3GL1A

Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
383
Chain Sequence
b'AEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein SSB1
publication title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 124
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3gl1A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3gl1A04
5AQSA 2AA4A 2Q36A 3W0LA 3WT0A 3JS6A 4BVPA 5LJWA 1JCEA 1SAZA 3FGUA 1K8KA 3KHYA 1HX1A 2YHWA 3B8AX 3I8BA 4MO5A 2P9IB 1TUYA 4Y0WA 1XC3A 4E1JA 5EX5A 3R8EA 1BA1A 3R9PA 5AQFA 2NZTA 2CGJA 4NB4A 4BRNA 2YHYA 1LOTB 5CE3A 4BRDA 3FR0A 5JICA 4WQ5A 4DHYA 5BRHA 1K8KB 3LM2A 3WEEA 5KPRA 5EY4A 2GTDA 5F0XA 3H1QA 1QQNA 4RWTA 3G25A 3WXIA 4H0OA 2GEMA 4BC2A 3U9ZA 3A8YA 4IZ9A 5E84A 2E8AA 1S3XA 1RDWX 4L3QA 4H5TA 4RCHA 5KPZA 3FZHA 4JAXA 2Q0UA 1X3NA 2IVNA 4BGBA 2IIRA 4H5WA 3ENOA 2VWBA 1J6ZA 3WEEB 5JLHA 2E2OA 3FZLA 5AQOA 2UYTA 5AQTA 3C0BA 3VF6A 3GOIA 3O5BA 4H0PA 3TU5A 3VGKA 4B1WB 2HOEA 1T6CA 4BR5A 2PBDA 5AQKA 1HKGA 2FF3B 3BUZB 1ATRA 4FWSA 3DXMA 4EHUA 4GNIA 3CETA 3L0QA 3ENHA 2QWOA 1HPMA 4O5FA 2ZGZA 5AZJA 2FF6A 3R6MA 1QZ5A 3L6QA 1RGIA 2V51B 2E1ZA 2D0OA 3MK6A 4GY2B 3EO3A 5AQVA 1QQMA 3VPZA 3D2EA 4IJNA 3IUCA 3SMSA 3A0IX 4K43A 4PKGA 1MDUB 3ZX3A 2Q97A 4H03B 1CZAN 5AZJB 2F9WA 1YUWA 4FSVA 3SK3A 2KHOA 5AZIB 4BRAA 1Z6RA 1H1VA 3CHWA 4H5NA 3FZKA 4CZHA 5FPNA 4DCHA 4CZFA 2BUPA 1BUPA 2A5XA 4XH1A 3F9MA 3CJAA 4BROA 2PAVA 5FPDA 2QWNA 2YCHA 1LCUA 3EKSA 4PL7A 2Q0RA 3HBTA 3O08A 2QWMA 3CQYA 4MLHA 1E4GT 1NM1A 1T44A 1X3MA 5AQHA 3DJCA 1EQYA 3U9DA 3UKUB 5BPLA 5AFUH 4B1YB 2VCPA 3LDLA 3GL1A 4YDUC 1DKGD 3WQUA 4BC5A 2Q31A 3CJ1A 1T6DA 3VEVA 2VYPA 4BRMA 4CD1A 5ADXA 3O80A 4CZGA 1HLUA 4BR2A 4CBXA 3D2FA 5ELZA 4ISFA 4J8FA 5AQWA 3H46O 4AM6A 4QS9A 3VENA 3M1FA 2P9LB 1BG3A 4BREA 3FFKB 1GLDG 1RFQA 1NBWA 3W3DA 4DQ8A 2V52B 3A5NC 3AARA 4FWKA 2ZGYA 3QDKA 3D2FB 4CZIA 4JHDA 4DB3A 1BOTO 3WUHA 2FLOA 2HF3A 2P9KA 2AP1A 2A6AA 4FOIA 3VEYA 4MO4A 2E2NA 4YDUA 4BC3A 2P9PA 1HKCA 3CERA 3VF4A 3LDQA 1D4XA 1WOQA 1WUAA 1Z05A 4CZJA 4CBUA 3MN5A 4BQLA 5BR9A 3DAWA 4JHDB 2ZWHA 5F1XA 2P9KB 4BG9A 5AR0A 4BRPA 3GG4A 2P9PB 4KBOA 2I7NA 3VOVA 2FSNA 1ESVA 1V4TA 1G99A 2H3GX 3WQTA 4HWIA 2Q2RA 3VGLA 1YXQA 2CH6A 3RSEA 1Y64A 4B9QA 3CQXA 2YI1A 5AQLA 2GELA 3LL3A 3MCPA 3UB5A 4LC9B 4FWPA 2IVOA 2ZF5O 3H3NO 5AQXA 3FZMA 2QWRA 2GUPA 4JN4A 3RSEB 4PKHA 5AZIA 4EAHD 3CIPA 4H5VA 1MA9B 1ZBSA 2QWQA 2V7ZA 4CJ7A 4WQ4C 3O1BA 2E1YA 1NGAA 3I33A 3U8XA 4M7YA 2E88A 5EXWA 3IFRA 3SJHA 2YJFA 2BTFA 3SLCA 4IO8A 5AQNA 1DGKN 3HZ6A 1KXPA 1NGFA 3BEXA 5FPMA 3ZETA 4ISGA 3M6GA 1C0GA 4WYBA 4H0VB 1P8ZA 3LDNA 3UKUA 1DEJA 5KPTA 3ATUA 4ISEA 1XQSC 3VERA 4EIAA 5AQYA 3VF2A 1NGHA 5BREA 4CZKA 1BA0A 3AAQA 3VEZA 5JLFA 3ID8A 2ASMA 1GLCG 1U6ZA 3ZETB 3JXUA 5BN9A 3CJBA 3AAPA 3BF1A 4BRHA 3MMVA 2P9UA 4PKIA 3ATVA 4FPAA 5EVZA 5EOYA 5AFUA 1NGCA 5KQ8A 1BU6O 1V4SA 2D1KA 2W40A 2P9LA 4NO7A 1YAGA 5BN8A 4K41A 4BQZA 1ZXOA 3WXJA 3HSCA 1KAZA 2Q1NA 1KAXA 1NGGA 4CZMA 3ZX2A 1NGBA 3QB0A 5BRFA 2P9UB 5AQUA 3LDPA 4A61A 1NGEA 4C23A 4CI6A 4WQ5C 2QWLA 2A41A 3CJCA 3GE1A 1ATNA 1X9JA 1HJOA 3QBWA 4BRQA 4FL9A 3QMLA 5LY3A 2YHXA 4QS7A 4F9OA 4CD3A 4FOEA 1IJJA 2CGLA 4IJAA 3VEWA 1SQKA 3CJ9A 5AQPA 4IXCA 5TKYA 3MN6A 3KZBA 2QXLA 4H0TB 3H45C 3VEXA 2ASPA 3EZWA 2IVPA 3H6EA 2NLXA 1XUPO 4HTLA 1NGIA 5AQIA 5FPEA 1E4FT 2YJEA 1NGJA 4CZLA 3UKRA 4AM7A 1BWFO 3FZFA 5BPNA 1MWKA 3CI5A 3VETA 2I7PA 3MN7A 3O1WA 2HF4A 1TYQA 1OKJA 1S22A 4FPBA 2ITMA 2E2PA 2V7YA 2CH5A 2FSKA 4XH4A 4A2BA 3SMPA 2D4WA 1NWKA 3L4IA 1U2VA 3FE1A 3O8MA 3UKRB 4H5RA 2QWPA 3GDQA 3BF3A 3FLCO 4XEIA 4MLEA 4BRGA 3BP8A 3IMXA 2E2QA 1TYQB 3QICA 3EKUA 4BR0A 3IDHA 3LDOA 1NMDA 5I9EB 4Z94A 1GLLO 1U2VB 1QZ6A 1GLEG 3QFPA 4O8KA 4BGAA 3VGMA 1KAYA 4H0YB 2E20A 4BRLA 4FWOA 1QQOA 5KQDA 2P9SA 4BVOA 4JD2A 2WUSA 4B1XB 4I6MA 3C7NA 2GWJA 2EWSA 2NRHA 3O6WA 2A40A 3EN9A 3HTVA 2GWKA 3EL2A 1Q18A 2F9TA 1YVNA 1HKBA 5AQMA 5BRDA 3CJ7A 1GLBG 4FO0A 4B1UB 1R59O 2P9SB 3A5LC 4JD2B 3KVGA 1HUXA 1TUUA 4I6MB 3C7NB 3S41A 4XH5A 4A62A 3DWLA 1GLJO 2ASOA 3QFUA 1GLFO 3P4IA 3QBXA 3UE5A 4CBWA 4EHTA 3ULEA 4B1VA 3U4LA 1IG8A 1BO5O 3WXLA 2DPNA 1C0FA 4PL8A 3TPQA 3DXMB 4BRFA 1QHAA 3O4WA 5AQZA 4CZEA 2QW9A 4IWVA 2OANA 5E26A 2QM1A 3AY9A 5B8HA 1MWMA 3A5OC 2A42A 4K42A 2D0PA 4WQ4A 3ULEB 2FSJA 3H3OB 4JNEA 3D2EB 4RTFD 3ZEUA 4BR9A 4M63C 1ZC6A 4FWLA 1SZ2A 4A2AA 4BR7A 2J4RA 2CGKA 1JCGA 5AQQA 3GBTA 5AQGA 1BDGA 3LM9A 2P9NA 4BRIA 2W41A 3M3ZA 4FWQA 3H1VX 3VEOA 4H0XB 3DXKA 5AQRA 3OHRA 2HMPA 1JCFA 4QS8A 4FWNA 4FWMA 4B1ZA 3MN9A 3WXKA 5LJVA 3HM8A 3VESA 3ZEUB 5BPMA 3ZX0A 4BRCA 4BRKA 4FWRA 2FXUA 4M7XA 3HI0A 3J8AA 2P9NB 5F2RA 4BG8A 3MDQA 2P9IA 5ADXH 4K25A 5JMVA 4BC4A 1NLVA 3DXKB 4BR4A 2A3ZA 3A5MC 1ATSA 1NGDA 4EFHA 5AQJA 3D7EO 1GLAG
chains in the Genus database with same CATH superfamily
2Q36A 4N5SA 3WT0A 2C1GA 3E9OA 3AO4A 4BVPA 4O8UA 4MDAA 1K8KA 2VQFK 3KHYA 4JK9A 3I8DA 2P9IB 1B9DA 3NVMA 4K8XA 5TKWA 3BY5A 3R9PA 5AQFA 2CGJA 3K5MA 5MLCQ 3CMAN 1C0TA 5HLFA 1BRZA 2YBRC 3FR0A 4ICLA 5JICA 1K8KB 2E5LK 5KGWA 4CECA 3I55N 4Z4HA 4H0OA 4LFBK 4BC2A 2HHVA 4IZ9A 4OGCA 4KHWA 2UUBK 2E8AA 3PUFA 4RCHA 4IOXA 2YIPA 4AHRA 2IIRA 1KRPA 2B6AA 3R1XA 2E2OA 2AJQA 2UYTA 3VF6A 5AQTA 3GOIA 2W42A 4HUGA 1KLNA 3MXIA 1HYSA 3OYCA 4CF2A 1NJIO 4H0PA 4B1WB 4E89A 3DOKA 5KRTA 4BR5A 2G2KA 4CGIA 4KHNA 1QSSA 2KZZA 3MEEA 3MAQA 4FLTA 1VQKN 3DXMA 4EHUA 5D3GA 1VQ8N 1NJYA 3THYA 1HQEA 3T7ZA 3R6MA 3VA0A 1QZ5A 1RGIA 4NYNA 2YIOA 2D0OA 4BWJA 1RBRA 3OS0A 4CGFA 1QQMA 1T8EA 4WFAL 2D5RA 3KP0A 4K43A 2Q97A 1WBDA 1A5VA 2HMIA 3L2WA 3THYB 3NAEA 5AZIB 3LP1A 1BHLA 3KC6A 4IKFA 4CEBA 1HYZA 4CJFA 4CHNA 4FJ9A 2JLEA 4BACA 1VHXA 4DCHA 4C8KA 1KVAA 3GKUA 2A5XA 1PTXA 1JZAA 3M5RA 3F9MA 5FPDA 2YCHA 1OH5A 2I5JA 3QIPA 2ZQBA 3VQ4A 5FROA 1X3MA 5AQHA 1LQIA 1OMYA 1P90A 3VQ7A 3U9DA 4J2DA 1B7DA 4IEEA 2LY5A 1Z25A 1VQ6N 2FBYA 1HR0K 5E41A 1KFDA 4OLBA 2FBXA 3ALYA 1T6DA 4GW6A 4JI6K 1N33K 4BRMA 1KCFA 2ATBA 4IBNA 1C6VA 1T7BA 4F3OA 5ELZA 3L2RA 1VSLA 2B5JA 2E6MA 4N47A 3H46O 4LFAK 3DRRA 2N66A 4AH9A 1O13A 3KIOA 2FBVA 4DFKA 4H4MA 3AARA 4DU4A 4N41A 1TK5A 4FWKA 2ZGYA 4M3XA 3AGKA 3WUHA 2P9KA 2AP1A 2A6AA 3PV8A 3C65A 4YDUA 3OYBA 2UXDK 1QSLA 3CFPA 3LDQA 1WOQA 1WUAA 1Z05A 5C2DA 3VQ6A 4UAFE 2IOCA 2GL1A 5BR9A 4OX9K 4E7IA 1D5AA 2P9KB 2UU9K 3PIOL 4BG9A 3GG4A 4PQUA 4KBOA 3VOVA 4F2SA 4X62K 2FC0A 4WFNL 1LQHA 3WQTA 1WT7A 2YILA 1ASUA 2HHWA 2UUAK 2W6LA 4CK2A 3RSEA 4IEIA 3LPUA 2PZSA 4AHSA 1JLAA 3QEPA 5AQLA 4A5AA 3LL3A 1JLFA 4DTRA 3UB5A 3LWMA 2JWKA 4O5BA 4FW2A 4FWPA 4LC9B 2IVOA 2ITGA 4RG8A 4CJEA 4MDBA 4AILC 1W97L 4HHFA 2GUPA 4JN4A 3RSEB 3ZSWA 3J81O 3B6OA 3CIPA 3P31A 1X9WA 1ZBSA 4BEBA 1UAXA 2F8TA 3L3VA 1NGAA 3AA4A 1VSKA 3HVRA 3AVJA 5HRPA 2KJAA 2BTFA 4F2RA 4IOAL 2NY9X 1XRSB 3J7AP 5AQNA 3WNHA 1ZBHA 5M1OA 3RWUA 2P5OA 1NGFA 5KK4A 1T05A 4WYBA 1NK5A 5KPTA 4FJIA 3ATUA 3SUOA 1XQSC 1CXQA 3LALA 4IDHA 1NKCA 3CMEN 4DWIA 3QEVA 3AO5A 1LW2A 4B08A 3AVFA 3VEZA 1DTTA 1NK7A 3ID8A 2ASMA 4DFPA 3HP6A 3G4SN 3HK2A 2RKIA 1ZBIA 1D9DA 3MMVA 3ZT3A 5EVZA 5KQ8A 3CQ8A 3P83D 2EX3A 1JLQA 2P9LA 3IKMA 3ZT0A 4F3TA 1QE1A 1KAZA 2Q1NA 