;  4CI6 A;  5AQI A;  2WUS A;  4CBX A;  3DAW A;  3MN6 A;  5AQF A;  5JIC A;  5LY3 A;  4M63 C;  5I9E B;  4A2B A;  2QWN A;  3LDL A;  3O1B A;  4HTL A;  1XQS C;  1BA0 A;  2AA4 A;  1ATR A;  4FO0 A;  3FR0 A;  3L4I A;  2BTF A;  5BPM A;  2ZF5 O;  3VF6 A;  4BVP A;  5BRF A;  4IO8 A;  3A8Y A;  4K41 A;  5BN8 A;  1H1V A;  2PAV A;  3R6M A;  3G25 A;  1QHA A;  4WQ4 A;  1QQN A;  1ATS A;  1TYQ B;  4H0X B;  3DJC A;  4JNE A;  3VES A;  4J8F A;  5ADX H;  2QXL A;  3KHY A;  3P4I A;  3QDK A;  1NGB A;  3A5L C;  3KZB A;  2QWL A;  4H0O A;  4PKG A;  1IG8 A;  5F0X A;  4CJ7 A;  2D1K A;  3UKR A;  4JD2 A;  2VWB A;  2QWP A;  4Y0W A;  3ZX3 A;  1HLU A;  1NGJ A;  2A41 A;  4BRM A;  5F2R A;  3ZEU A;  1K8K A;  1NGD A;  2QM1 A;  4WYB A;  3VF2 A;  4IZ9 A;  5F1X A;  3H45 C;  4K25 A;  1QQO A;  2GUP A;  3TU5 A;  3VEO A;  5AZJ B;  1MWK A;  2W40 A;  4F9O A;  3D2E A;  4JHD B;  3DXM A;  4GNI A;  4H5N A;  4H0P A;  4BR2 A;  3MDQ A;  1DGK N;  4IJA A;  3MCP A;  1GLF O;  3SMP A;  2GWK A;  4RWT A;  1KAZ A;  1IJJ A;  3IMX A;  3FGU A;  2VCP A;  1HKG A;  4CZI A;  3WQU A;  5AFU A;  5AQP A;  2E2Q A;  3BUZ B;  2FSJ A;  1V4T A;  4BR4 A;  3LDN A;  1BG3 A;  1U2V B;  3H46 O;  2V7Y A;  4EIA A;  4H0Y B;  4WQ5 C;  3GOI A;  4BRG A;  4QS8 A;  1XUP O;  3FE1 A;  5AQU A;  5AQX A;  4Z94 A;  1JCE A;  1KAX A;  4QS7 A;  1JCF A;  4XH4 A;  3ENO A;  4EAH D;  2NZT A;  2BUP A;  4B1W B;  2Q2R A;  2YJF A;  2UYT A;  4XEI A;  1MDU B;  3QBW A;  5ELZ A;  4BQZ A;  1KAY A;  1D4X A;  1NMD A;  3RSE A;  5E26 A;  1GLJ O;  4FWM A;  3O8M A;  1Q18 A;  3I33 A;  4EHT A;  3H6E A;  3ZX2 A;  4BR5 A;  4B1U B;  3U8X A;  3HM8 A;  3QFU A;  3CJA A;  3FFK B;  1GLA G;  4JAX A;  4BVO A;  4MLH A;  3W3D A;  1OKJ A;  3VGM A;  3GG4 A;  4BRL A;  3HSC A;  1MA9 B;  1HUX A;  5AFU H;  2YI1 A;  4H03 B;  2E2P A;  2E1Y A;  2IVP A;  3L6Q A;  2P9U A;  3EKS A;  1R59 O;  4BRA A;  4RTF D;  4L3Q A;  1LCU A;  2F9T A;  2ITM A;  4BRI A;  5KPZ A;  2P9N A;  1SZ2 A;  4LC9 B;  1QQM A;  3FZM A;  2ZGZ A;  5AZI B;  2QWO A;  5ADX A;  5LJW A;  5EVZ A;  3H3N O;  4BRP A;  3LM2 A;  2P9P A;  5BRE A;  5B8H A;  4K43 A;  1YXQ A;  3CJ1 A;  5EY4 A;  2A40 A;  2ASP A;  2Q1N A;  3I8B A;  2QWM A;  2NLX A;  1HPM A;  2Q97 A;  4E1J A;  3DXK A;  3CHW A;  5FPD A;  2P9K A;  4FWP A;  4A62 A;  1GLB G;  4M7Y A;  2I7N A;  2P9S A;  3GE1 A;  2P9P B;  4FWR A;  3O5B A;  3EO3 A;  4HWI A;  4M7X A;  4H5W A;  5EOY A;  1T6D A;  1JCG A;  3WXJ A;  4AM6 A;  1NGI A;  2FSN A;  4BRE A;  5AQL A;  2YHY A;  2P9K B;  1RGI A;  3R8E A;  1WOQ A;  2KHO A;  4QS9 A;  3VEX A;  2H3G X;  4XH5 A;  4CZF A;  3CJ9 A;  1X3M A;  5BR9 A;  4BC2 A;  3DWL A;  4IWV A;  4NB4 A;  4GY2 B;  3WUH A;  5AQN A;  3VF4 A;  1HX1 A;  4BG9 A;  2E2O A;  4BRN A;  2Q0R A;  5AQY A;  2A6A A;  1BA1 A;  1C0F A;  1U6Z A;  5KPR A;  2HF4 A;  1YUW A;  4B9Q A;  4CD3 A;  3WEE A;  3QML A;  3MN9 A;  2DPN A;  3VPZ A;  1SQK A;  3D7E O;  5KQ8 A;  2E8A A;  3QBX A;  3BF1 A;  3W0L A;  4BRC A;  2FSK A;  3IDH A;  1XC3 A;  3UKR B;  4H5R A;  4JD2 B;  5AQV A;  4I6M A;  1MWM A;  4PKI A;  1S3X A;  4BRO A;  3QIC A;  2CH6 A;  3CET A;  3C7N A;  3A5M C;  3ZEU B;  1K8K B;  4BQL A;  4B1Y B;  3WXL A;  3QB0 A;  4C23 A;  2QW9 A;  1NGA A;  1C0G A;  4BGB A;  4RCH A;  5AQG A;  3S41 A;  3VEY A;  5JLH A;  3JXU A;  3D2E B;  3DXM B;  5AQZ A;  2V7Z A;  4BC3 A;  3ZET A;  3C7N B;  4BR7 A;  5FPM A;  5JLF A;  4MO5 A;  4FSV A;  3WT0 A;  3H3O B;  2CGJ A;  4B1X B;  2IVN A;  3MMV A;  4DHY A;  4K42 A;  2A3Z A;  1Z05 A;  2QWR A;  2D0P A;  3SMS A;  3ULE A;  4CZH A;  3D2F A;  2GWJ A;  3M1F A;  1SAZ A;  3CER A;  3VEN A;  4CZG A;  5AR0 A;  2HF3 A;  3A5O C;  3C0B A;  4A61 A;  1G99 A;  3H1Q A;  2ZWH A;  4BRK A;  3VER A;  2HMP A;  1ZBS A;  3ULE B;  1ATN A;  2PBD A;  1T6C A;  2AP1 A;  1NGC A;  3AY9 A;  3RSE B;  5AQW A;  1BUP A;  1DEJ A;  4PL8 A;  3WXI A;  4PL7 A;  2FF6 A;  2QWQ A;  2V51 B;  3MK6 A;  4YDU C;  1TUY A;  4FWN A;  3UKU A;  4AM7 A;  3VOV A;  4A2A A;  3FZL A;  2NRH A;  2Q31 A;  4CZM A;  2F9W A;  3ZX0 A;  3LM9 A;  4ISE A;  3R9P A;  1NGE A;  3L0Q A;  3LDP A;  2P9U B;  3TPQ A;  3BEX A;  3O4W A;  3VEW A;  1LOT B;  3GL1 A;  2P9L A;  3AAQ A;  5KPT A;  2E2N A;  1KXP A;  3FZH A;  4BR0 A;  2P9N B;  3CJB A;  2I7P A;  5AQS A;  3FZK A;  3ATV A; 
#chains in the Genus database with same CATH topology