1W2BM 4WF9L 2B3CA 2XRIA 4CZMA 4OKJA 3ZT1A 2BGGA 5AQUA 1NGEA 1QVFM 3NHGA 4LF7K 4FJGA 4NXMK 2QWLA 4GVEA 3CJCA 4JI2K 1HJOA 4FJ5A 3RRGA 4E7HA 3CC2N 5I3UA 2GUIA 4F9OA 4CD3A 4FOEA 3VQCA 4DFMA 3VEWA 1SQKA 1VAZA 3CJ9A 2UXCK 5AQPA 1SL2A 5TKYA 3SJJA 4M3WA 4KTWA 3VEXA 3OYDA 3DRSA 4DV3K 3H6EA 5C12A 3PO5A 4ILGB 5AQIA 1ZVGA 1IO2A 1B3CA 1E4FT 2YJEA 1NJWA 5M1KA 3CCMN 4QCLA 5BPNA 3V9ZA 3CI5A 1IBLK 3MECA 3NH2A 3O1WA 5M1PA 4FJKA 5DM7L 4LH5A 4FPBA 4JKGA 4CEAA 3UIQA 1JLEA 2CH5A 5GAGP 3HM9A 1X9MA 3SMPA 4CJQA 2D4WA 4KFBA 2XY6A 3O8MA 4CK1A 2X6SA 2HHTA 1M1KO 1KV0A 5JVHL 4FLWA 3IMXA 4KHPK 1YF5L 5J1EA 3HO1A 3TTCA 1X1PA 1WSFA 4JKGB 3SQ2A 3SPYA 4OKEA 4O0JA 3LP3A 2E2FA 5HROA 4BRLA 1FH3A 5KQDA 4B1XB 3CCQN 4I6MA 4DSKA 1YJWN 4ILJA 3OS1A 4AHUA 2GWKA 3EL2A 4BDPA 2F9TA 3SQ0A 1NPIA 3J7ZO 3PIPL 1RILA 4I2QA 4FO0A 4IFEA 2ASCA 2BE2A 4CJUA 1LQQA 3OYJA 4B1UB 3SBGA 2ATQA 4EP4A 4MQ3A 4M41A 3KVGA 1ASVA 1HUXA 1TVRA 4I6MB 1YJNN 3S41A 4XH5A 5HRRA 1WSEA 4ELTA 1IKYA 3LWLA 3PX4A 3DWLA 4DMNA 3TAMA 3AVCA 1LW0A 3ITHA 5SZTA 3ULEA 1RBTA 3U4LA 2HVIA 4FW1A 4BRFA 5AQZA 3CCVN 1Q82O 2QW9A 4B8AB 3MEGA 3AY9A 2HB5A 4KH4A 3A5OC 1SUQA 1BGXT 2O8EB 3ULEB 1TL1A 5I42A 4RW4A 4JNEA 2FSJA 3ZEUA 1KTQA 3JAMO 3TWHA 3MX2A 3JSMA 4M63C 4A2AA 2WTUA 3GBTA 3SAFA 2W41A 3KOYA 1IKXA 3QINA 3H1VX 1E3MA 2ZJPL 4ID1A 3CC4N 2HMPA 3VQDA 1RDAA 4FWMA 4NCGA 3MN9A 3WXKA 4B3RK 3M8RA 3ZEUB 4BRKA 1IG9A 3TAQA 3EE8A 5ADXH 1UWBA 4BE0A 3HP9A 3TSUA 1RTJA 5FLXO 1ATSA 4EFHA 4YOWA 3CFRA 2QKBA 3D7EO 1OVQA 1GLAG 2WONA 4DKWA 5AQSA 3W0LA 2R7YA 3JS6A 1JCEA 4DQQA 1BMRA 3AGRA 2HNZA 3KK1A 2O8DA 4E1JA 5HOOA 3R8EA 1A5WA 4A5BA 4DTUA 4GVMA 1LOTB 2EHGA 4BE2A 3HYFA 3QETA 2YKNA 2ZD1A 5BRHA 3LM2A 3WEEA 5KPRA 2GTDA 1VQ9N 3OYFA 1QQNA 1BCGA 4JK8A 1HRHA 3ZCMA 3U9ZA 1VQ4N 3J7YP 3QNNA 3E01A 4CHPA 4L3QA 4H5TA 1DT9A 3FZHA 2G8HA 4DR5K 2A7TA 3C6UA 2HNYA 3NE6A 1X3NA 1C1AA 1PX9A 4HVJA 4C8OA 1J6ZA 3WEEB 1TL3A 4U7BA 3FZLA 1VSJA 3C0BA 4Q5VA 4OLAA 5HRSA 4HHTA 4NLCA 1ZU3A 1L5UA 3TU5A 4CVNE 3THWA 2HOEA 4M3ZA 1T6CA 2VY6A 2JGUA 4DG1A 1HKGA 1RBSA 4JI4K 1VSFA 4FLVA 1ATRA 4CJKA 4FWSA 1IBMK 4GNIA 3G10A 1ZBUA 2G8IA 2WOMA 2ZGZA 1TKDA 1TAUA 3THWB 4LSLA 1CZ9A 3L6QA 1RT6A 4KAZA 2V51B 4JLHA 3E7RL 3L2VA 2E1ZA 2LJ7A 4FXDA 1X9SA 1AYJA 3VPZA 3D2EA 4IJNA 3IUCA 4PKGA 1L3UA 1MDUB 5GADP 2OPRA 3TAPA 1CZAN 2F9WA 2KFNA 4M45A 3V4IA 3IS9A 5AJ3K 1QHTA 3AVBA 5FPNA 2BUPA 4M3YA 4XH1A 3CJAA 1LWFA 3LP2A 3EKSA 4X64K 3VQ5A 2QWMA 3FFIA 1NM1A 4KH5A 3QEIA 1SL1A 3CCEN 3DJCA 4DV6K 5BPLA 4B1YB 1CN2A 3LDLA 3GL1A 4YDUC 1YIJN 4BE1A 3AVKA 1TK0A 3OVNA 4I9LA 4BDZA 4PHTX 4WE1A 4DSIA 2NNWA 4A59A 5ADXA 4CZGA 1HLUA 4BR2A 2XO7A 3PY8A 3L4QA 3K9KA 4J8FA 2JWLA 5AQWA 3TANA 3I56N 2JDQD 1RDBA 1RFQA 1FJGK 3KKRA 4DQ8A 3SZ2A 4JKCA 4CERA 3OA9A 2P1JA 1HPZA 1ZYVA 1HNVA 2HF3A 4FOIA 1KD1O 4UAEF 3E1YA 3D6RA 4BC3A 1N8RO 3RVCA 1HKCA 4Z4GA 3CERA 3VF4A 1I6FA 2N2RA 3SBTA 3SQ4A 4CBUA 4JKHA 3MN5A 4BQLA 4FJXA 2P51A 2HHXA 3KOZA 1RDCA 1XHZA 1NK6A 1Q8IA 1S1VA 1POIA 2X78A 2VG6A 2HHSA 4BRPA 4ZTFA 2G8VA 2NRTA 1V4TA 2H3GX 3CM6A 1DLOA 2GX9A 3BK3C 2N69A 2Q2RA 1N5YA 4EZ6A 2GMOA 5KTQA 1K9MO 4CJ3A 3CCSN 2G8KA 4CGGA 4FJHA 4CW7B 4HCBA 4M42A 3CQXA 4JI8K 2GELA 3KLGA 1EXQA 4B9TA 1LV5A 4KKOA 1I3AA 3OS2A 1NJZA 1ZBFA 3QERA 4FM2A 1BCOA 2KBKA 5AZIA 1K8BA 4Z4IA 2HVHA 4EAHD 1OH7A 2OPSA 4CF8A 2V7ZA 4CJ7A 4YOVA 4WQ4C 3O1BA 1WAFA 3AA3A 1SKWA 4G9ZA 1LWEA 3O9TA 3QLHA 5EXWA 3IFRA 2OPPA 5GIPA 5KRSA 1DGKN 2XY5A 3HZ6A 1KXPA 2OTLN 1HMVA 2I61A 5FPMA 4YY3K 4ISGA 1C0GA 4H0VB 3HPGA 3LDNA 2YNGA 3HOTA 3KK2A 3CF5L 2YV0X 2QEXN 3KD1E 5CYQA 2PYJA 4RW8A 4DR1K 4JYAK 1MU2A 3T1HK 1NMNA 5AQYA 4B8CA 4EZ9A 5BREA 1BA0A 2Z1GA 5JLFA 2O4IA 3JXUA 5BN9A 1WLJA 3DRPA 4CJLA 4PKIA 3ATVA 4FPAA 1NGCA 1BU6O 1V4SA 3P39A 4O44A 4DV4K 4K8ZA 3RTVA 4LF8K 2NUBA 1YAGA 1Q86O 3L8BA 2XHBA 5IT9O 4KHUA 1SS6A 3SUNA 2QKKA 4CEZA 5HRNA 2W6KA 1ZFUA 3KLFA 3TARA 2A41A 3EZ5A 3GE1A 1Y97A 4DTOA 1ICAA 1G15A 2YHAA 4BRQA 3G71N 2YHXA 4QS7A 1IJJA 2E0HA 1Z26A 3NFAA 3M8PA 1L4VA 1OH8A 4LY7A 4IXCA 3TAEA 1BK8A 3MN6A 3KZBA 4CEQA 4H0TB 3WXMB 3H45C 4CJTA 1NK8A 4ILHA 2IVPA 1S1XA 1RDUA 2VG7A 4Z4EA 1I2UA 1XMQK 4AM7A 4OO1J 3FZFA 1VSHA 4DU3A 3MN7A 4FJLA 1TYQA 1OKJA 4DSLA 2ITMA 4IOCL 1FKOA 1CHZA 4DF4A 4A2BA 1RCHA 2F8SA 1VK0A 2ZE2A 1NWKA 1U2VA 4B9MA 3O4QA 4YHHK 1L3SA 2QWPA 4BRGA 2B4JA 2HHIA 1SKRA 4LD0A 1TYQB 1HYVA 3EKUA 4BR0A 3BGRA 3IDHA 3KP1A 3K57A 4E7LA 1NMDA 4OPHA 5I9EB 1EWQA 4W5RA 2LR3A 1GLLO 1U2VB 1QZ6A 3PSMA 1SN4A 4BGAA 1VSEA 2D0BA 3VGMA 1KAYA 1LAWA 4Y1DA 3NGYA 3KWGA 5HBMA 3E9PA 4M3UA 4JD2A 2WUSA 4CF1A 3LZIA 3AO1A 1ZUTA 3C7NA 4YOYA 2EWSA 1VQON 4KI6A 2A40A 3HTVA 4DTSA 3SUQA 4DU1A 2WFBA 3TSPA 3BDPA 3LPTA 1NK9A 1QTMA 2FBTA 3S5TA 1SNBA 1GOAA 1K8AO 4IFVA 3A5LC 4JD2B 1TUUA 3C7NB 4GV6A 3PO4A 3DOLA 2LI7A 1JXBA 3ID6A 4HCCA 3C6AA 3VQEA 2ASOA 3QFUA 3UE5A 3EY1A 3WXLA 5FRMA 4PL8A 1C56A 4G1QA 3O4WA 3KTQA 1U04A 4IWVA 1IKWA 5E26A 4L8RB 4H4OA 2HW3A 2E4LA 3G6EN 3F5TA 1MWMA 4C1NK 1XI1A 3CW4A 4FK0A 4UJ0A 4WQ4A 4CFCA 1JJ2M 4JV5K 3DLRA 3H3OB 3NGZA 4OKKA 2IGIA 2NRVA 4BR9A 4FWLA 4N56A 4BR7A 1WSHA 2J4RA 1VQ5N 1JCGA 4NCBA 5AQGA 1BDGA 3NDKA 1YHQN 3CYGA 3J80O 3NF8A 1TI5A 2N2QA 1RBUA 1YVUA 4GKKK 3VA3A 5AQRA 3OHRA 4QS8A 1S6QA 2LY6A 3KKSA 4B1ZA 5LJVA 4KB0A 3LZJA 3OYAA 3AVLA 4M7XA 1J5EK 3AA5X 4BG8A 3MDQA 3K5NA 3ZSZA 4K25A 5JMVA 4BC4A 4CFBA 4JI3K 4BR4A 1IBKK 2MZ0A 3OJUA 1BL3A 1NGDA 2HBLA 1JKHA 3PLAA 2KBJA 2AA4A 1ZYWA 3ZSOA 5LJWA 1P0AA 1QSYA 4ELVA 4HE7A 1GPTA 3B6PA 2E3GA 3I8BA 3ENBA 1TKZA 5CHIA 1TUYA 4Y0WA 5DK5A 1BA1A 2KQ2A 4NB4A 2NZTA 4BRNA 4R79A 5CE3A 4FJMA 2SN3A 4B9UA 1FXXA 4E0DA 4OPJA 4YOXA 5EY4A 3LAKA 4RWTA 2DFEA 2GEMA 3A8YA 4BECA 1RDWX 3RMBA 3O9SA 3V1OA 3M8QA 3ENOA 1RTIA 4FM0A 1SL0A 2M8BB 1RTDA 4JKFA 4JI5K 1CXUA 4J2BA 1TV6A 3ZT2A 1S72N 1OVYA 4KHQA 1SEGA 2RN2A 5GIOA 2LKBA 3E9LA 3SV4A 1SV5A 4XJXA 3L2QA 3D0PA 3CETA 1U4BA 2Q3SA 2HBMA 2QWOA 4B3SK 4O5FA 2FF6A 5JS2A 4KV8A 4QAGA 2OZMA 1BCMA 1J54A 3PX6A 1JLCA 1T7EA 2O8EA 3MK6A 3EO3A 1VNAA 3SMSA 3O9UA 3MXMA 4LF9K 3ZX3A 4KHYA 5C2FA 3SK3A 4FSVA 1XNRK 2IAJA 4BRAA 1Z6RA 3MWPA 4DR3K 4KREA 4H5NA 3AO2A 1WBBA 4CZHA 3KHWA 3RMCA 4CZFA 3HRGA 4KTZA 4BROA 1C55A 4LF6K 2HSTA 3L3UA 2Q0RA 1NOZA 2KKZA 4MLHA 5CZ1A 1T44A 3WNFA 2DFFA 4O4GA 4X66K 2HBJA 3UKUB 2YNFA 4JK7A 3HSTB 4J2EA 1VQLN 5GAHP 3C6HA 1KC8O 3OYMA 4TSXA 1KVCA 4BC5A 2G8UA 2VWJA 5M1FA 2Q31A 3CJ1A 3VEVA 3OJSA 2VYPA 2XY7A 3NF7A 2LSNA 3F2KA 5A2QO 5T7BA 4PY5A 3OYIA 4N76A 1NKEA 2ETJA 4CIFA 5LL6Z 4ID5A 1OH6A 4AM6A 4QS9A 1TAQA 2ZJRL 1VQPN 2BRZA 4CJPA 3FFKB 1WWNA 2BH1A 5JS1A 1NBWA 3W3DA 3THVA 1RNHA 1HJRA 1JLBA 2E6LA 3CC7N 3QDKA 4JHDA 1OZZA 1BOTO 1RT2A 3O3HA 3SUPA 3VEYA 1RBVA 4MO4A 1WN7A 3DMJA 2YC1C 4OVLA 1AHOA 4CEEA 2HBKA 4CFDA 1F21A 4ELUA 4RW9A 3NVKA 4KI4A 2OTJN 1EKEA 1D4XA 4CK3A 3BZKA 4V1DC 3THXA 3DLLL 4CFAA 3OBYA 4JHDB 3DM2A 5KGXA 2ZWHA 1K73O 5F1XA 3KJVA 1JL1A 1DJTA 2NRZA 4NLBA 3LDSA 1VQMN 4GV9A 1ESVA 4E19A 3MX5A 4Z4CA 3CCLN 4HWIA 3THXB 4BE7B 3P38A 3VGLA 2CH6A 5M1NA 1NK4A 4DFJA 3VQ9A 4B9QA 3CXCM 4AEIA 2GBZA 3MCPA 2VG5A 4FLZA 3O3FA 1U48A 4YOTA 1VSDA 1KQSM 3S9HA 5AQXA 2QWRA 1I94K 1K6YA 4YNQA 1YITN 4PKHA 4CF9A 3V9UA 1MA9B 1D9FA 4LFCK 3S3MA 2NY8X 2QWQA 4Z0UA 2KFZA 2E1YA 4FJNA 1S5JA 1YTAA 4CESA 5DM6L 4RW7A 2O8BA 3SJHA 3CPEA 1LAVA 4Y1CA 3SLCA 4W5OA 4IO8A 3NH1A 1L3VA 3BEXA 5CY4A 4E3SA 3ZETA 1P8ZA 2X6NA 3TABA 1NJXA 1DEJA 2KZMA 4ISEA 3ASMA 2O8BB 3K0SA 4EIAA 3VF2A 1CLQA 1NGHA 1VSIA 1GLCG 1U6ZA 1W0HA 3ZETB 3CJBA 4KPYA 1QS4A 4O55A 4W5NA 3ZSYA 2QTDA 3I0SA 1VSMA 1T1TA 2P9UA 1TK8A 3QI7A 1JXEA 2D1KA 2W40A 2QK9A 4DF8A 2Z1JA 4NO7A 1JL2A 3K5OA 4K41A 4BQZA 4FLYA 1ZXOA 3WXJA 1KAXA 1NGGA 1WNSA 5DMRA 3ZX2A 3QB0A 5BRFA 2P9UB 2MBKA 4A61A 4C23A 4CI6A 4WQ5C 4CGHA 5CY0A 1X9JA 1S9EA 4NYFA 1BIUA 3ZLJA 2YNIA 4FL9A 3QMLA 3K59A 4DV2K 4JS4A 2CGLA 1IH7A 4XIUA 3TI0A 2YHBA 2YNHA 2ASPA 3EZWA 4JI7K 4B3MK 4HTLA 1NRAA 2KW4A 1NGIA 1HNIA 4CZLA 3S3NA 1NGJA 3ZSQA 3UKRA 1LWCA 1BWFO 3ISNC 1W7AA 1MWKA 3QEWA 3VETA 3HOSA 2I7PA 1Q7YO 4IG3A 4KHSA 4DQPA 4J2AA 2E2PA 2VWKA 4A57A 2FSKA 3E7UX 3FE1A 1WAJA 1XWLA 5HP1A 1S6PA 3UKRB 4H5RA 1P00A 3AVGA 3FLCO 3A2FA 3K9JA 4MLEA 5M1QA 4BDYA 1T7PA 5CZ2A 2KSKA 3HJFA 2DFHA 3KWIA 4CJRA 4OPKA 4PWDA 4IG0A 1IV0A 3F73A 3QIOA 3AVMA 2Y1JA 4CGJA 1GLEG 1YT3A 3QFPA 4O8KA 1UA0A 2E20A 1S1UA 1QQOA 4O0IA 1BQNA 4DSJA 4W5TA 4FLXA 3O6WA 5JENA 3EN9A 1C0UA 2P5GA 2W00A 4FVUA 3CJ7A 1JXCA 1GLBG 2QA4N 3RMAA 2QI2A 4JRPA 1HNZK 3MXJA 4JKBA 3RR7A 2VGMA 1I6GA 3O3GA 5J2MA 1S1WA 4JKAA 4A62A 4CF0A 4WCEL 5J2PA 2Y1IA 4FZYA 3O9RA 4E1NA 3HXMA 4EHTA 4B1VA 1IG8A 3LP0A 1NG9A 3TPQA 1EETA 3DXMB 3SF4D 4FZXC 1JLGA 3ZSXA 3ULDA 4CEDA 3HL8A 2OANA 3TAGA 2QM1A 4DTJA 1UGLA 5HL7L 3VTHA 2UXBK 1M90O 2RPIA 2NRXA 3CCJN 4K42A 2D0PA 1HNXK 4DLGA 3HVTA 3O4NA 1ASWA 4LF5K 4F4KA 3OY9A 4BRIA 4IO9L 2P9NA 3KOXA 4Z4FA 3DYAA 4CIGA 4HUFA 3DXKA 2HHUA 1JCFA 4MFBA 4FK4A 1SN1A 4E7JA 4FWNA 3SAGA 3T3FA 3ZSVA 3NMUA 1C0MA 4BRCA 5BPMA 3LANA 1PE4A 4DV0K 2FXUA 1RT3A 3HI0A 3J8AA 2P9NB 5F2RA 3QEXA 4DLEA 3DXKB 3OBWA 1QVGM 2C1IA 2BANA 3ZYYX 4E7KA 4Q0BA 1UOCA 4CJ4A 3P1GA 1SAZA 4AHVA 2WBNA 3FGUA 4B3OA 4B9LA 1HX1A 2B68A 2YHWA 3B8AX 1YJ9N 4MO5A 4CJVA 3VQBA 2KTQA 3ZSRA 1XC3A 4LF4K 2PY5A 2E3FA 5EX5A 4UADE 3G0ZA 2YHYA 4DSEA 1S1TA 3NF6A 1T0ZA 4I7FA 4DR4K 4BRDA 1REVA 1KLMA 3OYKA 2HHQA 2O8CA 4WQ5A 4DHYA 4UY8O 3H08A 2HHHK 4DR6K 5F0XA 3H1QA 2RE2A 3G25A 3WXIA 3SNNA 1U45A 4DTMA 5K14A 3V1QA 4AQYK 4CE9A 5E84A 1S3XA 1EP4A 5KPZA 2A1SA 3OW2M 4JAXA 4JRQA 5J2NA 2Q0UA 3SPZA 2IVNA 3C95A 4BGBA 2YKMA 2G8FA 4FCYA 4H5WA 4V19S 2O8CB 2PYLA 1DQ7A 2VWBA 5JLHA 3QESA 5AQOA 1N6QA 3O5BA 4DS5A 1S9GA 3NBPA 3QO9A 4UQGA 4GKJK 1DTQA 3IAYA 4DUYK 3VGKA 3CPWM 3DLGA 1N34K 4DTPA 2NRRA 4FK2A 5JVGL 1WSIA 4F8RA 2PBDA 3NH0A 5AQKA 4I2PA 3NGIA 2FF3B 3HPHA 3MWTA 3BUZB 2G8WA 3CCRN 3U3YA 3TAFA 4FJ7A 3DLEA 3L0QA 5SWMA 3VQAA 3ENHA 4B3TK 1HPMA 5AZJA 4WFBL 3CYMA 1WSGA 1D8YA 4CHZA 3N4QA 1NU0A 2OYQA 3VQPA 4GY2B 5AQVA 3A0IX 4B9SA 4OGEA 4H03B 5AZJB 4IDKA 1YUWA 2KHOA 1H1VA 1RT4A 1JKZA 3CHWA 2VGNA 4FVMA 3FZKA 2MN5A 3V6DA 3KK7A 3TSQA 1NE5A 4QOZB 3DI6A 1FW6A 1BUPA 2PAVA 4FLUA 3AVNA 2QWNA 1LCUA 1RT5A 4AAZA 4JI0K 4CQKA 4PL7A 1J9AA 3HBTA 3O08A 1VRUA 2X74A 5BR8K 3CQYA 1E4GT 2ZJQL 1Q9XA 3EE9A 4GV3A 4CHOA 3BZCA 4DQIA 5J2QA 1EQYA 4HTUA 5AFUH 3DLBA 2VCPA 4YFUA 3V9XA 1DKGD 3PSFA 3WQUA 3R2VA 3TTFA 5C15A 1BIZA 4FM1A 3AVHA 4C8NA 3OYNA 3CFOA 1U47A 3KLEA 2ZM6K 3QNOA 4CD1A 3L2UA 3O80A 1I39A 1XHXA 3IG1A 3T1YK 3P5JA 4CBXA 1VNBA 3D2FA 4ISFA 4GMJB 3NF9A 2D0CA 4DS4A 3VENA 2LN8A 4YOUA 3M1FA 3T19A 5CR4A 2P9LB 1BG3A 4BREA 1GLDG 1MYNA 4KO0A 1L3TA 4LSNA 4U67L 2V52B 3A5NC 4JKDA 1T3VA 3D2FB 4CZIA 4DB3A 2KLAA 2FLOA 4KH6A 3CG7A 1Q9YA 2E2NA 3OYHA 1YTUA 5LMUK 1XC9A 2P9PA 3WNGA 1UA1A 4C1NI 1EWRA 3U3GA 1CZBA 4CZJA 2O4GA 2KYQA 3M8SA 2LT8A 3L56A 2YX6A 3DAWA 1WB9A 1NKBA 3O9QA 5AR0A 2D0AA 2P9PB 4CIEA 1R0AA 2I7NA 3CM5A 1GOCA 1SKSA 2FSNA 2DTUA 1G99A 3V9SA 4DTXA 3AV9A 2A1RA 3F9KA 3DLKA 3KLHA 4FJ8A 1T03A 1YXQA 1Q81O 1Y64A 3PX0A 4BY9C 5C24A 2YI1A 3I0RA 3RR8A 4CHYA 4CEOA 3CCUN 1EO1A 2ZF5O 5H1SQ 3H3NO 3FZMA 2F4VK 3IRXA 1A5XA 3Q7BA 3OYLA 1XNQK 4E1MA 4H5VA 4B9VA 3I33A 2HNDA 4M7YA 2E88A 3U8XA 2XY8A 3AO3A 4EP5A 4DUZK 2BDPA 2YJFA 5C0YA 2F96A 3KK3A 3U6FA 5KI6A 1FK9A 4CJ5A 3M6GA 4JEPA 3UKUA 1NOYA 4NXNK 2NRWA 3SCXA 2VQEK 2RF2A 3VERA 3ZT4A 3OYGA 3D45A 2LJMA 4CZKA 3AAQA 3CD6N 3RRHA 3RMDA 1ZBLA 1VQ7N 4DV5K 2RHKA 3AAPA 3BF1A 4BRHA 4JKEA 2OPQA 5EOYA 5AFUA 1RDDA 2QXFA 3Q7CA 3NCIA 3KD5E 4RW6A 3WNEA 1NH5A 1TGOA 4JS5A 3VQ8A 3LAMA 4OPAA 5BN8A 5FDLA 1N36K 3HSCA 4KRFA 3N4PA 1BI4A 4ZTJA 4CJSA 1NGBA 1HNWK 3S3OA 3OYEA 3E66A 1KSPA 3LDPA 4JI1K 2O8FA 4FZZA 3HT3A 1ATNA 4C8MA 3QBWA 1TKXA 2DY4A 1J53A 3TTDA 5LY3A 3K2PA 1ZYQA 4KB1A 1BI4B 4IJAA 3AA2A 4FJJA 1I2VA 2QXLA 4W5QA 1MR4A 2O8FB 1RTHA 3VQQA 4AB0A 2NLXA 1XUPO 1BQMA 5FPEA 4AHCA 1O1WA 4DQRA 3V1RA 2OCEA 4H8KA 2Z1IA 2HF4A 1S22A 4BWMA 4C8LA 2Z1HA 3OTOK 3VMFB 2V7YA 3V81A 3C6TA 4XH4A 3EEQA 1N32K 3K5LA 3VN5A 4AHTA 3L4IA 3PSIA 4IFYA 4CGDA 4DR2K 5CYMA 1HQUA 1VQNN 4DV1K 1GPSA 2UUCK 3DLHA 3VTIA 4M3TA 3GDQA 4YORA 3BF3A 5GINA 2O8DB 1ITGA 4XEIA 4CEFA 3T1AA 3BP8A 1YI2N 1FKPA 3QICA 1ZVEA 2E2QA 4DTNA 2IDOA 2KGQA 3LDOA 3JYTA 4CCHA 4DR7K 3SAHA 3HPOA 5IWAK 4Z94A 3SV3A 2IS3A 4M3RA 2PFUA 2K35A 4H0YB 4ZHRA 3K58A 4FWOA 2P9SA 4BVOA 4PUOA 2WC9A 2GWJA 1WSJA 2D56A 2NRHA 3SYZA 1C1CA 1Q18A 2F7TA 1YVNA 1B9FA 3V9WA 1HKBA 5AQMA 5GAEP 4KYPA 4X65K 3MEDA 5BRDA 1EX4A 3SI6A 4K0KK 2YEOA 1R59O 2P9SB 3KLIA 3AVAA 2OA8A 2OZSA 3MCAB 5C10A 1JZBA 1VRTA 3SQ1A 4OJRA 5FRNA 1GLJO 4I9QA 3P4IA 1GLFO 4DV7K 3QBXA 4CBWA 3C94A 4LH4A 1U49A 1NK0A 1BO5O 1N4NA 2DPNA 1C0FA 3EYZA 1QHAA 4CZEA 1GOBA 1XMOK 2KBHA 1KFSA 1B92A 1W9HA 5B8HA 3AVIA 2IC3A 4PA1A 1C1BA 2A42A 1T7AA 1NNEA 3D2EB 1RT1A 4RTFD 1ZC6A 3KOWA 1SZ2A 5C42A 2KPYA 2CGKA 5AQQA 3LM9A 5C25A 3M3ZA 1J5OA 1BISA 4FWQA 4DSFA 1WMTA 1KVBA 4H0XB 3VEOA 4CHQA 1NRBA 2GV9A 1IKVA 1TKTA 5LMNK 4R5PA 4CJWA 3HM8A 3VESA 3ZX0A 4FYDA 4FWRA 5EU7A 3T69A 4NCAA 4AF1A 3TR8A 4E72A 2P9IA 4KTQA 1RT7A 1ILYA 1NLVA 2A3ZA 4B9NA 3A5MC 4HUEA 1QQCA 5AQJA 4DQSA 3R3LA
chains in the Genus database with same CATH topology