 3VTI A;  3KIO A;  1Q86 O;  2G8H A;  4LFB K;  3HP9 A;  1C0M A;  1M90 O;  3ZSO A;  2KTQ A;  4CEE A;  4OO1 J;  2E1Z A;  4CFB A;  1ZBL A;  3QEW A;  3WNH A;  1ITG A;  4CJW A;  1WB9 A;  5AJ3 K;  2ZD1 A;  1X9W A;  3E7U X;  3NH1 A;  3EZW A;  5GAG P;  4CCH A;  4BG8 A;  5AQT A;  2J4R A;  5AQK A;  1SS6 A;  3AVI A;  1TKX A;  3O3G A;  2YNI A;  4IXC A;  3VEV A;  4Z0U A;  3A2F A;  1P8Z A;  3AVB A;  3ZSR A;  3O08 A;  4CGF A;  4YHH K;  3TTF A;  4FJ9 A;  4DQR A;  2ZGY A;  4K0K K;  4CZJ A;  3TAG A;  1JLG A;  1CZB A;  4JK7 A;  4YOW A;  1NJY A;  1S6Q A;  4QOZ B;  4DTP A;  1JLC A;  3PX4 A;  1S9E A;  3IUC A;  4CD1 A;  4E1M A;  4E89 A;  1EQY A;  3OS2 A;  1X9M A;  3K5M A;  5FPE A;  2V52 B;  4LF4 K;  3T1A A;  5AQO A;  1XHX A;  3RR8 A;  4Z4F A;  1ZC6 A;  4BR9 A;  5GAD P;  3MEG A;  4FM0 A;  1T03 A;  4DTR A;  4FOE A;  2UU9 K;  3BGR A;  4KBO A;  4DSF A;  4FZX C;  3LDQ A;  1HPZ A;  4PKH A;  1SKW A;  2LJM A;  3A5N C;  4FWL A;  4KFB A;  2YHW A;  4FJI A;  1R0A A;  1ZFU A;  4CF9 A;  3EKU A;  3M3Z A;  3VQE A;  1K73 O;  4HUG A;  3OW2 M;  4FWS A;  1YTA A;  3ZET B;  4H0V B;  5BPL A;  2FLO A;  1J9A A;  1RT6 A;  5KQD A;  5J1E A;  1WWN A;  4FL9 A;  4XH1 A;  2FF3 B;  3SK3 A;  1Q81 O;  1K6Y A;  2ZM6 K;  3CFR A;  3AVN A;  2IIR A;  5M1P A;  1DQ7 A;  5AQH A;  2OYQ A;  3KHW A;  1BQN A;  3O80 A;  4E7K A;  1VQ5 N;  5LMN K;  4GV3 A;  5FLX O;  4FPA A;  4OGC A;  2G8K A;  4QCL A;  3BF3 A;  1GLC G;  2D0O A;  3MWP A;  4LSL A;  3QEI A;  3CJ7 A;  5GAH P;  3J8A A;  1IH7 A;  2C1G A;  1RTJ A;  1ESV A;  5AZI A;  4CBW A;  1UA1 A;  4NO7 A;  1TVR A;  3NGZ A;  3SF4 D;  1Z6R A;  1ICA A;  1YAG A;  4IDH A;  4CVN E;  1NOY A;  1RDD A;  3UB5 A;  4DG1 A;  4DV3 K;  4CEZ A;  3V4I A;  1JLQ A;  1TL1 A;  3O4Q A;  2GEL A;  1EX4 A;  1X3N A;  5HBM A;  3PLA A;  4Y1D A;  3FZF A;  1LAV A;  3ID8 A;  1SEG A;  3L56 A;  2NY9 X;  3CQY A;  5FPN A;  5C2F A;  4CI6 A;  4ZHR A;  3J7Z O;  1VQM N;  3DAW A;  3MN6 A;  4M63 C;  1VQK N;  3T3F A;  3LDL A;  4HTL A;  4IOC L;  1NK8 A;  2GMO A;  1BA0 A;  2F8T A;  2BTF A;  4K41 A;  4DTJ A;  1I2U A;  4FJ5 A;  5BN8 A;  2PAV A;  4BAC A;  3G25 A;  1QHA A;  3B6O A;  3RTV A;  4WQ4 A;  1ASW A;  1KVB A;  1BCM A;  4H0X B;  1N5Y A;  4JNE A;  4C8M A;  3Q7B A;  4GV9 A;  2X6S A;  5ADX H;  1QVF M;  2K35 A;  1VSJ A;  1NGB A;  4JKG B;  4KH4 A;  1NKC A;  4FLZ A;  2D5R A;  5F0X A;  2NY8 X;  2IC3 A;  1OH7 A;  2VWB A;  4YY3 K;  3OYC A;  1WMT A;  2R7Y A;  4FLW A;  2QM1 A;  1IV0 A;  5M1K A;  5F1X A;  2P1J A;  2GUP A;  3VEO A;  4CHP A;  4W5O A;  2ZJQ L;  5AZJ B;  1I6F A;  2W40 A;  4DV4 K;  4ILH A;  4JHD B;  3DXM A;  4KHY A;  5CZ2 A;  1UGL A;  1C1B A;  4A5B A;  1A5V A;  3SMP A;  3OYJ A;  2B6A A;  1KAZ A;  3PIP L;  3ZT3 A;  3NGI A;  3IMX A;  1GPS A;  2VCP A;  5FDL A;  1HKG A;  4CZI A;  1I2V A;  3WQU A;  4PWD A;  2ITG A;  4PA1 A;  3IKM A;  3AO1 A;  4BR4 A;  1WLJ A;  3KD5 E;  3LDN A;  3CG7 A;  4I2P A;  1U2V B;  4M3Z A;  2VWJ A;  4EIA A;  1J5E K;  4H0Y B;  5HRN A;  5CYQ A;  4BRG A;  2VGM A;  4M3Y A;  5T7B A;  1A5X A;  4ID5 A;  3TAP A;  3CCE N;  1TI5 A;  1VSI A;  1D9F A;  1WN7 A;  4EAH D;  4ELV A;  1IBM K;  2O8D A;  4B1W B;  3O3F A;  4BQZ A;  1MDU B;  5ELZ A;  4DV5 K;  4CJV A;  4NLC A;  1NMD A;  1RBR A;  1RTI A;  3RSE A;  1FJG K;  3ZSY A;  1L3V A;  1Q18 A;  3I33 A;  3H6E A;  1JL1 A;  1KD1 O;  5M1F A;  1BQM A;  4NXN K;  4WE1 A;  5C10 A;  3V6D A;  3DLK A;  4BRL A;  4JI4 K;  3PSM A;  1HUX A;  2AJQ A;  2IVP A;  1JL2 A;  3PIO L;  1RT4 A;  2HB5 A;  4H4M A;  3QLH A;  4AF1 A;  4IEI A;  2BH1 A;  1LCU A;  4BRI A;  2P9N A;  1IO2 A;  1GOC A;  1HNZ K;  5C24 A;  3KP1 A;  2UXD K;  3L2V A;  3SUO A;  3HYF A;  2QWO A;  4PQU A;  4YOU A;  5LJW A;  5EVZ A;  3KK1 A;  2P9P A;  4DV6 K;  1KFD A;  4K43 A;  4DSL A;  4YOT A;  2X6N A;  2ASP A;  4CE9 A;  3VQB A;  1K8A O;  3LZJ A;  2LN8 A;  2E3F A;  4BY9 C;  4BDP A;  2P9K A;  3BY5 A;  1XMO K;  4HCC A;  2I7N A;  5J2Q A;  2P9S A;  3RRH A;  1RIL A;  3GE1 A;  2P9P B;  3O5B A;  2QTD A;  4HWI A;  2RHK A;  4H5W A;  3V81 A;  3NHG A;  3TSU A;  5EOY A;  4BDY A;  1U47 A;  1HJR A;  1XRS B;  5C12 A;  2FSN A;  1QSY A;  1J53 A;  4BRE A;  3ID6 A;  1LW2 A;  2P9K B;  1WOQ A;  2KHO A;  4HUE A;  1X3M A;  5BR9 A;  1Q7Y O;  4IWV A;  4NB4 A;  4R5P A;  3LPT A;  3WUH A;  3NMU A;  2XY7 A;  1KVC A;  2QEX N;  3M8Q A;  3IRX A;  5I42 A;  3HPO A;  1IKY A;  3K5N A;  3MAQ A;  1C0F A;  1U6Z A;  5KPR A;  3SYZ A;  3O9U A;  4AAZ A;  1KTQ A;  3SQ4 A;  1HNV A;  3D45 A;  4YNQ A;  5LMU K;  3C65 A;  5MLC Q;  1SQK A;  4V1D C;  4BE1 A;  2JDQ D;  3D7E O;  4JK9 A;  2E8A A;  1WSJ A;  1S1U A;  3BF1 A;  1KVA A;  1JXB A;  3NBP A;  4E7L A;  1T8E A;  4NXM K;  2Z1J A;  1XC3 A;  3UKR B;  5H1S Q;  3KWI A;  4FJJ A;  1MWM A;  4PKI A;  2O8E B;  2CH6 A;  3CET A;  3A5M C;  2PYL A;  1K8K B;  3K2P A;  4BQL A;  1VNB A;  4KHP K;  5M1N A;  4UAF E;  4RCH A;  5AQG A;  3S41 A;  3VEY A;  5JLH A;  1T7A A;  2YHB A;  2Z1G A;  2QI2 A;  3JXU A;  4KHS A;  1TV6 A;  4FCY A;  2ZJR L;  2V7Z A;  4BC3 A;  4FSV A;  1NJX A;  4CW7 B;  4YOV A;  3OS1 A;  3CC2 N;  4RW8 A;  2F7T A;  4FLV A;  1W9H A;  3NH2 A;  4CZH A;  2Y1J A;  1SAZ A;  4Z4C A;  4DV2 K;  5AR0 A;  3KD1 E;  3A5O C;  1WSG A;  1GPT A;  5HOO A;  2W6K A;  3KLE A;  5J2M A;  2KW4 A;  4BRK A;  2HMP A;  2O8B A;  4B9S A;  2PBD A;  2HHS A;  4FJM A;  3ZSX A;  1OVQ A;  2GV9 A;  1O13 A;  1BUP A;  1RCH A;  4E3S A;  3WXI A;  4PL7 A;  4DFJ A;  3T69 A;  1VQ9 N;  3MK6 A;  3U3Y A;  2RN2 A;  1U04 A;  3AVJ A;  4AM7 A;  2YNG A;  1JLB A;  4JKE A;  4QAG A;  5HP1 A;  4DSK A;  2O8B B;  3DRS A;  2Q31 A;  4DR6 K;  4CZM A;  1S1T A;  1HNW K;  4B9U A;  3LM9 A;  4N5S A;  3R9P A;  3L0Q A;  3SAF A;  2O8F A;  2OPR A;  4HTU A;  3TPQ A;  4R79 A;  3VEW A;  1FKP A;  1ASV A;  3GL1 A;  1Q82 O;  2OZS A;  2P9L A;  3TWH A;  4KKO A;  3FZH A;  1OH5 A;  1HYZ A;  3ATV A;  4X65 K;  2F4V K;  2PYJ A;  1Q8I A;  1X1P A;  4OPA A;  2OAN A;  2O8F B;  2UUB K;  4FYD A;  4BRQ A;  4CJU A;  1BIZ A;  4FOI A;  4KI4 A;  3BP8 A;  1BDG A;  2E2F A;  5GAE P;  4UJ0 A;  4LFC K;  3LL3 A;  1KFS A;  4DQI A;  1N32 K;  1HQU A;  3EN9 A;  1QSL A;  3KVG A;  4FPB A;  2E20 A;  2PFU A;  4M41 A;  4OJR A;  1LV5 A;  3CQX A;  4RW9 A;  4BGA A;  4B9M A;  3NH0 A;  4KB0 A;  1ZBH A;  1TYQ A;  3HZ6 A;  4B1V A;  1IKX A;  4FJN A;  2LSN A;  4CFA A;  2HBK A;  2BE2 A;  1W97 L;  4JI7 K;  1BI4 A;  3NVK A;  2BAN A;  2XRI A;  3LAK A;  2GEM A;  1D9D A;  3SCX A;  3EZ5 A;  3AGK A;  4NCA A;  3SI6 A;  4Y1C A;  1BK8 A;  4DQ8 A;  1KRP A;  1HQE A;  3HI0 A;  4DSI A;  3DM2 A;  1JXE A;  1TKZ A;  3WEE B;  2ASM A;  1NM1 A;  3V9X A;  4H4O A;  4IDK A;  1SNB A;  1KLN A;  4FWO A;  2KYQ A;  4IO9 L;  3MEE A;  1T7B A;  3RWU A;  1OMY A;  1HKC A;  4JN4 A;  3TAM A;  1RT1 A;  1DTT A;  3DLG A;  1NPI A;  2W00 A;  4GMJ B;  4HVJ A;  3LP1 A;  2W6L A;  4G1Q A;  4MO4 A;  2E88 A;  4DTO A;  4BRF A;  1PX9 A;  2XY6 A;  1VQN N;  1S22 A;  1YJW N;  3I56 N;  2RPI A;  2FXU A;  1BIS A;  4XIU A;  3EL2 A;  4PY5 A;  3MCA B;  4LSN A;  1SL2 A;  3AAR A;  1IKV A;  4DS5 A;  3C6A A;  2IVO A;  3ENH A;  1VRU A;  2D4W A;  4DF8 A;  4DR4 K;  3D2F B;  3OHR A;  5TKY A;  4IJN A;  3M8S A;  3CI5 A;  1B9F A;  3E9O A;  3JS6 A;  4JRQ A;  3RR7 A;  3B6P A;  5IT9 O;  3CF5 L;  4AEI A;  3SJJ A;  3THW A;  1CZ9 A;  4KTQ A;  4MDB A;  5HRP A;  3MXI A;  1ZVE A;  1E4G T;  1S6P A;  1NK5 A;  3CQ8 A;  3GDQ A;  1ZBI A;  3E1Y A;  4CJK A;  1NGG A;  3UIQ A;  4H5V A;  3KLH A;  3AVL A;  3UKU B;  4BC5 A;  2OTJ N;  1NK4 A;  2O8C A;  1HJO A;  3SUN A;  3EYZ A;  2LY6 A;  1ZVG A;  3M8R A;  2LJ7 A;  4CHQ A;  4IG0 A;  2KQ2 A;  3ASM A;  1K9M O;  4HUF A;  3I0S A;  1NGH A;  1HKB A;  3CPW M;  4H5T A;  5LJV A;  3OYF A;  3TI0 A;  1Y64 A;  4CIG A;  3NF7 A;  5BRD A;  4DB3 A;  1HYS A;  3MN5 A;  4YFU A;  1RT5 A;  5CE3 A;  4BC4 A;  3OA9 A;  2P51 A;  2UXC K;  3MWT A;  5AQI A;  1ASU A;  3KK7 A;  3PX0 A;  3CCL N;  4GV6 A;  5JIC A;  1RBV A;  5LY3 A;  3AVM A;  2HBM A;  3CXC M;  4A2B A;  3ZSV A;  4ILG B;  2G8W A;  4KHQ A;  3L4I A;  3VF6 A;  3CC4 N;  2KZM A;  4KHU A;  4IO8 A;  5HLF A;  4DU3 A;  5A2Q O;  3R6M A;  5JEN A;  2B5J A;  3K59 A;  2YEO A;  4B9V A;  3AA4 A;  4ELU A;  4DLG A;  1VSH A;  3DJC A;  3O3H A;  3CYM A;  3R3L A;  4AHT A;  1EKE A;  1VQ6 N;  3BZC A;  2QXL A;  3KHY A;  1BMR A;  3C95 A;  2HMI A;  4PKG A;  3SQ1 A;  1YVU A;  3ZSW A;  4CJ7 A;  1WAJ A;  4G9Z A;  4BWJ A;  4WFA L;  2NRX A;  1KC8 O;  4GW6 A;  4DTN A;  1AYJ A;  3QER A;  1LQQ A;  3ZEU A;  4Z4G A;  1NGD A;  3VF2 A;  3I55 N;  4IZ9 A;  1NRA A;  4IG3 A;  5C0Y A;  1ZYV A;  3EY1 A;  3V9W A;  3NFA A;  1MWK A;  3KWG A;  4F9O A;  4CEQ A;  4CHZ A;  4L8R B;  1B92 A;  3ZT1 A;  4BR2 A;  3MDQ A;  1CLQ A;  3CCM N;  4WFN L;  4Z4I A;  1NKB A;  1GLF O;  2GWK A;  5JS2 A;  4J2A A;  3C94 A;  3AA2 A;  3L4Q A;  3F73 A;  3BUZ B;  2E2Q A;  2FSJ A;  2Q3S A;  3OYE A;  4BE2 A;  3M8P A;  4CJF A;  4N56 A;  1U45 A;  4KH5 A;  3H46 O;  2VQF K;  4J2E A;  4QS8 A;  3WNE A;  1SL0 A;  1VSL A;  3D0P A;  3VQ6 A;  5AQU A;  3KTQ A;  4AHR A;  3MX5 A;  4Z94 A;  1KAX A;  4AIL C;  2NRW A;  4XH4 A;  3ENO A;  2O4G A;  4CEA A;  3G4S N;  3VQ7 A;  2Q2R A;  3ENB A;  2G8U A;  4XEI A;  4O0J A;  1KAY A;  1I3A A;  2YKN A;  1GLJ O;  2ATB A;  1XNR K;  3O8M A;  4JI5 K;  4BR5 A;  3QIP A;  4B1U B;  3U8X A;  3KK3 A;  4JAX A;  4BVO A;  2NUB A;  3TR8 A;  5KRT A;  3NCI A;  3HSC A;  1Q9X A;  4FK2 A;  5DM7 L;  1MA9 B;  3E9P A;  5AFU H;  