4DKWA 5AQSA 2AA4A 2Q36A 3W0LA 3WT0A 2C1GA 3E9OA 3JS6A 4BVPA 5LJWA 4O8UA 1JCEA 4MDAA 1SAZA 2WBNA 3AGRA 3FGUA 1K8KA 3KHYA 1HX1A 4JK9A 2YHWA 3B8AX 1YJ9N 3I8BA 3ENBA 4MO5A 2P9IB 5CHIA 3NVMA 1TUYA 4Y0WA 1XC3A 4E1JA 5TKWA 5HOOA 5EX5A 4UADE 3R8EA 1BA1A 4A5BA 3R9PA 5AQFA 2NZTA 2CGJA 4NB4A 4BRNA 2YHYA 1LOTB 4R79A 5CE3A 4BRDA 5MLCQ 3CMAN 3FR0A 5JICA 4WQ5A 4DHYA 5BRHA 4UY8O 1K8KB 4YOXA 3LM2A 3WEEA 5KPRA 5EY4A 2GTDA 1VQ9N 5F0XA 3H1QA 3I55N 1QQNA 2RE2A 3G25A 3WXIA 4RWTA 4H0OA 4JK8A 2GEMA 4BC2A 3U9ZA 1VQ4N 3A8YA 4IZ9A 4BECA 5E84A 2E8AA 1S3XA 1RDWX 4L3QA 4H5TA 4RCHA 5KPZA 3OW2M 1DT9A 3FZHA 4JAXA 2Q0UA 1X3NA 2IVNA 3O9SA 4IOXA 2YIPA 4BGBA 2IIRA 4H5WA 3ENOA 2VWBA 1J6ZA 3WEEB 5JLHA 4U7BA 3R1XA 2E2OA 3FZLA 5AQOA 2UYTA 5AQTA 3C0BA 4JKFA 3GOIA 3VF6A 3O5BA 4NLCA 1NJIO 4H0PA 3TU5A 3VGKA 4B1WB 3CPWM 1S72N 2HOEA 1T6CA 4BR5A 2NRRA 1OVYA 5JVGL 2VY6A 2PBDA 5AQKA 1HKGA 2FF3B 5GIOA 3E9LA 3MWTA 3BUZB 1ATRA 3CCRN 1VQKN 4FWSA 3DXMA 4XJXA 4EHUA 1VQ8N 4GNIA 3CETA 3L0QA 3ENHA 2HBMA 2QWOA 1HPMA 4O5FA 2ZGZA 5AZJA 4WFBL 2FF6A 3T7ZA 3N4QA 3R6MA 1QZ5A 3L6QA 1RGIA 2V51B 2E1ZA 2YIOA 2D0OA 3MK6A 4GY2B 3EO3A 5AQVA 1QQMA 3VPZA 3D2EA 4IJNA 4WFAL 3IUCA 3O9UA 3SMSA 3A0IX 4K43A 4PKGA 1MDUB 5GADP 3ZX3A 2Q97A 4H03B 1CZAN 5AZJB 2F9WA 5C2FA 1YUWA 4FSVA 3SK3A 2KHOA 5AZIB 4BRAA 1Z6RA 1H1VA 3MWPA 3KC6A 3CHWA 2VGNA 4H5NA 3FZKA 2MN5A 4CZHA 3KHWA 3KK7A 5FPNA 3TSQA 4DCHA 4CZFA 2BUPA 1BUPA 2A5XA 3HRGA 3F9MA 3CJAA 3M5RA 2PAVA 5FPDA 4XH1A 2QWNA 2YCHA 1LCUA 3EKSA 4PL7A 2HSTA 2Q0RA 3HBTA 3O08A 2QWMA 3CQYA 2KKZA 1E4GT 1NM1A 4MLHA 3EE9A 1T44A 2ZJQL 4KH5A 4GV3A 1X3MA 5AQHA 3CCEN 1P90A 3DJCA 1EQYA 3U9DA 2HBJA 3UKUB 5BPLA 5AFUH 4B1YB 4IEEA 2VCPA 3LDLA 3GL1A 4YDUC 1VQ6N 4JK7A 1YIJN 1VQLN 1DKGD 3C6HA 5GAHP 3WQUA 1KC8O 4BC5A 3R2VA 3TTFA 5C15A 5M1FA 2Q31A 3CJ1A 1T6DA 4PHTX 3VEVA 2VYPA 4BRMA 2NNWA 4CD1A 4A59A 5ADXA 3O80A 4CZGA 1HLUA 3F2KA 4BR2A 4CBXA 3D2FA 3L4QA 5ELZA 4ISFA 3K9KA 4J8FA 2JWLA 5AQWA 3H46O 3I56N 4AM6A 2JDQD 4QS9A 2LN8A 3VENA 4YOUA 3M1FA 2ZJRL 1VQPN 5CR4A 2P9LB 1BG3A 4BREA 3FFKB 1O13A 2BH1A 1GLDG 1RFQA 1NBWA 3W3DA 4DQ8A 4JKCA 4U67L 2V52B 3A5NC 3AARA 4JKDA 1T3VA 3OA9A 3CC7N 4FWKA 2ZGYA 3QDKA 3D2FB 4CZIA 4JHDA 4DB3A 2KLAA 1BOTO 3AGKA 3WUHA 2FLOA 2HF3A 2P9KA 2AP1A 4KH6A 2A6AA 4FOIA 3VEYA 3C65A 4MO4A 1KD1O 4UAEF 2E2NA 3D6RA 3E1YA 4YDUA 2P9PA 4BC3A 3RVCA 1N8RO 1HKCA 4C1NI 2HBKA 3CERA 3VF4A 3NVKA 2OTJN 3LDQA 1D4XA 1WOQA 1WUAA 1Z05A 3SBTA 4CZJA 5C2DA 4CBUA 4UAFE 4JKHA 3MN5A 4BQLA 3DLLL 5BR9A 2YX6A 3L56A 3OBYA 3DAWA 4JHDB 1K73O 1POIA 2ZWHA 5F1XA 2P9KB 3PIOL 4BG9A 3O9QA 5AR0A 2NRZA 4BRPA 3GG4A 2P9PB 4KBOA 2I7NA 4NLBA 2NRTA 3VOVA 2FSNA 1VQMN 4GV9A 1ESVA 1V4TA 1G99A 2H3GX 4WFNL 3MX5A 3WQTA 3CCLN 2GX9A 4HWIA 2YILA 3BK3C 2Q2RA 2GMOA 4BE7B 3P38A 3VGLA 1YXQA 2CH6A 3RSEA 5M1NA 1K9MO 3CCSN 4IEIA 1Q81O 1Y64A 4B9QA 4BY9C 3CQXA 2YI1A 5AQLA 4A5AA 3CXCM 2GELA 3LL3A 3MCPA 3UB5A 2JWKA 4LC9B 4FWPA 3CCUN 2IVOA 4YOTA 1EO1A 2ZF5O 4MDBA 5H1SQ 3H3NO 1W97L 1KQSM 5AQXA 3FZMA 2QWRA 3Q7BA 2GUPA 4JN4A 3RSEB 4PKHA 5AZIA 1YITN 4EAHD 3CIPA 3P31A 4H5VA 1MA9B 1ZBSA 4BEBA 2QWQA 2V7ZA 4CJ7A 4YOVA 4WQ4C 3O1BA 2E1YA 1NGAA 3I33A 4G9ZA 3O9TA 3U8XA 4M7YA 2E88A 5EXWA 5DM6L 3IFRA 3SJHA 3CPEA 5GIPA 2YJFA 2BTFA 3SLCA 4IOAL 5C0YA 4IO8A 5AQNA 1DGKN 3HZ6A 5M1OA 1KXPA 2OTLN 1NGFA 3BEXA 5FPMA 3ZETA 4ISGA 3M6GA 1C0GA 4WYBA 4H0VB 1P8ZA 3LDNA 4JEPA 3UKUA 3HOTA 1DEJA 3CF5L 5KPTA 2NRWA 2QEXN 3ATUA 3PLAA 4ISEA 1XQSC 3VERA 4EIAA 5AQYA 4IDHA 3VF2A 3CMEN 1NGHA 5BREA 4CZKA 1BA0A 3AAQA 3CD6N 3VEZA 5JLFA 3ID8A 2ASMA 1GLCG 1U6ZA 3ZETB 1VQ7N 3JXUA 5BN9A 3G4SN 3CJBA 2RHKA 3AAPA 3BF1A 4BRHA 4JKEA 2QTDA 3MMVA 2P9UA 4PKIA 3ATVA 3QI7A 4FPAA 5EVZA 5EOYA 5AFUA 1NGCA 3Q7CA 1BU6O 1V4SA 2D1KA 3P39A 2W40A 5KQ8A 2P9LA 3IKMA 4NO7A 4OPAA 1YAGA 5BN8A 4K41A 4BQZA 1ZXOA 1Q86O 3WXJA 3HSCA 1KAZA 2Q1NA 1W2BM 1KAXA 3N4PA 4WF9L 1NGGA 4CZMA 3ZX2A 4BROA 1NGBA 1SS6A 3QB0A 5BRFA 2P9UB 2MBKA 5AQUA 3E66A 3LDPA 4A61A 1NGEA 4C23A 4CI6A 1QVFM 4WQ5C 2QWLA 4GVEA 2A41A 3CJCA 3GE1A 1ATNA 1X9JA 1HJOA 3QBWA 4BRQA 4FL9A 3QMLA 3G71N 3TTDA 5LY3A 2YHXA 4QS7A 3CC2N 4F9OA 4CD3A 4FOEA 1IJJA 2CGLA 4IJAA 3VEWA 1SQKA 1VAZA 3CJ9A 5AQPA 4IXCA 5TKYA 3MN6A 3KZBA 2QXLA 4H0TB 3WXMB 3H45C 3VEXA 2ASPA 4ILHA 3EZWA 2IVPA 3H6EA 2NLXA 1XUPO 4HTLA 5C12A 1RDUA 1NGIA 4ILGB 5AQIA 5FPEA 1E4FT 2YJEA 1NGJA 4CZLA 3UKRA 4AM7A 5M1KA 1BWFO 3CCMN 4OO1J 3FZFA 5BPNA 1MWKA 3CI5A 3VETA 3HOSA 2I7PA 3MN7A 1Q7YO 3O1WA 2HF4A 5M1PA 1TYQA 1OKJA 1S22A 5DM7L 4FPBA 2ITMA 2E2PA 4JKGA 3VMFB 2V7YA 2CH5A 4A57A 5GAGP 4IOCL 2FSKA 4XH4A 4A2BA 3SMPA 2D4WA 1NWKA 3L4IA 1U2VA 1VQNN 3FE1A 3O8MA 3UKRB 4H5RA 3VTIA 2QWPA 3GDQA 3BF3A 3FLCO 4YORA 3K9JA 4XEIA 5GINA 4MLEA 5M1QA 5JVHL 1M1KO 4BRGA 3BP8A 3IMXA 1YI2N 1YF5L 2E2QA 1TYQB 3QICA 3EKUA 3KWIA 4BR0A 3IDHA 3TTCA 4JKGB 3LDOA 3SAHA 1NMDA 4OPHA 5I9EB 4Z94A 1GLLO 1U2VB 1QZ6A 1GLEG 3QFPA 2PFUA 4O8KA 4BGAA 3VGMA 1KAYA 2E2FA 2K35A 2E20A 4H0YB 4BRLA 3KWGA 4FWOA 1QQOA 3E9PA 5KQDA 2P9SA 4BVOA 4JD2A 2WUSA 4B1XB 3CCQN 2WC9A 4I6MA 3C7NA 2GWJA 4YOYA 2EWSA 1YJWN 1VQON 2D56A 2NRHA 3O6WA 4ILJA 2A40A 3EN9A 3HTVA 2GWKA 3EL2A 2W00A 1Q18A 2F7TA 2F9TA 1YVNA 1HKBA 5AQMA 5GAEP 5BRDA 4FVUA 3CJ7A 3J7ZO 1GLBG 2WFBA 3PIPL 3TSPA 4FO0A 4IFEA 2QA4N 2QI2A 4B1UB 1R59O 3SBGA 1K8AO 2P9SB 3A5LC 4JKBA 4JD2B 1YJNN 3KVGA 1HUXA 1TUUA 4I6MB 3C7NB 3S41A 4GV6A 2VGMA 4XH5A 3MCAB 5C10A 4JKAA 3ID6A 4A62A 4WCEL 3C6AA 3DWLA 1GLJO 2ASOA 3QFUA 1GLFO 3P4IA 3QBXA 3UE5A 4CBWA 3O9RA 4EHTA 3ULEA 4B1VA 3U4LA 1IG8A 1BO5O 3WXLA 2DPNA 1C0FA 4PL8A 3TPQA 3DXMB 4BRFA 1QHAA 3O4WA 3SF4D 5AQZA 4CZEA 3CCVN 1Q82O 2QW9A 4IWVA 2OANA 5E26A 2QM1A 3AY9A 5B8HA 5HL7L 3VTHA 3G6EN 3F5TA 1MWMA 3A5OC 4KH4A 4C1NK 2NRXA 3CCJN 3CW4A 2A42A 1M90O 4K42A 2D0PA 4WQ4A 1JJ2M 3ULEB 2FSJA 3H3OB 4JNEA 3D2EB 4RTFD 3ZEUA 2NRVA 3MX2A 4M63C 1ZC6A 4BR9A 4FWLA 1SZ2A 4A2AA 4BR7A 1VQ5N 2J4RA 2CGKA 1JCGA 5AQQA 3GBTA 5AQGA 1BDGA 3LM9A 2P9NA 4BRIA 2W41A 3SAFA 4IO9L 3M3ZA 1YHQN 4FWQA 3H1VX 3VEOA 4H0XB 3DXKA 2ZJPL 3CC4N 5AQRA 3OHRA 2HMPA 1JCFA 4QS8A 4FWNA 3SAGA 4FWMA 4B1ZA 3MN9A 3WXKA 5LJVA 3NMUA 3HM8A 3VESA 3ZEUB 5BPMA 3ZX0A 4BRCA 4BRKA 4FWRA 2FXUA 4M7XA 3T69A 3HI0A 4AF1A 3J8AA 2P9NB 3EE8A 5F2RA 4BG8A 3MDQA 2P9IA 5ADXH 4K25A 5JMVA 1ILYA 4BC4A 3TSUA 1NLVA 3DXKB 3OBWA 4BR4A 1QVGM 2A3ZA 3A5MC 2C1IA 1ATSA 1NGDA 4EFHA 2HBLA 4YOWA 5AQJA 3ZYYX 3D7EO 1GLAG 3R3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQS A;  2AA4 A;  2Q36 A;  3W0L A;  3WT0 A;  3JS6 A;  4BVP A;  5LJW A;  1JCE A;  1SAZ A;  3FGU A;  1K8K A;  3KHY A;  1HX1 A;  2YHW A;  3B8A X;  3I8B A;  4MO5 A;  2P9I B;  1TUY A;  4Y0W A;  1XC3 A;  4E1J A;  5EX5 A;  3R8E A;  1BA1 A;  3R9P A;  5AQF A;  2NZT A;  2CGJ A;  4NB4 A;  4BRN A;  2YHY A;  1LOT B;  5CE3 A;  4BRD A;  3FR0 A;  5JIC A;  4WQ5 A;  4DHY A;  5BRH A;  1K8K B;  3LM2 A;  3WEE A;  5KPR A;  5EY4 A;  2GTD A;  5F0X A;  3H1Q A;  1QQN A;  4RWT A;  3G25 A;  3WXI A;  4H0O A;  2GEM A;  4BC2 A;  3U9Z A;  3A8Y A;  4IZ9 A;  5E84 A;  2E8A A;  1S3X A;  1RDW X;  4L3Q A;  4H5T A;  4RCH A;  5KPZ A;  3FZH A;  4JAX A;  2Q0U A;  1X3N A;  2IVN A;  4BGB A;  2IIR A;  4H5W A;  3ENO A;  2VWB A;  1J6Z A;  3WEE B;  5JLH A;  2E2O A;  3FZL A;  5AQO A;  2UYT A;  5AQT A;  3C0B A;  3VF6 A;  3GOI A;  3O5B A;  4H0P A;  3TU5 A;  3VGK A;  4B1W B;  2HOE A;  1T6C A;  4BR5 A;  2PBD A;  5AQK A;  1HKG A;  2FF3 B;  3BUZ B;  1ATR A;  4FWS A;  3DXM A;  4EHU A;  4GNI A;  3CET A;  3L0Q A;  3ENH A;  2QWO A;  1HPM A;  4O5F A;  2ZGZ A;  5AZJ A;  2FF6 A;  3R6M A;  1QZ5 A;  3L6Q A;  1RGI A;  2V51 B;  2E1Z A;  2D0O A;  3MK6 A;  4GY2 B;  3EO3 A;  5AQV A;  1QQM A;  3VPZ A;  3D2E A;  4IJN A;  3IUC A;  3SMS A;  3A0I X;  4K43 A;  4PKG A;  1MDU B;  3ZX3 A;  2Q97 A;  4H03 B;  1CZA N;  5AZJ B;  2F9W A;  1YUW A;  4FSV A;  3SK3 A;  2KHO A;  5AZI B;  4BRA A;  1Z6R A;  1H1V A;  3CHW A;  4H5N A;  3FZK A;  4CZH A;  5FPN A;  4DCH A;  4CZF A;  2BUP A;  1BUP A;  2A5X A;  4XH1 A;  3F9M A;  3CJA A;  4BRO A;  2PAV A;  5FPD A;  2QWN A;  2YCH A;  1LCU A;  3EKS A;  4PL7 A;  