4B3S K;  3ZYY X;  3IG1 A;  2E1Y A;  4HCB A;  1JLF A;  4BRA A;  4L3Q A;  2QKK A;  2VGN A;  1W0H A;  2ITM A;  4KYP A;  2YC1 C;  1CXQ A;  3HVT A;  3JYT A;  1SZ2 A;  2OA8 A;  4LF9 K;  4CFC A;  1QQM A;  4CF2 A;  3L8B A;  5JVH L;  3FZM A;  2ZGZ A;  1JXC A;  3LP2 A;  5AZI B;  4K8Z A;  3PSI A;  4F4K A;  4PUO A;  5KGX A;  5EY4 A;  1VSD A;  4W5R A;  3I8B A;  4DUZ K;  4DV1 K;  3NF8 A;  2Q97 A;  1B7D A;  3DXK A;  1LQH A;  4JRP A;  2RF2 A;  1FW6 A;  4H8K A;  2D56 A;  4LF5 K;  1JKZ A;  3Q7C A;  3CW4 A;  4M7X A;  1LWF A;  3KKR A;  3ULD A;  1C0U A;  1T6D A;  5GIN A;  1JCG A;  2D0C A;  2GX9 A;  3PV8 A;  2B4J A;  3OYI A;  1HMV A;  2QXF A;  4FLX A;  4M45 A;  3O4N A;  1U48 A;  1L3U A;  4CZF A;  2VY6 A;  2OTL N;  3CM5 A;  3PUF A;  5M1O A;  1OH6 A;  3AO3 A;  4DQS A;  4I7F A;  4GY2 B;  5AQN A;  3K9J A;  4AQY K;  2HHU A;  5D3G A;  4MDA A;  3QEV A;  2Q0R A;  3L2W A;  3HXM A;  4N41 A;  2A6A A;  1BA1 A;  4IOA L;  4CHY A;  3THV A;  3MEC A;  4CD3 A;  2DPN A;  2KBJ A;  3SQ2 A;  4V19 S;  3V9S A;  5KQ8 A;  3W0L A;  2FSK A;  2D0A A;  5EU7 A;  3IDH A;  4I6M A;  3HOT A;  4B8C A;  4BE0 A;  3QIC A;  1MYN A;  1VAZ A;  5J2P A;  3KOY A;  2HHT A;  1S72 N;  1C0G A;  1NGA A;  1EET A;  2EHG A;  2LY5 A;  3L2R A;  4DTM A;  3V1R A;  4YOX A;  3OYG A;  3RMA A;  2ATQ A;  2EX3 A;  3DXM B;  5SWM A;  2JWK A;  2WTU A;  1HRH A;  3OBW A;  4FZZ A;  5KRS A;  4IEE A;  4B1X B;  4DR7 K;  3MMV A;  4O0I A;  3P5J A;  3TAR A;  1GOA A;  2D0B A;  3T1Y K;  3L3V A;  1M1K O;  4LY7 A;  3QNN A;  1Z05 A;  2QWR A;  1L3S A;  3ULE A;  1YTU A;  5TKW A;  1RDA A;  1CHZ A;  1XC9 A;  2DFE A;  3K9K A;  2N2Q A;  1JLA A;  1FKO A;  3CER A;  5GIP A;  4KRE A;  4ID1 A;  3LP0 A;  3C0B A;  3QIO A;  3L2Q A;  4A61 A;  1YF5 L;  4GKJ K;  3VQ4 A;  3VER A;  3GKU A;  3ULE B;  2O8D B;  1ATN A;  2BDP A;  4E7J A;  4EP5 A;  1ZBF A;  3RSE B;  5C25 A;  4PL8 A;  2FF6 A;  4JS4 A;  2QWQ A;  2V51 B;  4N47 A;  2FBT A;  3ZSZ A;  4YDU C;  2GUI A;  4NLB A;  4BDZ A;  1FXX A;  3VOV A;  4X64 K;  3SZ2 A;  3KLI A;  3MX2 A;  2F9W A;  3ZX0 A;  5IWA K;  3AV9 A;  4I9Q A;  2IGI A;  1RT3 A;  4CK1 A;  5FRM A;  3O4W A;  1S5J A;  1TK5 A;  1LOT B;  3AAQ A;  4FW1 A;  4DV7 K;  1NKE A;  1REV A;  2P9N B;  3CJB A;  2I7P A;  5AQS A;  4ILJ A;  1TK8 A;  1KV0 A;  3KC6 A;  2GL1 A;  4X66 K;  4CK3 A;  3GBT A;  3F9K A;  4ISG A;  1Z26 A;  3I8D A;  3VGK A;  1J5O A;  1D5A A;  4F3O A;  1QS4 A;  1OVY A;  5KI6 A;  3LZI A;  2YJE A;  3SBT A;  2VYP A;  4B8A B;  1GLD G;  4CJS A;  1WSF A;  3SJH A;  4NCG A;  1X9S A;  1W2B M;  2GTD A;  4EHU A;  5LL6 Z;  1GLE G;  3ZT2 A;  3CYG A;  1T1T A;  2P9S B;  1BRZ A;  1DLO A;  2YCH A;  5BN9 A;  4CJ5 A;  1QSS A;  3CD6 N;  1JJ2 M;  2OPP A;  1B3C A;  3ALY A;  3DLE A;  3ZSQ A;  4KHN A;  2DY4 A;  3ATU A;  3THX A;  3E66 A;  2JLE A;  4FLU A;  1HNI A;  1C1A A;  4DTS A;  2EWS A;  4DU4 A;  2DFH A;  4B08 A;  3CCQ N;  3QO9 A;  5M1Q A;  2YHA A;  3DLR A;  5BRH A;  4CJL A;  3IFR A;  4GKK K;  1X9J A;  4LF7 K;  3VGL A;  5KK4 A;  2WOM A;  4FXD A;  5JMV A;  2HVI A;  1E4F T;  1SKS A;  2LT8 A;  3KKS A;  1PTX A;  3HBT A;  2B68 A;  2A7T A;  4C8L A;  2HNY A;  3VEZ A;  4BRH A;  1ILY A;  3F5T A;  2KPY A;  4AHU A;  5BPN A;  4CHO A;  1QZ6 A;  1POI A;  3PO4 A;  4FJH A;  3M6G A;  2NNW A;  5CR4 A;  2BRZ A;  5AQJ A;  1C55 A;  4KI6 A;  1SUQ A;  4CJT A;  3UE5 A;  3WNG A;  2YNH A;  3SPY A;  1V4S A;  3OTO K;  3DRP A;  3J7A P;  4BEC A;  1HYV A;  3C6U A;  2E3G A;  3O6W A;  3U4L A;  4NYN A;  4DR5 K;  1NK9 A;  2Q0U A;  4B1Z A;  1QZ5 A;  4H0T B;  2Z1H A;  3VN5 A;  4DR3 K;  3S5T A;  2YX6 A;  1YIJ N;  4CZK A;  1NJZ A;  5C2D A;  3N4Q A;  3U9D A;  3B8A X;  4DTU A;  2FBX A;  4KTZ A;  1T0Z A;  1VK0 A;  2LI7 A;  3KOW A;  3SLC A;  4ELT A;  1BWF O;  3VET A;  2G8V A;  2F8S A;  3OYN A;  4CF0 A;  5EXW A;  4MLE A;  2FC0 A;  2IDO A;  2WON A;  4LFA K;  4CGD A;  2HHQ A;  3KLG A;  5AQR A;  4FWK A;  5AQM A;  1ZXO A;  2HND A;  2Y1I A;  1C56 A;  2A1R A;  3QES A;  2ZJP L;  1VSM A;  5HRO A;  3NE6 A;  4KO0 A;  4J2B A;  3SBG A;  2W41 A;  2NRZ A;  4M42 A;  4E19 A;  2N69 A;  3LWM A;  2HW3 A;  3QEX A;  4UAD E;  3QFP A;  1NWK A;  2HNZ A;  4CGH A;  4YOY A;  4C1N K;  1WBB A;  1QHT A;  4MQ3 A;  3S3M A;  4DTX A;  2P9L B;  2UUC K;  4WQ5 A;  4IFV A;  4BEB A;  3VQ9 A;  3C6H A;  3V9Z A;  2QK9 A;  4DSE A;  1DKG D;  2OPQ A;  1LW0 A;  4CBX A;  4CF8 A;  2KJA A;  5AQF A;  3VQ8 A;  5DMR A;  1QTM A;  2QWN A;  3O1B A;  3OVN A;  4FVU A;  4FLT A;  2AA4 A;  3V1Q A;  1EXQ A;  4FO0 A;  3AO5 A;  3CCU N;  5HL7 L;  1XWL A;  2ZF5 O;  1JLE A;  4BVP A;  5HRS A;  1NOZ A;  4OPJ A;  3A8Y A;  1N36 K;  3QIN A;  4I9L A;  3ZCM A;  3SPZ A;  4OX9 K;  1HNX K;  1H1V A;  4F3T A;  4O5B A;  2KFN A;  2ASC A;  2KKZ A;  4A59 A;  1ZU3 A;  1VQ7 N;  3CCS N;  3MED A;  1NK7 A;  4FJ7 A;  1P00 A;  1QQN A;  3QI7 A;  1ZUT A;  1TYQ B;  1NNE A;  1DTQ A;  4F8R A;  2QA4 N;  2HHV A;  4J8F A;  2RKI A;  3CCV N;  3KZB A;  1BI4 B;  2X78 A;  4O4G A;  2G2K A;  2D1K A;  4JD2 A;  4CF1 A;  2QWP A;  4DU1 A;  1IKW A;  3ZX3 A;  1HLU A;  2A41 A;  5JVG L;  3U6F A;  4HE7 A;  3HP6 A;  3AVF A;  3CFP A;  4M3R A;  3VTH A;  4KHW A;  3TU5 A;  2UUA K;  3EE8 A;  3D2E A;  4GNI A;  1P0A A;  4H5N A;  1VSK A;  1DGK N;  4OVL A;  4IJA A;  5SZT A;  3OS0 A;  3LWL A;  2IOC A;  2WBN A;  4UQG A;  4F2S A;  4IKF A;  1YIT N;  3HVR A;  4DLE A;  4JK8 A;  1RDB A;  4IFE A;  3DRR A;  4WQ5 C;  3V1O A;  1XUP O;  5AQX A;  4LH4 A;  1CN2 A;  4JKA A;  1EWR A;  5DM6 L;  4CEF A;  1JCF A;  4C8K A;  2KGQ A;  2NZT A;  5KTQ A;  4C8O A;  4FLY A;  4OPH A;  2YJF A;  2UYT A;  3QBW A;  3OYD A;  1N34 K;  3L3U A;  1D4X A;  1VSF A;  2E6M A;  3NVM A;  3IS9 A;  5E26 A;  4YOR A;  1W7A A;  4CGJ A;  4LF6 K;  1EO1 A;  3ZX2 A;  3F2K A;  1VSE A;  3LP3 A;  3FFK B;  3NF6 A;  1GLA G;  3K5L A;  1WSH A;  1N8R O;  3W3D A;  3HPH A;  3LAL A;  1RBS A;  5I3U A;  3G0Z A;  1RT2 A;  2YI1 A;  4H03 B;  1XHZ A;  3L6Q A;  2P9U A;  3EKS A;  3OYA A;  3THW B;  3LPU A;  1R59 O;  4E0D A;  4RTF D;  4B9L A;  3J81 O;  4FJL A;  3AO4 A;  5KPZ A;  4LC9 B;  3ZT0 A;  4UAE F;  4CEO A;  4A57 A;  4ZTF A;  3H3N O;  2F96 A;  4JI3 K;  1VQP N;  5B8H A;  4IOX A;  4CER A;  1YXQ A;  4M3W A;  2O8C B;  3CJ1 A;  4JKC A;  2A40 A;  1HR0 K;  1GOB A;  3E01 A;  1WNS A;  2QWM A;  1KLM A;  2NLX A;  4DQQ A;  3ISN C;  3CHW A;  5FPD A;  1SKR A;  4FWP A;  2RE2 A;  4M7Y A;  1BIU A;  4FM2 A;  2E0H A;  4FWR A;  5DK5 A;  2B3C A;  4CJ4 A;  3TTC A;  1NK6 A;  2VG7 A;  1ZYW A;  4O55 A;  3S9H A;  3PSF A;  4AM6 A;  1NGI A;  4FJX A;  2HVH A;  5AQL A;  2HHH K;  4DMN A;  3AO2 A;  3R8E A;  4IBN A;  5BR8 K;  4BC2 A;  2HHW A;  3KJV A;  1UAX A;  1C0T A;  3TAN A;  1HX1 A;  3HT3 A;  1TK0 A;  3G71 N;  1C6V A;  1B9D A;  1JZB A;  3DOK A;  4RW4 A;  5AQY A;  1J54 A;  3QNO A;  3CPE A;  4FJG A;  3CC7 N;  3MXM A;  1YUW A;  4B9Q A;  5E41 A;  3DLL L;  3MN9 A;  2HHI A;  3EEQ A;  1U4B A;  3VA3 A;  2WC9 A;  4JI8 K;  4OKJ A;  3J80 O;  3ZT4 A;  1N33 K;  4BRC A;  2ZE2 A;  1WBD A;  2VG6 A;  1PE4 A;  4H5R A;  1LWE A;  1WT7 A;  5AQV A;  1WAF A;  4C8N A;  4U67 L;  5FRN A;  4BRO A;  2BGG A;  3C7N A;  4HHT A;  4GVM A;  3ZEU B;  3P31 A;  1OZZ A;  3WXL A;  3TAQ A;  5CHI A;  1QVG M;  4C23 A;  2YIP A;  4M3X A;  4JI6 K;  2N2R A;  3SV3 A;  1KSP A;  2DTU A;  1NE5 A;  4BGB A;  2OPS A;  4KB1 A;  1MR4 A;  1FK9 A;  5AQZ A;  3ZET A;  3C7N B;  4AHS A;  4BR7 A;  2KFZ A;  4MO5 A;  3P83 D;  4CJE A;  1TKT A;  3WT0 A;  4CIE A;  3H3O B;  1Q9Y A;  4FJK A;  2IVN A;  4BE7 B;  2A3Z A;  1XMQ K;  3KOZ A;  2C1I A;  2GWJ A;  3M1F A;  4DS4 A;  3C6T A;  4FZY A;  4CZG A;  3RMB A;  2VG5 A;  2HF3 A;  2W42 A;  1DT9 A;  3H1Q A;  4CES A;  3K0S A;  1ZBS A;  3D6R A;  2NRV A;  3SAH A;  3RVC A;  1T6C A;  3AY9 A;  1XI1 A;  5AQW A;  1XNQ K;  1DEJ A;  2QKB A;  3AVA A;  4E7I A;  1TUY A;  4FWN A;  3I0R A;  4DR1 K;  1RTH A;  3KLF A;  4B3M K;  2NRH A;  4OGE A;  1EWQ A;  4ISE A;  3CMA N;  4EP4 A;  4CFD A;  1NGE A;  3AA3 A;  4JKB A;  1K8B A;  3BEX A;  3ITH A;  5JS1 A;  4O44 A;  4FVM A;  2E2N A;  1LAW A;  4DFP A;  5EX5 A;  1RFQ A;  5CYM A;  2YKM A;  2CGK A;  4FWQ A;  4LF8 K;  1T44 A;  1VHX A;  3U3G A;  3LDO A;  1YVN A;  1GLL O;  1BO5 O;  3BDP A;  5AQQ A;  1S1X A;  2N66 A;  1RDW X;  3DXK B;  4CZL A;  3HST B;  1YHQ N;  2NRR A;  1TUU A;  1NGF A;  1BL3 A;  4AHC A;  3AVK A;  4ISF A;  2G8F A;  2LKB A;  3KOX A;  5J2N A;  4FJ8 A;  3HM9 A;  3TSP A;  3O9R A;  4BRD A;  2PZS A;  4YDU A;  3SUQ A;  1JKH A;  1VRT A;  1DJT A;  1NMN A;  3WQT A;  4JKG A;  2CH5 A;  5CY4 A;  2SN3 A;  3WXK A;  4CK2 A;  3TAB A;  3LAM A;  1J6Z A;  4WF9 L;  4HHF A;  3O1W A;  1E3M A;  4FK4 A;  2XY5 A;  1BOT O;  3MN7 A;  4JV5 K;  4DF4 A;  4PHT X;  1ZYQ A;  5HRR A;  5AZJ A;  4KAZ A;  2FBV A;  2ETJ A;  3FFI A;  3OYH A;  1NK0 A;  4JHD A;  2I5J A;  1NJI O;  4JKD A;  4NYF A;  2GBZ A;  1RBU A;  2YNF A;  1OH8 A;  2YIO A;  4I6M B;  4A5A A;  4B3T K;  1S9G A;  1Y97 A;  3RRG A;  4CJR A;  1U2V A;  1UOC A;  4EFH A;  2LR3 A;  2Q36 A;  3T19 A;  3OBY A;  2G8I A;  3O9S A;  4BWM A;  3HTV A;  4CBU A;  4CED A;  3AA5 X;  4CHN A;  3H1V X;  3AVG A;  1C1C A;  1BU6 O;  4GVE A;  3A0I X;  3G6E N;  1SV5 A;  3OYL A;  4Z4H A;  