2Q0R A;  3HBT A;  3O08 A;  2QWM A;  3CQY A;  4MLH A;  1E4G T;  1NM1 A;  1T44 A;  1X3M A;  5AQH A;  3DJC A;  1EQY A;  3U9D A;  3UKU B;  5BPL A;  5AFU H;  4B1Y B;  2VCP A;  3LDL A;  3GL1 A;  4YDU C;  1DKG D;  3WQU A;  4BC5 A;  2Q31 A;  3CJ1 A;  1T6D A;  3VEV A;  2VYP A;  4BRM A;  4CD1 A;  5ADX A;  3O80 A;  4CZG A;  1HLU A;  4BR2 A;  4CBX A;  3D2F A;  5ELZ A;  4ISF A;  4J8F A;  5AQW A;  3H46 O;  4AM6 A;  4QS9 A;  3VEN A;  3M1F A;  2P9L B;  1BG3 A;  4BRE A;  3FFK B;  1GLD G;  1RFQ A;  1NBW A;  3W3D A;  4DQ8 A;  2V52 B;  3A5N C;  3AAR A;  4FWK A;  2ZGY A;  3QDK A;  3D2F B;  4CZI A;  4JHD A;  4DB3 A;  1BOT O;  3WUH A;  2FLO A;  2HF3 A;  2P9K A;  2AP1 A;  2A6A A;  4FOI A;  3VEY A;  4MO4 A;  2E2N A;  4YDU A;  4BC3 A;  2P9P A;  1HKC A;  3CER A;  3VF4 A;  3LDQ A;  1D4X A;  1WOQ A;  1WUA A;  1Z05 A;  4CZJ A;  4CBU A;  3MN5 A;  4BQL A;  5BR9 A;  3DAW A;  4JHD B;  2ZWH A;  5F1X A;  2P9K B;  4BG9 A;  5AR0 A;  4BRP A;  3GG4 A;  2P9P B;  4KBO A;  2I7N A;  3VOV A;  2FSN A;  1ESV A;  1V4T A;  1G99 A;  2H3G X;  3WQT A;  4HWI A;  2Q2R A;  3VGL A;  1YXQ A;  2CH6 A;  3RSE A;  1Y64 A;  4B9Q A;  3CQX A;  2YI1 A;  5AQL A;  2GEL A;  3LL3 A;  3MCP A;  3UB5 A;  4LC9 B;  4FWP A;  2IVO A;  2ZF5 O;  3H3N O;  5AQX A;  3FZM A;  2QWR A;  2GUP A;  4JN4 A;  3RSE B;  4PKH A;  5AZI A;  4EAH D;  3CIP A;  4H5V A;  1MA9 B;  1ZBS A;  2QWQ A;  2V7Z A;  4CJ7 A;  4WQ4 C;  3O1B A;  2E1Y A;  1NGA A;  3I33 A;  3U8X A;  4M7Y A;  2E88 A;  5EXW A;  3IFR A;  3SJH A;  2YJF A;  2BTF A;  3SLC A;  4IO8 A;  5AQN A;  1DGK N;  3HZ6 A;  1KXP A;  1NGF A;  3BEX A;  5FPM A;  3ZET A;  4ISG A;  3M6G A;  1C0G A;  4WYB A;  4H0V B;  1P8Z A;  3LDN A;  3UKU A;  1DEJ A;  5KPT A;  3ATU A;  4ISE A;  1XQS C;  3VER A;  4EIA A;  5AQY A;  3VF2 A;  1NGH A;  5BRE A;  4CZK A;  1BA0 A;  3AAQ A;  3VEZ A;  5JLF A;  3ID8 A;  2ASM A;  1GLC G;  1U6Z A;  3ZET B;  3JXU A;  5BN9 A;  3CJB A;  3AAP A;  3BF1 A;  4BRH A;  3MMV A;  2P9U A;  4PKI A;  3ATV A;  4FPA A;  5EVZ A;  5EOY A;  5AFU A;  1NGC A;  5KQ8 A;  1BU6 O;  1V4S A;  2D1K A;  2W40 A;  2P9L A;  4NO7 A;  1YAG A;  5BN8 A;  4K41 A;  4BQZ A;  1ZXO A;  3WXJ A;  3HSC A;  1KAZ A;  2Q1N A;  1KAX A;  1NGG A;  4CZM A;  3ZX2 A;  1NGB A;  3QB0 A;  5BRF A;  2P9U B;  5AQU A;  3LDP A;  4A61 A;  1NGE A;  4C23 A;  4CI6 A;  4WQ5 C;  2QWL A;  2A41 A;  3CJC A;  3GE1 A;  1ATN A;  1X9J A;  1HJO A;  3QBW A;  4BRQ A;  4FL9 A;  3QML A;  5LY3 A;  2YHX A;  4QS7 A;  4F9O A;  4CD3 A;  4FOE A;  1IJJ A;  2CGL A;  4IJA A;  3VEW A;  1SQK A;  3CJ9 A;  5AQP A;  4IXC A;  5TKY A;  3MN6 A;  3KZB A;  2QXL A;  4H0T B;  3H45 C;  3VEX A;  2ASP A;  3EZW A;  2IVP A;  3H6E A;  2NLX A;  1XUP O;  4HTL A;  1NGI A;  5AQI A;  5FPE A;  1E4F T;  2YJE A;  1NGJ A;  4CZL A;  3UKR A;  4AM7 A;  1BWF O;  3FZF A;  5BPN A;  1MWK A;  3CI5 A;  3VET A;  2I7P A;  3MN7 A;  3O1W A;  2HF4 A;  1TYQ A;  1OKJ A;  1S22 A;  4FPB A;  2ITM A;  2E2P A;  2V7Y A;  2CH5 A;  2FSK A;  4XH4 A;  4A2B A;  3SMP A;  2D4W A;  1NWK A;  3L4I A;  1U2V A;  3FE1 A;  3O8M A;  3UKR B;  4H5R A;  2QWP A;  3GDQ A;  3BF3 A;  3FLC O;  4XEI A;  4MLE A;  4BRG A;  3BP8 A;  3IMX A;  2E2Q A;  1TYQ B;  3QIC A;  3EKU A;  4BR0 A;  3IDH A;  3LDO A;  1NMD A;  5I9E B;  4Z94 A;  1GLL O;  1U2V B;  1QZ6 A;  1GLE G;  3QFP A;  4O8K A;  4BGA A;  3VGM A;  1KAY A;  4H0Y B;  2E20 A;  4BRL A;  4FWO A;  1QQO A;  5KQD A;  2P9S A;  4BVO A;  4JD2 A;  2WUS A;  4B1X B;  4I6M A;  3C7N A;  2GWJ A;  2EWS A;  2NRH A;  3O6W A;  2A40 A;  3EN9 A;  3HTV A;  2GWK A;  3EL2 A;  1Q18 A;  2F9T A;  1YVN A;  1HKB A;  5AQM A;  5BRD A;  3CJ7 A;  1GLB G;  4FO0 A;  4B1U B;  1R59 O;  2P9S B;  3A5L C;  4JD2 B;  3KVG A;  1HUX A;  1TUU A;  4I6M B;  3C7N B;  3S41 A;  4XH5 A;  4A62 A;  3DWL A;  1GLJ O;  2ASO A;  3QFU A;  1GLF O;  3P4I A;  3QBX A;  3UE5 A;  4CBW A;  4EHT A;  3ULE A;  4B1V A;  3U4L A;  1IG8 A;  1BO5 O;  3WXL A;  2DPN A;  1C0F A;  4PL8 A;  3TPQ A;  3DXM B;  4BRF A;  1QHA A;  3O4W A;  5AQZ A;  4CZE A;  2QW9 A;  4IWV A;  2OAN A;  5E26 A;  2QM1 A;  3AY9 A;  5B8H A;  1MWM A;  3A5O C;  2A42 A;  4K42 A;  2D0P A;  4WQ4 A;  3ULE B;  2FSJ A;  3H3O B;  4JNE A;  3D2E B;  4RTF D;  3ZEU A;  4BR9 A;  4M63 C;  1ZC6 A;  4FWL A;  1SZ2 A;  4A2A A;  4BR7 A;  2J4R A;  2CGK A;  1JCG A;  5AQQ A;  3GBT A;  5AQG A;  1BDG A;  3LM9 A;  2P9N A;  4BRI A;  2W41 A;  3M3Z A;  4FWQ A;  3H1V X;  3VEO A;  4H0X B;  3DXK A;  5AQR A;  3OHR A;  2HMP A;  1JCF A;  4QS8 A;  4FWN A;  4FWM A;  4B1Z A;  3MN9 A;  3WXK A;  5LJV A;  3HM8 A;  3VES A;  3ZEU B;  5BPM A;  3ZX0 A;  4BRC A;  4BRK A;  4FWR A;  2FXU A;  4M7X A;  3HI0 A;  3J8A A;  2P9N B;  5F2R A;  4BG8 A;  3MDQ A;  2P9I A;  5ADX H;  4K25 A;  5JMV A;  4BC4 A;  1NLV A;  3DXK B;  4BR4 A;  2A3Z A;  3A5M C;  1ATS A;  1NGD A;  4EFH A;  5AQJ A;  3D7E O;  1GLA G; 
#chains in the Genus database with same CATH topology
 2Q36 A;  4N5S A;  3WT0 A;  2C1G A;  3E9O A;  3AO4 A;  4BVP A;  4O8U A;  4MDA A;  1K8K A;  2VQF K;  3KHY A;  4JK9 A;  3I8D A;  2P9I B;  1B9D A;  3NVM A;  4K8X A;  5TKW A;  3BY5 A;  3R9P A;  5AQF A;  2CGJ A;  3K5M A;  5MLC Q;  3CMA N;  1C0T A;  5HLF A;  1BRZ A;  2YBR C;  3FR0 A;  4ICL A;  5JIC A;  1K8K B;  2E5L K;  5KGW A;  4CEC A;  3I55 N;  4Z4H A;  4H0O A;  4LFB K;  4BC2 A;  2HHV A;  4IZ9 A;  4OGC A;  4KHW A;  2UUB K;  2E8A A;  3PUF A;  4RCH A;  4IOX A;  2YIP A;  4AHR A;  2IIR A;  1KRP A;  2B6A A;  3R1X A;  2E2O A;  2AJQ A;  2UYT A;  3VF6 A;  5AQT A;  3GOI A;  2W42 A;  4HUG A;  1KLN A;  3MXI A;  1HYS A;  3OYC A;  4CF2 A;  1NJI O;  4H0P A;  4B1W B;  4E89 A;  3DOK A;  5KRT A;  4BR5 A;  2G2K A;  4CGI A;  4KHN A;  1QSS A;  2KZZ A;  3MEE A;  3MAQ A;  4FLT A;  1VQK N;  3DXM A;  4EHU A;  5D3G A;  1VQ8 N;  1NJY A;  3THY A;  1HQE A;  3T7Z A;  3R6M A;  3VA0 A;  1QZ5 A;  1RGI A;  4NYN A;  2YIO A;  2D0O A;  4BWJ A;  1RBR A;  3OS0 A;  4CGF A;  1QQM A;  1T8E A;  4WFA L;  2D5R A;  3KP0 A;  4K43 A;  2Q97 A;  1WBD A;  1A5V A;  2HMI A;  3L2W A;  3THY B;  3NAE A;  5AZI B;  3LP1 A;  1BHL A;  3KC6 A;  4IKF A;  4CEB A;  1HYZ A;  4CJF A;  4CHN A;  4FJ9 A;  2JLE A;  4BAC A;  1VHX A;  4DCH A;  4C8K A;  1KVA A;  3GKU A;  2A5X A;  1PTX A;  1JZA A;  3M5R A;  3F9M A;  5FPD A;  2YCH A;  1OH5 A;  2I5J A;  3QIP A;  2ZQB A;  3VQ4 A;  5FRO A;  1X3M A;  5AQH A;  1LQI A;  1OMY A;  1P90 A;  3VQ7 A;  3U9D A;  4J2D A;  1B7D A;  4IEE A;  2LY5 A;  1Z25 A;  1VQ6 N;  2FBY A;  1HR0 K;  5E41 A;  1KFD A;  4OLB A;  2FBX A;  3ALY A;  1T6D A;  4GW6 A;  4JI6 K;  1N33 K;  4BRM A;  1KCF A;  2ATB A;  4IBN A;  1C6V A;  1T7B A;  4F3O A;  5ELZ A;  3L2R A;  1VSL A;  2B5J A;  2E6M A;  4N47 A;  3H46 O;  4LFA K;  3DRR A;  2N66 A;  4AH9 A;  1O13 A;  3KIO A;  2FBV A;  4DFK A;  4H4M A;  3AAR A;  4DU4 A;  4N41 A;  1TK5 A;  4FWK A;  2ZGY A;  4M3X A;  3AGK A;  3WUH A;  2P9K A;  2AP1 A;  2A6A A;  3PV8 A;  3C65 A;  4YDU A;  3OYB A;  2UXD K;  1QSL A;  3CFP A;  3LDQ A;  1WOQ A;  1WUA A;  1Z05 A;  5C2D A;  3VQ6 A;  4UAF E;  2IOC A;  2GL1 A;  5BR9 A;  4OX9 K;  4E7I A;  1D5A A;  2P9K B;  2UU9 K;  3PIO L;  4BG9 A;  3GG4 A;  4PQU A;  4KBO A;  3VOV A;  4F2S A;  4X62 K;  2FC0 A;  4WFN L;  1LQH A;  3WQT A;  1WT7 A;  2YIL A;  1ASU A;  2HHW A;  2UUA K;  2W6L A;  4CK2 A;  3RSE A;  4IEI A;  3LPU A;  2PZS A;  4AHS A;  1JLA A;  3QEP A;  5AQL A;  4A5A A;  3LL3 A;  1JLF A;  4DTR A;  3UB5 A;  3LWM A;  2JWK A;  4O5B A;  4FW2 A;  4FWP A;  4LC9 B;  2IVO A;  2ITG A;  4RG8 A;  4CJE A;  4MDB A;  4AIL C;  1W97 L;  4HHF A;  2GUP A;  4JN4 A;  3RSE B;  3ZSW A;  3J81 O;  3B6O A;  3CIP A;  3P31 A;  1X9W A;  1ZBS A;  4BEB A;  1UAX A;  2F8T A;  3L3V A;  1NGA A;  3AA4 A;  1VSK A;  3HVR A;  3AVJ A;  5HRP A;  2KJA A;  2BTF A;  4F2R A;  4IOA L;  2NY9 X;  1XRS B;  3J7A P;  5AQN A;  3WNH A;  1ZBH A;  5M1O A;  3RWU A;  2P5O A;  1NGF A;  5KK4 A;  1T05 A;  4WYB A;  1NK5 A;  5KPT A;  4FJI A;  3ATU A;  3SUO A;  1XQS C;  1CXQ A;  3LAL A;  4IDH A;  1NKC A;  3CME N;  4DWI A;  3QEV A;  3AO5 A;  1LW2 A;  4B08 A;  3AVF A;  3VEZ A;  1DTT A;  1NK7 A;  3ID8 A;  2ASM A;  4DFP A;  3HP6 A;  3G4S N;  3HK2 A;  2RKI A;  1ZBI A;  1D9D A;  3MMV A;  3ZT3 A;  5EVZ A;  5KQ8 A;  3CQ8 A;  3P83 D;  2EX3 A;  1JLQ A;  2P9L A;  3IKM A;  3ZT0 A;  4F3T A;  1QE1 A;  1KAZ A;  2Q1N A;  1W2B M;  4WF9 L;  2B3C A;  2XRI A;  4CZM A;  4OKJ A;  3ZT1 A;  2BGG A;  5AQU A;  1NGE A;  1QVF M;  3NHG A;  4LF7 K;  4FJG A;  4NXM K;  2QWL A;  4GVE A;  3CJC A;  4JI2 K;  1HJO A;  4FJ5 A;  3RRG A;  4E7H A;  3CC2 N;  5I3U A;  2GUI A;  4F9O A;  4CD3 A;  4FOE A;  3VQC A;  4DFM A;  3VEW A;  1SQK A;  1VAZ A;  3CJ9 A;  2UXC K;  5AQP A;  1SL2 A;  5TKY A;  3SJJ A;  4M3W A;  4KTW A;  3VEX A;  3OYD A;  3DRS A;  4DV3 K;  3H6E A;  5C12 A;  3PO5 A;  4ILG B;  5AQI A;  1ZVG A;  1IO2 A;  1B3C A;  1E4F T;  2YJE A;  1NJW A;  5M1K A;  3CCM N;  4QCL A;  5BPN A;  3V9Z A;  3CI5 A;  1IBL K;  3MEC A;  3NH2 A;  3O1W A;  5M1P A;  4FJK A;  5DM7 L;  4LH5 A;  4FPB A;  4JKG A;  4CEA A;  3UIQ A;  1JLE A;  2CH5 A;  5GAG P;  3HM9 A;  1X9M A;  3SMP A;  4CJQ A;  2D4W A;  4KFB A;  2XY6 A;  3O8M A;  4CK1 A;  2X6S A;  2HHT A;  1M1K O;  1KV0 A;  5JVH L;  4FLW A;  3IMX A;  4KHP K;  1YF5 L;  5J1E A;  3HO1 A;  3TTC A;  1X1P A;  1WSF A;  4JKG B;  3SQ2 A;  3SPY A;  4OKE A;  4O0J A;  3LP3 A;  2E2F A;  5HRO A;  4BRL A;  1FH3 A;  5KQD A;  4B1X B;  3CCQ N;  4I6M A;  4DSK A;  1YJW N;  4ILJ A;  3OS1 A;  4AHU A;  2GWK A;  3EL2 A;  4BDP A;  2F9T A;  3SQ0 A;  1NPI A;  3J7Z O;  3PIP L;  1RIL A;  4I2Q A;  4FO0 A;  4IFE A;  2ASC A;  2BE2 A;  4CJU A;  1LQQ A;  3OYJ A;  4B1U B;  3SBG A;  2ATQ A;  4EP4 A;  4MQ3 A;  4M41 A;  3KVG A;  1ASV A;  1HUX A;  1TVR A;  4I6M B;  1YJN N;  3S41 A;  4XH5 A;  5HRR A;  1WSE A;  4ELT A;  1IKY A;  3LWL A;  3PX4 A;  3DWL A;  4DMN A;  3TAM A;  3AVC A;  1LW0 A;  3ITH A;  5SZT A;  3ULE A;  1RBT A;  3U4L A;  2HVI A;  4FW1 A;  4BRF A;  5AQZ A;  3CCV N;  1Q82 O;  2QW9 A;  4B8A B;  3MEG A;  3AY9 A;  2HB5 A;  4KH4 A;  3A5O C;  1SUQ A;  1BGX T;  2O8E B;  3ULE B;  1TL1 A;  5I42 A;  4RW4 A;  4JNE A;  2FSJ A;  3ZEU A;  1KTQ A;  3JAM O;  3TWH A;  3MX2 A;  3JSM A;  4M63 C;  4A2A A;  2WTU A;  3GBT A;  3SAF A;  2W41 A;  3KOY A;  1IKX A;  3QIN A;  3H1V X;  1E3M A;  2ZJP L;  4ID1 A;  3CC4 N;  2HMP A;  3VQD A;  1RDA A;  4FWM A;  4NCG A;  3MN9 A;  3WXK A;  4B3R K;  3M8R A;  3ZEU B;  4BRK A;  1IG9 A;  3TAQ A;  3EE8 A;  5ADX H;  1UWB A;  4BE0 A;  3HP9 A;  3TSU A;  1RTJ A;  5FLX O;  1ATS A;  4EFH A;  4YOW A;  3CFR A;  2QKB A;  3D7E O;  1OVQ A;  1GLA G;  2WON A;  4DKW A;  5AQS A;  3W0L A;  2R7Y A;  3JS6 A;  1JCE A;  4DQQ A;  1BMR A;  3AGR A;  2HNZ A;  3KK1 A;  2O8D A;  4E1J A;  5HOO A;  3R8E A;  1A5W A;  4A5B A;  4DTU A;  4GVM A;  1LOT B;  2EHG A;  4BE2 A;  3HYF A;  3QET A;  2YKN A;  2ZD1 A;  5BRH A;  3LM2 A;  3WEE A;  5KPR A;  2GTD A;  1VQ9 N;  3OYF A;  1QQN A;  1BCG A;  4JK8 A;  1HRH A;  3ZCM A;  3U9Z A;  1VQ4 N;  3J7Y P;  3QNN A;  3E01 A;  4CHP A;  4L3Q A;  4H5T A;  1DT9 A;  3FZH A;  2G8H A;  4DR5 K;  2A7T A;  3C6U A;  2HNY A;  3NE6 A;  1X3N A;  1C1A A;  1PX9 A;  4HVJ A;  4C8O A;  1J6Z A;  3WEE B;  1TL3 A;  4U7B A;  3FZL A;  1VSJ A;  3C0B A;  4Q5V A;  4OLA A;  5HRS A;  4HHT A;  4NLC A;  1ZU3 A;  1L5U A;  3TU5 A;  4CVN E;  3THW A;  2HOE A;  4M3Z A;  1T6C A;  2VY6 A;  2JGU A;  4DG1 A;  1HKG A;  1RBS A;  4JI4 K;  1VSF A;  4FLV A;  1ATR A;  4CJK A;  4FWS A;  1IBM K;  4GNI A;  3G10 A;  1ZBU A;  2G8I A;  2WOM A;  2ZGZ A;  1TKD A;  1TAU A;  3THW B;  4LSL A;  1CZ9 A;  3L6Q A;  1RT6 A;  4KAZ A;  2V51 B;  4JLH A;  3E7R L;  3L2V A;  2E1Z A;  2LJ7 A;  4FXD A;  1X9S A;  1AYJ A;  3VPZ A;  3D2E A;  4IJN A;  3IUC A;  4PKG A;  1L3U A;  1MDU B;  5GAD P;  2OPR A;  3TAP A;  1CZA N;  2F9W A;  2KFN A;  4M45 A;  3V4I A;  3IS9 A;  5AJ3 K;  1QHT A;  3AVB A;  5FPN A;  2BUP A;  4M3Y A;  4XH1 A;  3CJA A;  1LWF A;  3LP2 A;  3EKS A;  4X64 K;  3VQ5 A;  2QWM A;  3FFI A;  1NM1 A;  4KH5 A;  3QEI A;  1SL1 A;  3CCE N;  3DJC A;  4DV6 K;  5BPL A;  4B1Y B;  1CN2 A;  3LDL A;  3GL1 A;  4YDU C;  1YIJ N;  4BE1 A;  3AVK A;  1TK0 A;  3OVN A;  4I9L A;  4BDZ A;  4PHT X;  4WE1 A;  4DSI A;  2NNW A;  4A59 A;  5ADX A;  4CZG A;  1HLU A;  4BR2 A;  2XO7 A;  3PY8 A;  3L4Q A;  3K9K A;  4J8F A;  2JWL A;  5AQW A;  3TAN A;  3I56 N;  2JDQ D;  1RDB A;  1RFQ A;  1FJG K;  3KKR A;  4DQ8 A;  3SZ2 A;  4JKC A;  4CER A;  3OA9 A;  2P1J A;  1HPZ A;  1ZYV A;  1HNV A;  2HF3 A;  4FOI A;  1KD1 O;  4UAE F;  3E1Y A;  3D6R A;  4BC3 A;  1N8R O;  3RVC A;  1HKC A;  4Z4G A;  3CER A;  3VF4 A;  1I6F A;  2N2R A;  3SBT A;  3SQ4 A;  4CBU A;  4JKH A;  3MN5 A;  4BQL A;  4FJX A;  2P51 A;  2HHX A;  3KOZ A;  1RDC A;  1XHZ A;  1NK6 A;  1Q8I A;  1S1V A;  1POI A;  2X78 A;  2VG6 A;  2HHS A;  4BRP A;  4ZTF A;  2G8V A;  2NRT A;  1V4T A;  2H3G X;  3CM6 A;  1DLO A;  2GX9 A;  3BK3 C;  2N69 A;  2Q2R A;  1N5Y A;  4EZ6 A;  2GMO A;  5KTQ A;  1K9M O;  4CJ3 A;  3CCS N;  2G8K A;  4CGG A;  4FJH A;  4CW7 B;  4HCB A;  4M42 A;  3CQX A;  4JI8 K;  2GEL A;  3KLG A;  1EXQ A;  4B9T A;  1LV5 A;  4KKO A;  1I3A A;  3OS2 A;  1NJZ A;  1ZBF A;  3QER A;  4FM2 A;  1BCO A;  2KBK A;  5AZI A;  1K8B A;  4Z4I A;  2HVH A;  4EAH D;  1OH7 A;  2OPS A;  4CF8 A;  2V7Z A;  4CJ7 A;  4YOV A;  4WQ4 C;  3O1B A;  1WAF A;  3AA3 A;  1SKW A;  4G9Z A;  1LWE A;  3O9T A;  3QLH A;  5EXW A;  3IFR A;  2OPP A;  5GIP A;  5KRS A;  1DGK N;  2XY5 A;  3HZ6 A;  1KXP A;  2OTL N;  1HMV A;  2I61 A;  5FPM A;  4YY3 K;  4ISG A;  1C0G A;  4H0V B;  3HPG A;  3LDN A;  2YNG A;  3HOT A;  3KK2 A;  3CF5 L;  2YV0 X;  2QEX N;  3KD1 E;  5CYQ A;  2PYJ A;  4RW8 A;  4DR1 K;  4JYA K;  1MU2 A;  3T1H K;  1NMN A;  5AQY A;  4B8C A;  4EZ9 A;  5BRE A;  1BA0 A;  2Z1G A;  5JLF A;  2O4I A;  3JXU A;  5BN9 A;  1WLJ A;  3DRP A;  4CJL A;  4PKI A;  3ATV A;  4FPA A;  1NGC A;  1BU6 O;  1V4S A;  3P39 A;  4O44 A;  4DV4 K;  4K8Z A;  3RTV A;  4LF8 K;  2NUB A;  1YAG A;  1Q86 O;  3L8B A;  2XHB A;  5IT9 O;  4KHU A;  1SS6 A;  