3FLC O;  4XJX A;  3O9T A;  3R1X A;  3VQP A;  4CJP A;  1YT3 A;  1UWB A;  4O5F A;  2YHX A;  3EE9 A;  2KLA A;  1P90 A;  4DQP A;  4I2Q A;  5CZ1 A;  2M8B B;  1RNH A;  3DLB A;  5E84 A;  1NLV A;  4J2D A;  1TGO A;  2YIL A;  4JI0 K;  4CQK A;  4O8K A;  1NU0 A;  2HOE A;  3OYB A;  2VQE K;  2HBJ A;  2E5L K;  1S1W A;  3VMF B;  1O1W A;  4FW2 A;  4B9N A;  4O8U A;  1NH5 A;  4FM1 A;  3PY8 A;  1LWC A;  3HOS A;  3OJS A;  4WQ4 C;  5C42 A;  3O9Q A;  4ZTJ A;  2CGL A;  2A42 A;  4RG8 A;  1SN4 A;  4CZE A;  1N4N A;  3TAE A;  2P9I A;  1T7E A;  2ASO A;  3S3O A;  3VQC A;  4Z4E A;  3CIP A;  2A5X A;  1RTD A;  1NBW A;  4EZ9 A;  3AAP A;  3F9M A;  4DCH A;  3DLH A;  5KGW A;  3DYA A;  5GIO A;  1T05 A;  3CJC A;  1WUA A;  4JKH A;  4TSX A;  1WSE A;  3U9Z A;  4DFK A;  2P9I B;  1L3T A;  4W5N A;  1CZA N;  3WXM B;  3WNF A;  2WUS A;  4Q5V A;  4OLB A;  4AHV A;  2XO7 A;  2P5O A;  3OJU A;  3VQD A;  5I9E B;  3E7R L;  1A5W A;  2KSK A;  4E1N A;  4CGG A;  1XQS C;  1ATR A;  3FR0 A;  5BPM A;  3S3N A;  5BRF A;  2WFB A;  3PX6 A;  4JKF A;  4JI1 K;  4UY8 O;  3VQQ A;  1KQS M;  2FBY A;  3CCR N;  1I94 K;  2KBH A;  2KBK A;  2YV0 X;  1ATS A;  4JYA K;  1JZA A;  2DFF A;  3THX B;  4CIF A;  3VES A;  3BK3 C;  1L5U A;  3VQ5 A;  3P4I A;  3QDK A;  3A5L C;  4DSJ A;  2QWL A;  4H0O A;  4JI2 K;  1IG8 A;  3UKR A;  3THY A;  3T1H K;  4RW7 A;  4Y0W A;  2O8E A;  1NGJ A;  1Z25 A;  4BRM A;  5F2R A;  3P39 A;  1K8K A;  5K14 A;  1YJN N;  4WYB A;  1FH3 A;  2HBL A;  1RDC A;  3H45 C;  4K25 A;  4DV0 K;  1QQO A;  3L2U A;  2O4I A;  3G10 A;  4E7H A;  3SUP A;  3N4P A;  4KH6 A;  4DKW A;  2JWL A;  3THY B;  4IFY A;  4B9T A;  4H0P A;  2UXB K;  5CY0 A;  3MCP A;  3NF9 A;  4RWT A;  2XHB A;  4B3R K;  2KZZ A;  1IJJ A;  1YJ9 N;  3CM6 A;  2IAJ A;  2VWK A;  1TKD A;  3FGU A;  4EZ6 A;  3TSQ A;  3AGR A;  5AFU A;  5AQP A;  1V4T A;  3KP0 A;  5C15 A;  1BG3 A;  3K5O A;  4JLH A;  2V7Y A;  3RMD A;  3DMJ A;  3GOI A;  4M3U A;  3MXJ A;  3TTD A;  4CGI A;  3FE1 A;  1JCE A;  4QS7 A;  1NJW A;  1LQI A;  1BCG A;  2BUP A;  3P38 A;  4K8X A;  5FRO A;  1EP4 A;  4DUY K;  4F2R A;  3M5R A;  1QE1 A;  4FWM A;  4EHT A;  1VQ8 N;  3HM8 A;  3QFU A;  3CJA A;  1RDU A;  2HST A;  4MLH A;  1OKJ A;  3VGM A;  3GG4 A;  1VQL N;  3R2V A;  3ZLJ A;  4AH9 A;  1UA0 A;  3SNN A;  2A1S A;  4DR2 K;  2E2P A;  1QQC A;  3AVH A;  3SV4 A;  1BCO A;  1RT7 A;  2E6L A;  2F9T A;  4OPK A;  2NRT A;  2YBR C;  4C1N I;  5ADX A;  2P5G A;  4BRP A;  3LM2 A;  5BRE A;  1N6Q A;  1VQ4 N;  4MFB A;  2Q1N A;  1CXU A;  1HPM A;  4E1J A;  2MBK A;  4A62 A;  4CJQ A;  1GLB G;  3NAE A;  1ZBU A;  1F21 A;  3EO3 A;  1AHO A;  1BHL A;  2OCE A;  3JAM O;  4DWI A;  3WXJ A;  3TAF A;  1VQO N;  3K57 A;  3LDS A;  2YHY A;  1BGX T;  1D8Y A;  1RGI A;  1KCF A;  4QS9 A;  3VEX A;  2H3G X;  4XH5 A;  1NRB A;  3P1G A;  3NDK A;  3CJ9 A;  2JGU A;  3HK2 A;  3JSM A;  3DWL A;  3HL8 A;  1I6G A;  4FK0 A;  2MN5 A;  4E72 A;  3VF4 A;  4BG9 A;  3SQ0 A;  4ICL A;  1IBL K;  3PO5 A;  2E2O A;  4BRN A;  1SL1 A;  3BZK A;  1NG9 A;  1MU2 A;  3SAG A;  4LD0 A;  2HF4 A;  3WEE A;  3QML A;  4OLA A;  3VPZ A;  2OZM A;  3E9L A;  3OY9 A;  3QBX A;  3CCJ N;  4U7B A;  3DI6 A;  4Q0B A;  4JD2 B;  4AB0 A;  1S3X A;  4OKE A;  1IG9 A;  2XY8 A;  2E4L A;  4NCB A;  1SN1 A;  1T3V A;  1U49 A;  1IBK K;  4B1Y B;  1TAQ A;  3HPG A;  2IS3 A;  3HJF A;  3QB0 A;  4JEP A;  2QW9 A;  3VA0 A;  3DOL A;  3D2E B;  2ZQB A;  4N76 A;  4OKK A;  3NGY A;  4KRF A;  3VQA A;  5FPM A;  5JLF A;  2I61 A;  2CGJ A;  1YI2 N;  4LH5 A;  4DHY A;  4K42 A;  3RMC A;  2D0P A;  3SMS A;  3D2F A;  4CJ3 A;  1L4V A;  2HHX A;  1I39 A;  3VEN A;  3T7Z A;  2MZ0 A;  4X62 K;  3HRG A;  2X74 A;  4RW6 A;  1G99 A;  1RBT A;  2ZWH A;  3CME N;  4WFB L;  1TAU A;  3CFO A;  2PY5 A;  1S1V A;  3QEP A;  3OYM A;  4KV8 A;  4CEB A;  2AP1 A;  3HO1 A;  1NGC A;  4B3O A;  3K58 A;  3V9U A;  1WSI A;  3LAN A;  4DFM A;  4W5Q A;  3J7Y P;  4WCE L;  3UKU A;  3KK2 A;  4A2A A;  3FZL A;  2Z1I A;  3OYK A;  3QET A;  4CEC A;  4KPY A;  1VNA A;  3LDP A;  2P9U B;  3AVC A;  3IAY A;  1G15 A;  3H08 A;  4KTW A;  5KPT A;  1KXP A;  4BR0 A;  4W5T A;  1TL3 A;  4JS5 A;  1T7P A;  3FZK A;  4M3T A; 
#chains in the Genus database with same CATH homology