3SUN A;  2QKK A;  4CEZ A;  5HRN A;  2W6K A;  1ZFU A;  3KLF A;  3TAR A;  2A41 A;  3EZ5 A;  3GE1 A;  1Y97 A;  4DTO A;  1ICA A;  1G15 A;  2YHA A;  4BRQ A;  3G71 N;  2YHX A;  4QS7 A;  1IJJ A;  2E0H A;  1Z26 A;  3NFA A;  3M8P A;  1L4V A;  1OH8 A;  4LY7 A;  4IXC A;  3TAE A;  1BK8 A;  3MN6 A;  3KZB A;  4CEQ A;  4H0T B;  3WXM B;  3H45 C;  4CJT A;  1NK8 A;  4ILH A;  2IVP A;  1S1X A;  1RDU A;  2VG7 A;  4Z4E A;  1I2U A;  1XMQ K;  4AM7 A;  4OO1 J;  3FZF A;  1VSH A;  4DU3 A;  3MN7 A;  4FJL A;  1TYQ A;  1OKJ A;  4DSL A;  2ITM A;  4IOC L;  1FKO A;  1CHZ A;  4DF4 A;  4A2B A;  1RCH A;  2F8S A;  1VK0 A;  2ZE2 A;  1NWK A;  1U2V A;  4B9M A;  3O4Q A;  4YHH K;  1L3S A;  2QWP A;  4BRG A;  2B4J A;  2HHI A;  1SKR A;  4LD0 A;  1TYQ B;  1HYV A;  3EKU A;  4BR0 A;  3BGR A;  3IDH A;  3KP1 A;  3K57 A;  4E7L A;  1NMD A;  4OPH A;  5I9E B;  1EWQ A;  4W5R A;  2LR3 A;  1GLL O;  1U2V B;  1QZ6 A;  3PSM A;  1SN4 A;  4BGA A;  1VSE A;  2D0B A;  3VGM A;  1KAY A;  1LAW A;  4Y1D A;  3NGY A;  3KWG A;  5HBM A;  3E9P A;  4M3U A;  4JD2 A;  2WUS A;  4CF1 A;  3LZI A;  3AO1 A;  1ZUT A;  3C7N A;  4YOY A;  2EWS A;  1VQO N;  4KI6 A;  2A40 A;  3HTV A;  4DTS A;  3SUQ A;  4DU1 A;  2WFB A;  3TSP A;  3BDP A;  3LPT A;  1NK9 A;  1QTM A;  2FBT A;  3S5T A;  1SNB A;  1GOA A;  1K8A O;  4IFV A;  3A5L C;  4JD2 B;  1TUU A;  3C7N B;  4GV6 A;  3PO4 A;  3DOL A;  2LI7 A;  1JXB A;  3ID6 A;  4HCC A;  3C6A A;  3VQE A;  2ASO A;  3QFU A;  3UE5 A;  3EY1 A;  3WXL A;  5FRM A;  4PL8 A;  1C56 A;  4G1Q A;  3O4W A;  3KTQ A;  1U04 A;  4IWV A;  1IKW A;  5E26 A;  4L8R B;  4H4O A;  2HW3 A;  2E4L A;  3G6E N;  3F5T A;  1MWM A;  4C1N K;  1XI1 A;  3CW4 A;  4FK0 A;  4UJ0 A;  4WQ4 A;  4CFC A;  1JJ2 M;  4JV5 K;  3DLR A;  3H3O B;  3NGZ A;  4OKK A;  2IGI A;  2NRV A;  4BR9 A;  4FWL A;  4N56 A;  4BR7 A;  1WSH A;  2J4R A;  1VQ5 N;  1JCG A;  4NCB A;  5AQG A;  1BDG A;  3NDK A;  1YHQ N;  3CYG A;  3J80 O;  3NF8 A;  1TI5 A;  2N2Q A;  1RBU A;  1YVU A;  4GKK K;  3VA3 A;  5AQR A;  3OHR A;  4QS8 A;  1S6Q A;  2LY6 A;  3KKS A;  4B1Z A;  5LJV A;  4KB0 A;  3LZJ A;  3OYA A;  3AVL A;  4M7X A;  1J5E K;  3AA5 X;  4BG8 A;  3MDQ A;  3K5N A;  3ZSZ A;  4K25 A;  5JMV A;  4BC4 A;  4CFB A;  4JI3 K;  4BR4 A;  1IBK K;  2MZ0 A;  3OJU A;  1BL3 A;  1NGD A;  2HBL A;  1JKH A;  3PLA A;  2KBJ A;  2AA4 A;  1ZYW A;  3ZSO A;  5LJW A;  1P0A A;  1QSY A;  4ELV A;  4HE7 A;  1GPT A;  3B6P A;  2E3G A;  3I8B A;  3ENB A;  1TKZ A;  5CHI A;  1TUY A;  4Y0W A;  5DK5 A;  1BA1 A;  2KQ2 A;  4NB4 A;  2NZT A;  4BRN A;  4R79 A;  5CE3 A;  4FJM A;  2SN3 A;  4B9U A;  1FXX A;  4E0D A;  4OPJ A;  4YOX A;  5EY4 A;  3LAK A;  4RWT A;  2DFE A;  2GEM A;  3A8Y A;  4BEC A;  1RDW X;  3RMB A;  3O9S A;  3V1O A;  3M8Q A;  3ENO A;  1RTI A;  4FM0 A;  1SL0 A;  2M8B B;  1RTD A;  4JKF A;  4JI5 K;  1CXU A;  4J2B A;  1TV6 A;  3ZT2 A;  1S72 N;  1OVY A;  4KHQ A;  1SEG A;  2RN2 A;  5GIO A;  2LKB A;  3E9L A;  3SV4 A;  1SV5 A;  4XJX A;  3L2Q A;  3D0P A;  3CET A;  1U4B A;  2Q3S A;  2HBM A;  2QWO A;  4B3S K;  4O5F A;  2FF6 A;  5JS2 A;  4KV8 A;  4QAG A;  2OZM A;  1BCM A;  1J54 A;  3PX6 A;  1JLC A;  1T7E A;  2O8E A;  3MK6 A;  3EO3 A;  1VNA A;  3SMS A;  3O9U A;  3MXM A;  4LF9 K;  3ZX3 A;  4KHY A;  5C2F A;  3SK3 A;  4FSV A;  1XNR K;  2IAJ A;  4BRA A;  1Z6R A;  3MWP A;  4DR3 K;  4KRE A;  4H5N A;  3AO2 A;  1WBB A;  4CZH A;  3KHW A;  3RMC A;  4CZF A;  3HRG A;  4KTZ A;  4BRO A;  1C55 A;  4LF6 K;  2HST A;  3L3U A;  2Q0R A;  1NOZ A;  2KKZ A;  4MLH A;  5CZ1 A;  1T44 A;  3WNF A;  2DFF A;  4O4G A;  4X66 K;  2HBJ A;  3UKU B;  2YNF A;  4JK7 A;  3HST B;  4J2E A;  1VQL N;  5GAH P;  3C6H A;  1KC8 O;  3OYM A;  4TSX A;  1KVC A;  4BC5 A;  2G8U A;  2VWJ A;  5M1F A;  2Q31 A;  3CJ1 A;  3VEV A;  3OJS A;  2VYP A;  2XY7 A;  3NF7 A;  2LSN A;  3F2K A;  5A2Q O;  5T7B A;  4PY5 A;  3OYI A;  4N76 A;  1NKE A;  2ETJ A;  4CIF A;  5LL6 Z;  4ID5 A;  1OH6 A;  4AM6 A;  4QS9 A;  1TAQ A;  2ZJR L;  1VQP N;  2BRZ A;  4CJP A;  3FFK B;  1WWN A;  2BH1 A;  5JS1 A;  1NBW A;  3W3D A;  3THV A;  1RNH A;  1HJR A;  1JLB A;  2E6L A;  3CC7 N;  3QDK A;  4JHD A;  1OZZ A;  1BOT O;  1RT2 A;  3O3H A;  3SUP A;  3VEY A;  1RBV A;  4MO4 A;  1WN7 A;  3DMJ A;  2YC1 C;  4OVL A;  1AHO A;  4CEE A;  2HBK A;  4CFD A;  1F21 A;  4ELU A;  4RW9 A;  3NVK A;  4KI4 A;  2OTJ N;  1EKE A;  1D4X A;  4CK3 A;  3BZK A;  4V1D C;  3THX A;  3DLL L;  4CFA A;  3OBY A;  4JHD B;  3DM2 A;  5KGX A;  2ZWH A;  1K73 O;  5F1X A;  3KJV A;  1JL1 A;  1DJT A;  2NRZ A;  4NLB A;  3LDS A;  1VQM N;  4GV9 A;  1ESV A;  4E19 A;  3MX5 A;  4Z4C A;  3CCL N;  4HWI A;  3THX B;  4BE7 B;  3P38 A;  3VGL A;  2CH6 A;  5M1N A;  1NK4 A;  4DFJ A;  3VQ9 A;  4B9Q A;  3CXC M;  4AEI A;  2GBZ A;  3MCP A;  2VG5 A;  4FLZ A;  3O3F A;  1U48 A;  4YOT A;  1VSD A;  1KQS M;  3S9H A;  5AQX A;  2QWR A;  1I94 K;  1K6Y A;  4YNQ A;  1YIT N;  4PKH A;  4CF9 A;  3V9U A;  1MA9 B;  1D9F A;  4LFC K;  3S3M A;  2NY8 X;  2QWQ A;  4Z0U A;  2KFZ A;  2E1Y A;  4FJN A;  1S5J A;  1YTA A;  4CES A;  5DM6 L;  4RW7 A;  2O8B A;  3SJH A;  3CPE A;  1LAV A;  4Y1C A;  3SLC A;  4W5O A;  4IO8 A;  3NH1 A;  1L3V A;  3BEX A;  5CY4 A;  4E3S A;  3ZET A;  1P8Z A;  2X6N A;  3TAB A;  1NJX A;  1DEJ A;  2KZM A;  4ISE A;  3ASM A;  2O8B B;  3K0S A;  4EIA A;  3VF2 A;  1CLQ A;  1NGH A;  1VSI A;  1GLC G;  1U6Z A;  1W0H A;  3ZET B;  3CJB A;  4KPY A;  1QS4 A;  4O55 A;  4W5N A;  3ZSY A;  2QTD A;  3I0S A;  1VSM A;  1T1T A;  2P9U A;  1TK8 A;  3QI7 A;  1JXE A;  2D1K A;  2W40 A;  2QK9 A;  4DF8 A;  2Z1J A;  4NO7 A;  1JL2 A;  3K5O A;  4K41 A;  4BQZ A;  4FLY A;  1ZXO A;  3WXJ A;  1KAX A;  1NGG A;  1WNS A;  5DMR A;  3ZX2 A;  3QB0 A;  5BRF A;  2P9U B;  2MBK A;  4A61 A;  4C23 A;  4CI6 A;  4WQ5 C;  4CGH A;  5CY0 A;  1X9J A;  1S9E A;  4NYF A;  1BIU A;  3ZLJ A;  2YNI A;  4FL9 A;  3QML A;  3K59 A;  4DV2 K;  4JS4 A;  2CGL A;  1IH7 A;  4XIU A;  3TI0 A;  2YHB A;  2YNH A;  2ASP A;  3EZW A;  4JI7 K;  4B3M K;  4HTL A;  1NRA A;  2KW4 A;  1NGI A;  1HNI A;  4CZL A;  3S3N A;  1NGJ A;  3ZSQ A;  3UKR A;  1LWC A;  1BWF O;  3ISN C;  1W7A A;  1MWK A;  3QEW A;  3VET A;  3HOS A;  2I7P A;  1Q7Y O;  4IG3 A;  4KHS A;  4DQP A;  4J2A A;  2E2P A;  2VWK A;  4A57 A;  2FSK A;  3E7U X;  3FE1 A;  1WAJ A;  1XWL A;  5HP1 A;  1S6P A;  3UKR B;  4H5R A;  1P00 A;  3AVG A;  3FLC O;  3A2F A;  3K9J A;  4MLE A;  5M1Q A;  4BDY A;  1T7P A;  5CZ2 A;  2KSK A;  3HJF A;  2DFH A;  3KWI A;  4CJR A;  4OPK A;  4PWD A;  4IG0 A;  1IV0 A;  3F73 A;  3QIO A;  3AVM A;  2Y1J A;  4CGJ A;  1GLE G;  1YT3 A;  3QFP A;  4O8K A;  1UA0 A;  2E20 A;  1S1U A;  1QQO A;  4O0I A;  1BQN A;  4DSJ A;  4W5T A;  4FLX A;  3O6W A;  5JEN A;  3EN9 A;  1C0U A;  2P5G A;  2W00 A;  4FVU A;  3CJ7 A;  1JXC A;  1GLB G;  2QA4 N;  3RMA A;  2QI2 A;  4JRP A;  1HNZ K;  3MXJ A;  4JKB A;  3RR7 A;  2VGM A;  1I6G A;  3O3G A;  5J2M A;  1S1W A;  4JKA A;  4A62 A;  4CF0 A;  4WCE L;  5J2P A;  2Y1I A;  4FZY A;  3O9R A;  4E1N A;  3HXM A;  4EHT A;  4B1V A;  1IG8 A;  