 5EX5 A;  1RFQ A;  3GBT A;  3VTI A;  2CGK A;  4FWQ A;  4ISG A;  4OPA A;  1Q86 O;  2OAN A;  3VGK A;  1T44 A;  1M90 O;  1OVY A;  4OO1 J;  2E1Z A;  3LDO A;  4BRQ A;  2YJE A;  3SBT A;  1YVN A;  2VYP A;  1GLL O;  1BO5 O;  1GLD G;  4FOI A;  3BP8 A;  5AQQ A;  3SJH A;  1BDG A;  2E2F A;  3EZW A;  5GAE P;  5GAG P;  1RDW X;  2GTD A;  1W2B M;  3DXK B;  3LL3 A;  4BG8 A;  4EHU A;  5AQT A;  1GLE G;  2J4R A;  5AQK A;  4ILJ A;  4CZL A;  1SS6 A;  1YHQ N;  2P9S B;  2NRR A;  2YCH A;  4IXC A;  5BN9 A;  3EN9 A;  3VEV A;  3KVG A;  1TUU A;  1NGF A;  4FPB A;  3CD6 N;  2E20 A;  2PFU A;  1P8Z A;  1JJ2 M;  4ISF A;  3CQX A;  3O08 A;  4BGA A;  3TTF A;  3TSP A;  3O9R A;  1TYQ A;  3ATU A;  4BRD A;  3E66 A;  3HZ6 A;  4YDU A;  4B1V A;  2ZGY A;  2HBK A;  3WQT A;  1W97 L;  4JKG A;  2CH5 A;  2EWS A;  3NVK A;  4CZJ A;  4JK7 A;  3WXK A;  4YOW A;  2GEM A;  3CCQ N;  5M1Q A;  1J6Z A;  3AGK A;  4WF9 L;  3O1W A;  5BRH A;  1BOT O;  3IUC A;  3MN7 A;  4CD1 A;  1EQY A;  3IFR A;  4PHT X;  1X9J A;  3VGL A;  5FPE A;  2V52 B;  4DQ8 A;  5AQO A;  5JMV A;  5AZJ A;  1ZC6 A;  4BR9 A;  3HI0 A;  5GAD P;  1E4F T;  3WEE B;  2ASM A;  4JHD A;  1NM1 A;  1NJI O;  4FOE A;  4JKD A;  4KBO A;  3HBT A;  3LDQ A;  4PKH A;  4FWO A;  4IO9 L;  3VEZ A;  2YIO A;  4I6M B;  4A5A A;  4BRH A;  3A5N C;  1ILY A;  4FWL A;  3F5T A;  1HKC A;  2YHW A;  4JN4 A;  5BPN A;  1QZ6 A;  1POI A;  1U2V A;  4EFH A;  2W00 A;  2Q36 A;  4MO4 A;  3OBY A;  3M6G A;  2NNW A;  3O9S A;  2E88 A;  3HTV A;  5CR4 A;  4CBU A;  3H1V X;  4BRF A;  5AQJ A;  1BU6 O;  4GVE A;  3A0I X;  3EKU A;  3G6E N;  4XJX A;  3M3Z A;  3FLC O;  1K73 O;  3O9T A;  3R1X A;  1VQN N;  1S22 A;  3OW2 M;  1YJW N;  3I56 N;  3UE5 A;  4O5F A;  2FXU A;  4FWS A;  2YHX A;  3EE9 A;  3ZET B;  1V4S A;  4H0V B;  5BPL A;  2KLA A;  2FLO A;  3EL2 A;  1P90 A;  5KQD A;  4BEC A;  3MCA B;  3AAR A;  3O6W A;  3U4L A;  4FL9 A;  4XH1 A;  2FF3 B;  3C6A A;  2Q0U A;  4B1Z A;  2IVO A;  3ENH A;  3SK3 A;  1QZ5 A;  4H0T B;  1Q81 O;  2D4W A;  3D2F B;  3OHR A;  2YX6 A;  5TKY A;  1YIJ N;  5M1P A;  2IIR A;  4IJN A;  4CZK A;  5C2D A;  5AQH A;  3N4Q A;  3CI5 A;  3E9O A;  5E84 A;  3KHW A;  3JS6 A;  1NLV A;  3U9D A;  3B8A X;  3O80 A;  2YIL A;  4O8K A;  1VQ5 N;  2HOE A;  4GV3 A;  2HBJ A;  3CF5 L;  4FPA A;  3SLC A;  3VMF B;  1BWF O;  4MDB A;  3VET A;  3BF3 A;  4O8U A;  1GLC G;  2D0O A;  3HOS A;  1E4G T;  3MWP A;  5EXW A;  3CJ7 A;  4MLE A;  4WQ4 C;  3O9Q A;  5GAH P;  3J8A A;  2CGL A;  3GDQ A;  5AQR A;  2A42 A;  2C1G A;  3E1Y A;  1ESV A;  5AZI A;  4FWK A;  1NGG A;  5AQM A;  4CBW A;  4CZE A;  4NO7 A;  4H5V A;  3SF4 D;  2P9I A;  1Z6R A;  1ZXO A;  3UKU B;  4BC5 A;  2ASO A;  2ZJP L;  2OTJ N;  1YAG A;  4IDH A;  1HJO A;  3CIP A;  2A5X A;  1NBW A;  3SBG A;  3AAP A;  3F9M A;  3UB5 A;  2W41 A;  4DCH A;  2NRZ A;  5GIO A;  1K9M O;  3CJC A;  1NGH A;  1HKB A;  1WUA A;  4UAD E;  3QFP A;  4H5T A;  1NWK A;  2GEL A;  4JKH A;  4C1N K;  5LJV A;  1Y64 A;  4YOY A;  3CPW M;  1X3N A;  3U9Z A;  5BRD A;  4DB3 A;  3PLA A;  3MN5 A;  2P9I B;  2P9L B;  3FZF A;  1CZA N;  4WQ5 A;  3ID8 A;  3L56 A;  5CE3 A;  4BEB A;  3WXM B;  3OA9 A;  3C6H A;  3CQY A;  4BC4 A;  5FPN A;  1DKG D;  3MWT A;  5C2F A;  4CI6 A;  5AQI A;  2WUS A;  4CBX A;  3J7Z O;  3KK7 A;  1VQM N;  3DAW A;  3MN6 A;  3CCL N;  4GV6 A;  5AQF A;  5JIC A;  5LY3 A;  4M63 C;  2HBM A;  3CXC M;  5I9E B;  4A2B A;  1VQK N;  2QWN A;  3LDL A;  3O1B A;  4HTL A;  4IOC L;  4FVU A;  1XQS C;  2GMO A;  1BA0 A;  2AA4 A;  4ILG B;  1ATR A;  4FO0 A;  3CCU N;  3FR0 A;  3L4I A;  5HL7 L;  2BTF A;  5BPM A;  2ZF5 O;  3VF6 A;  3CC4 N;  4BVP A;  5BRF A;  4IO8 A;  3A8Y A;  2WFB A;  4K41 A;  4JKF A;  5BN8 A;  1H1V A;  2PAV A;  3R6M A;  4UY8 O;  3G25 A;  1QHA A;  2KKZ A;  1KQS M;  4WQ4 A;  4A59 A;  1VQ7 N;  3CCS N;  3CCR N;  1QQN A;  1ATS A;  3QI7 A;  1TYQ B;  4H0X B;  3DJC A;  4JNE A;  2QA4 N;  3R3L A;  3Q7B A;  4GV9 A;  3VES A;  4J8F A;  3BK3 C;  2K35 A;  5ADX H;  1QVF M;  1VQ6 N;  2QXL A;  3KHY A;  3P4I A;  3QDK A;  3CCV N;  1NGB A;  3A5L C;  4JKG B;  4KH4 A;  3KZB A;  2QWL A;  4H0O A;  4PKG A;  1IG8 A;  5F0X A;  4CJ7 A;  2D1K A;  3UKR A;  4JD2 A;  4G9Z A;  2VWB A;  2QWP A;  4WFA L;  2NRX A;  4Y0W A;  1KC8 O;  3ZX3 A;  1HLU A;  1NGJ A;  2A41 A;  4BRM A;  5JVG L;  5F2R A;  3P39 A;  1K8K A;  3ZEU A;  1YJN N;  1NGD A;  2QM1 A;  4WYB A;  3VF2 A;  3I55 N;  4IZ9 A;  2HBL A;  3VTH A;  5M1K A;  5F1X A;  3H45 C;  4K25 A;  1QQO A;  2GUP A;  3TU5 A;  3VEO A;  5C0Y A;  2ZJQ L;  5AZJ B;  1MWK A;  2W40 A;  3EE8 A;  3KWG A;  3N4P A;  3D2E A;  4KH6 A;  4ILH A;  2JWL A;  4JHD B;  3DXM A;  4DKW A;  4F9O A;  4GNI A;  4H5N A;  4H0P A;  4BR2 A;  3MDQ A;  1DGK N;  3CCM N;  4IJA A;  4WFN L;  3MCP A;  4A5B A;  1GLF O;  3SMP A;  2GWK A;  4RWT A;  1KAZ A;  1IJJ A;  1YJ9 N;  3PIP L;  3IMX A;  3FGU A;  3TSQ A;  2VCP A;  2WBN A;  3AGR A;  1HKG A;  3L4Q A;  4CZI A;  3WQU A;  5AFU A;  5AQP A;  2E2Q A;  3BUZ B;  2FSJ A;  1YIT N;  3IKM A;  4JK8 A;  1V4T A;  4BR4 A;  4IFE A;  3LDN A;  5C15 A;  4KH5 A;  1BG3 A;  1U2V B;  3H46 O;  2V7Y A;  4EIA A;  4H0Y B;  4WQ5 C;  3GOI A;  4BRG A;  2VGM A;  4QS8 A;  1XUP O;  3TTD A;  3CCE N;  3FE1 A;  5AQU A;  5AQX A;  3MX5 A;  4Z94 A;  1JCE A;  4JKA A;  1KAX A;  4QS7 A;  2NRW A;  5DM6 L;  1JCF A;  4XH4 A;  3ENO A;  4EAH D;  2NZT A;  3G4S N;  2BUP A;  3P38 A;  4B1W B;  2Q2R A;  3ENB A;  4OPH A;  2YJF A;  2UYT A;  4XEI A;  1MDU B;  3QBW A;  5ELZ A;  4BQZ A;  1KAY A;  1D4X A;  3M5R A;  3NVM A;  4NLC A;  1NMD A;  3RSE A;  5E26 A;  4YOR A;  1GLJ O;  4FWM A;  3O8M A;  1Q18 A;  3I33 A;  4EHT A;  1EO1 A;  3H6E A;  1VQ8 N;  3ZX2 A;  3F2K A;  4BR5 A;  5M1F A;  1KD1 O;  4B1U B;  3U8X A;  3HM8 A;  3QFU A;  3CJA A;  3FFK B;  1GLA G;  1RDU A;  4JAX A;  2HST A;  4MLH A;  4BVO A;  3W3D A;  1N8R O;  1OKJ A;  3VGM A;  5C10 A;  3GG4 A;  1VQL N;  4BRL A;  3R2V A;  3HSC A;  5DM7 L;  1MA9 B;  1HUX A;  3E9P A;  5AFU H;  2YI1 A;  4H03 B;  3ZYY X;  2E2P A;  2E1Y A;  2IVP A;  3L6Q A;  2P9U A;  3PIO L;  3EKS A;  4AF1 A;  4IEI A;  1R59 O;  4BRA A;  4RTF D;  2BH1 A;  4L3Q A;  1LCU A;  2F9T A;  2VGN A;  2ITM A;  4BRI A;  5KPZ A;  2P9N A;  2NRT A;  1SZ2 A;  4LC9 B;  4UAE F;  1QQM A;  5JVH L;  3FZM A;  2ZGZ A;  5AZI B;  2QWO A;  4A57 A;  4C1N I;  5ADX A;  4YOU A;  5LJW A;  5EVZ A;  3H3N O;  4BRP A;  3LM2 A;  2P9P A;  5BRE A;  1VQP N;  5B8H A;  4IOX A;  1VQ4 N;  4K43 A;  1YXQ A;  3CJ1 A;  4JKC A;  4YOT A;  5EY4 A;  2A40 A;  2ASP A;  2Q1N A;  1K8A O;  3I8B A;  2QWM A;  2NLX A;  2LN8 A;  1HPM A;  2Q97 A;  4E1J A;  3DXK A;  2MBK A;  3CHW A;  4BY9 C;  5FPD A;  2P9K A;  4FWP A;  4A62 A;  2RE2 A;  1GLB G;  4M7Y A;  2I7N A;  2D56 A;  2P9S A;  3GE1 A;  2P9P B;  4FWR A;  3O5B A;  2QTD A;  3Q7C A;  3CW4 A;  4HWI A;  2RHK A;  4H5W A;  3EO3 A;  4M7X A;  3TSU A;  5EOY A;  3TTC A;  1T6D A;  5GIN A;  1JCG A;  2GX9 A;  5C12 A;  3WXJ A;  4AM6 A;  1NGI A;  1VQO N;  2FSN A;  4BRE A;  5AQL A;  2YHY A;  3ID6 A;  2P9K B;  1RGI A;  3R8E A;  1WOQ A;  2KHO A;  4QS9 A;  3VEX A;  2H3G X;  4XH5 A;  2VY6 A;  4CZF A;  2OTL N;  3CJ9 A;  1X3M A;  5BR9 A;  1Q7Y O;  5M1O A;  4BC2 A;  3DWL A;  4IWV A;  4NB4 A;  4GY2 B;  3WUH A;  3NMU A;  2MN5 A;  5AQN A;  3VF4 A;  3K9J A;  1HX1 A;  4BG9 A;  2QEX N;  3G71 N;  2E2O A;  4MDA A;  4BRN A;  2Q0R A;  5AQY A;  2A6A A;  1BA1 A;  3CPE A;  4IOA L;  1C0F A;  1U6Z A;  5KPR A;  3CC7 N;  3O9U A;  3SAG A;  2HF4 A;  1YUW A;  4B9Q A;  4CD3 A;  3WEE A;  3QML A;  3DLL L;  3MN9 A;  2DPN A;  3VPZ A;  3C65 A;  5MLC Q;  1SQK A;  3E9L A;  2WC9 A;  2JDQ D;  3D7E O;  4JK9 A;  5KQ8 A;  2E8A A;  3QBX A;  3CCJ N;  3BF1 A;  3W0L A;  4U7B A;  4BRC A;  2FSK A;  3IDH A;  1XC3 A;  3UKR B;  4H5R A;  4JD2 B;  5AQV A;  4U67 L;  3KWI A;  4I6M A;  1MWM A;  5H1S Q;  3HOT A;  4PKI A;  1S3X A;  4BRO A;  3QIC A;  2CH6 A;  3CET A;  3C7N A;  3A5M C;  1VAZ A;  3ZEU B;  1K8K B;  1T3V A;  3P31 A;  4BQL A;  4B1Y B;  3WXL A;  5CHI A;  1QVG M;  1S72 N;  3QB0 A;  4C23 A;  2YIP A;  4JEP A;  2QW9 A;  1NGA A;  1C0G A;  5M1N A;  4UAF E;  4BGB A;  4RCH A;  5AQG A;  3S41 A;  3VEY A;  5JLH A;  4YOX A;  2QI2 A;  3JXU A;  3D2E B;  3DXM B;  2JWK A;  5AQZ A;  2ZJR L;  2V7Z A;  3OBW A;  4BC3 A;  3ZET A;  3C7N B;  4BR7 A;  5FPM A;  5JLF A;  4IEE A;  4FSV A;  4MO5 A;  3WT0 A;  4YOV A;  3H3O B;  2CGJ A;  4B1X B;  2IVN A;  3MMV A;  1YI2 N;  3CC2 N;  2F7T A;  4BE7 B;  4DHY A;  4K42 A;  2A3Z A;  1M1K O;  1Z05 A;  2QWR A;  2D0P A;  3SMS A;  3ULE A;  4CZH A;  5TKW A;  3D2F A;  2C1I A;  2GWJ A;  3M1F A;  3K9K A;  1SAZ A;  3CER A;  5GIP A;  3VEN A;  4CZG A;  3T7Z A;  5AR0 A;  2HF3 A;  3A5O C;  3C0B A;  3HRG A;  5HOO A;  4A61 A;  1G99 A;  1DT9 A;  1YF5 L;  3H1Q A;  2ZWH A;  3CME N;  4BRK A;  3VER A;  2HMP A;  4WFB L;  1ZBS A;  3ULE B;  3D6R A;  2NRV A;  3SAH A;  1ATN A;  2PBD A;  3RVC A;  1T6C A;  2AP1 A;  1NGC A;  3AY9 A;  1O13 A;  5AQW A;  3RSE B;  1BUP A;  1DEJ A;  4PL8 A;  3WXI A;  4PL7 A;  2FF6 A;  1VQ9 N;  3T69 A;  2QWQ A;  2V51 B;  3MK6 A;  4WCE L;  4YDU C;  4NLB A;  1TUY A;  4FWN A;  3UKU A;  4AM7 A;  3VOV A;  4JKE A;  4A2A A;  3FZL A;  2NRH A;  2Q31 A;  3MX2 A;  4CZM A;  2F9W A;  3ZX0 A;  3LM9 A;  4ISE A;  3CMA N;  3R9P A;  1NGE A;  3L0Q A;  3LDP A;  4JKB A;  2P9U B;  3SAF A;  3TPQ A;  4R79 A;  3BEX A;  3O4W A;  3VEW A;  1LOT B;  3GL1 A;  1Q82 O;  2P9L A;  3AAQ A;  5KPT A;  2E2N A;  1KXP A;  3FZH A;  4BR0 A;  2P9N B;  3CJB A;  2I7P A;  5AQS A;  3FZK A;  3ATV A;  3KC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...