3LP0 A;  1NG9 A;  3TPQ A;  1EET A;  3DXM B;  3SF4 D;  4FZX C;  1JLG A;  3ZSX A;  3ULD A;  4CED A;  3HL8 A;  2OAN A;  3TAG A;  2QM1 A;  4DTJ A;  1UGL A;  5HL7 L;  3VTH A;  2UXB K;  1M90 O;  2RPI A;  2NRX A;  3CCJ N;  4K42 A;  2D0P A;  1HNX K;  4DLG A;  3HVT A;  3O4N A;  1ASW A;  4LF5 K;  4F4K A;  3OY9 A;  4BRI A;  4IO9 L;  2P9N A;  3KOX A;  4Z4F A;  3DYA A;  4CIG A;  4HUF A;  3DXK A;  2HHU A;  1JCF A;  4MFB A;  4FK4 A;  1SN1 A;  4E7J A;  4FWN A;  3SAG A;  3T3F A;  3ZSV A;  3NMU A;  1C0M A;  4BRC A;  5BPM A;  3LAN A;  1PE4 A;  4DV0 K;  2FXU A;  1RT3 A;  3HI0 A;  3J8A A;  2P9N B;  5F2R A;  3QEX A;  4DLE A;  3DXK B;  3OBW A;  1QVG M;  2C1I A;  2BAN A;  3ZYY X;  4E7K A;  4Q0B A;  1UOC A;  4CJ4 A;  3P1G A;  1SAZ A;  4AHV A;  2WBN A;  3FGU A;  4B3O A;  4B9L A;  1HX1 A;  2B68 A;  2YHW A;  3B8A X;  1YJ9 N;  4MO5 A;  4CJV A;  3VQB A;  2KTQ A;  3ZSR A;  1XC3 A;  4LF4 K;  2PY5 A;  2E3F A;  5EX5 A;  4UAD E;  3G0Z A;  2YHY A;  4DSE A;  1S1T A;  3NF6 A;  1T0Z A;  4I7F A;  4DR4 K;  4BRD A;  1REV A;  1KLM A;  3OYK A;  2HHQ A;  2O8C A;  4WQ5 A;  4DHY A;  4UY8 O;  3H08 A;  2HHH K;  4DR6 K;  5F0X A;  3H1Q A;  2RE2 A;  3G25 A;  3WXI A;  3SNN A;  1U45 A;  4DTM A;  5K14 A;  3V1Q A;  4AQY K;  4CE9 A;  5E84 A;  1S3X A;  1EP4 A;  5KPZ A;  2A1S A;  3OW2 M;  4JAX A;  4JRQ A;  5J2N A;  2Q0U A;  3SPZ A;  2IVN A;  3C95 A;  4BGB A;  2YKM A;  2G8F A;  4FCY A;  4H5W A;  4V19 S;  2O8C B;  2PYL A;  1DQ7 A;  2VWB A;  5JLH A;  3QES A;  5AQO A;  1N6Q A;  3O5B A;  4DS5 A;  1S9G A;  3NBP A;  3QO9 A;  4UQG A;  4GKJ K;  1DTQ A;  3IAY A;  4DUY K;  3VGK A;  3CPW M;  3DLG A;  1N34 K;  4DTP A;  2NRR A;  4FK2 A;  5JVG L;  1WSI A;  4F8R A;  2PBD A;  3NH0 A;  5AQK A;  4I2P A;  3NGI A;  2FF3 B;  3HPH A;  3MWT A;  3BUZ B;  2G8W A;  3CCR N;  3U3Y A;  3TAF A;  4FJ7 A;  3DLE A;  3L0Q A;  5SWM A;  3VQA A;  3ENH A;  4B3T K;  1HPM A;  5AZJ A;  4WFB L;  3CYM A;  1WSG A;  1D8Y A;  4CHZ A;  3N4Q A;  1NU0 A;  2OYQ A;  3VQP A;  4GY2 B;  5AQV A;  3A0I X;  4B9S A;  4OGE A;  4H03 B;  5AZJ B;  4IDK A;  1YUW A;  2KHO A;  1H1V A;  1RT4 A;  1JKZ A;  3CHW A;  2VGN A;  4FVM A;  3FZK A;  2MN5 A;  3V6D A;  3KK7 A;  3TSQ A;  1NE5 A;  4QOZ B;  3DI6 A;  1FW6 A;  1BUP A;  2PAV A;  4FLU A;  3AVN A;  2QWN A;  1LCU A;  1RT5 A;  4AAZ A;  4JI0 K;  4CQK A;  4PL7 A;  1J9A A;  3HBT A;  3O08 A;  1VRU A;  2X74 A;  5BR8 K;  3CQY A;  1E4G T;  2ZJQ L;  1Q9X A;  3EE9 A;  4GV3 A;  4CHO A;  3BZC A;  4DQI A;  5J2Q A;  1EQY A;  4HTU A;  5AFU H;  3DLB A;  2VCP A;  4YFU A;  3V9X A;  1DKG D;  3PSF A;  3WQU A;  3R2V A;  3TTF A;  5C15 A;  1BIZ A;  4FM1 A;  3AVH A;  4C8N A;  3OYN A;  3CFO A;  1U47 A;  3KLE A;  2ZM6 K;  3QNO A;  4CD1 A;  3L2U A;  3O80 A;  1I39 A;  1XHX A;  3IG1 A;  3T1Y K;  3P5J A;  4CBX A;  1VNB A;  3D2F A;  4ISF A;  4GMJ B;  3NF9 A;  2D0C A;  4DS4 A;  3VEN A;  2LN8 A;  4YOU A;  3M1F A;  3T19 A;  5CR4 A;  2P9L B;  1BG3 A;  4BRE A;  1GLD G;  1MYN A;  4KO0 A;  1L3T A;  4LSN A;  4U67 L;  2V52 B;  3A5N C;  4JKD A;  1T3V A;  3D2F B;  4CZI A;  4DB3 A;  2KLA A;  2FLO A;  4KH6 A;  3CG7 A;  1Q9Y A;  2E2N A;  3OYH A;  1YTU A;  5LMU K;  1XC9 A;  2P9P A;  3WNG A;  1UA1 A;  4C1N I;  1EWR A;  3U3G A;  1CZB A;  4CZJ A;  2O4G A;  2KYQ A;  3M8S A;  2LT8 A;  3L56 A;  2YX6 A;  3DAW A;  1WB9 A;  1NKB A;  3O9Q A;  5AR0 A;  2D0A A;  2P9P B;  4CIE A;  1R0A A;  2I7N A;  3CM5 A;  1GOC A;  1SKS A;  2FSN A;  2DTU A;  1G99 A;  3V9S A;  4DTX A;  3AV9 A;  2A1R A;  3F9K A;  3DLK A;  3KLH A;  4FJ8 A;  1T03 A;  1YXQ A;  1Q81 O;  1Y64 A;  3PX0 A;  4BY9 C;  5C24 A;  2YI1 A;  3I0R A;  3RR8 A;  4CHY A;  4CEO A;  3CCU N;  1EO1 A;  2ZF5 O;  5H1S Q;  3H3N O;  3FZM A;  2F4V K;  3IRX A;  1A5X A;  3Q7B A;  3OYL A;  1XNQ K;  4E1M A;  4H5V A;  4B9V A;  3I33 A;  2HND A;  4M7Y A;  2E88 A;  3U8X A;  2XY8 A;  3AO3 A;  4EP5 A;  4DUZ K;  2BDP A;  2YJF A;  5C0Y A;  2F96 A;  3KK3 A;  3U6F A;  5KI6 A;  1FK9 A;  4CJ5 A;  3M6G A;  4JEP A;  3UKU A;  1NOY A;  4NXN K;  2NRW A;  3SCX A;  2VQE K;  2RF2 A;  3VER A;  3ZT4 A;  3OYG A;  3D45 A;  2LJM A;  4CZK A;  3AAQ A;  3CD6 N;  3RRH A;  3RMD A;  1ZBL A;  1VQ7 N;  4DV5 K;  2RHK A;  3AAP A;  3BF1 A;  4BRH A;  4JKE A;  2OPQ A;  5EOY A;  5AFU A;  1RDD A;  2QXF A;  3Q7C A;  3NCI A;  3KD5 E;  4RW6 A;  3WNE A;  1NH5 A;  1TGO A;  4JS5 A;  3VQ8 A;  3LAM A;  4OPA A;  5BN8 A;  5FDL A;  1N36 K;  3HSC A;  4KRF A;  3N4P A;  1BI4 A;  4ZTJ A;  4CJS A;  1NGB A;  1HNW K;  3S3O A;  3OYE A;  3E66 A;  1KSP A;  3LDP A;  4JI1 K;  2O8F A;  4FZZ A;  3HT3 A;  1ATN A;  4C8M A;  3QBW A;  1TKX A;  2DY4 A;  1J53 A;  3TTD A;  5LY3 A;  3K2P A;  1ZYQ A;  4KB1 A;  1BI4 B;  4IJA A;  3AA2 A;  4FJJ A;  1I2V A;  2QXL A;  4W5Q A;  1MR4 A;  2O8F B;  1RTH A;  3VQQ A;  4AB0 A;  2NLX A;  1XUP O;  1BQM A;  5FPE A;  4AHC A;  1O1W A;  4DQR A;  3V1R A;  2OCE A;  4H8K A;  2Z1I A;  2HF4 A;  1S22 A;  4BWM A;  4C8L A;  2Z1H A;  3OTO K;  3VMF B;  2V7Y A;  3V81 A;  3C6T A;  4XH4 A;  3EEQ A;  1N32 K;  3K5L A;  3VN5 A;  4AHT A;  3L4I A;  3PSI A;  4IFY A;  4CGD A;  4DR2 K;  5CYM A;  1HQU A;  1VQN N;  4DV1 K;  1GPS A;  2UUC K;  3DLH A;  3VTI A;  4M3T A;  3GDQ A;  4YOR A;  3BF3 A;  5GIN A;  2O8D B;  1ITG A;  4XEI A;  4CEF A;  3T1A A;  3BP8 A;  1YI2 N;  1FKP A;  3QIC A;  1ZVE A;  2E2Q A;  4DTN A;  2IDO A;  2KGQ A;  3LDO A;  3JYT A;  4CCH A;  4DR7 K;  3SAH A;  3HPO A;  5IWA K;  4Z94 A;  3SV3 A;  2IS3 A;  4M3R A;  2PFU A;  2K35 A;  4H0Y B;  4ZHR A;  3K58 A;  4FWO A;  2P9S A;  4BVO A;  4PUO A;  2WC9 A;  2GWJ A;  1WSJ A;  2D56 A;  2NRH A;  3SYZ A;  1C1C A;  1Q18 A;  2F7T A;  1YVN A;  1B9F A;  3V9W A;  1HKB A;  5AQM A;  5GAE P;  4KYP A;  4X65 K;  3MED A;  5BRD A;  1EX4 A;  3SI6 A;  4K0K K;  2YEO A;  1R59 O;  2P9S B;  3KLI A;  3AVA A;  2OA8 A;  2OZS A;  3MCA B;  5C10 A;  1JZB A;  1VRT A;  3SQ1 A;  4OJR A;  5FRN A;  1GLJ O;  4I9Q A;  3P4I A;  1GLF O;  4DV7 K;  3QBX A;  4CBW A;  3C94 A;  4LH4 A;  1U49 A;  1NK0 A;  1BO5 O;  1N4N A;  2DPN A;  1C0F A;  3EYZ A;  1QHA A;  4CZE A;  1GOB A;  1XMO K;  2KBH A;  1KFS A;  1B92 A;  1W9H A;  5B8H A;  3AVI A;  2IC3 A;  4PA1 A;  1C1B A;  2A42 A;  1T7A A;  1NNE A;  3D2E B;  1RT1 A;  4RTF D;  1ZC6 A;  3KOW A;  1SZ2 A;  5C42 A;  2KPY A;  2CGK A;  5AQQ A;  3LM9 A;  5C25 A;  3M3Z A;  1J5O A;  1BIS A;  4FWQ A;  4DSF A;  1WMT A;  1KVB A;  4H0X B;  3VEO A;  4CHQ A;  1NRB A;  2GV9 A;  1IKV A;  1TKT A;  5LMN K;  4R5P A;  4CJW A;  3HM8 A;  3VES A;  3ZX0 A;  4FYD A;  4FWR A;  5EU7 A;  3T69 A;  4NCA A;  4AF1 A;  3TR8 A;  4E72 A;  2P9I A;  4KTQ A;  1RT7 A;  1ILY A;  1NLV A;  2A3Z A;  4B9N A;  3A5M C;  4HUE A;  1QQC A;  5AQJ A;  4DQS A;  3R3L A; 
#chains in the Genus database with same CATH homology
 4DKW A;  5AQS A;  2AA4 A;  2Q36 A;  3W0L A;  3WT0 A;  2C1G A;  3E9O A;  3JS6 A;  4BVP A;  5LJW A;  4O8U A;  1JCE A;  4MDA A;  1SAZ A;  2WBN A;  3AGR A;  3FGU A;  1K8K A;  3KHY A;  1HX1 A;  4JK9 A;  2YHW A;  3B8A X;  1YJ9 N;  3I8B A;  3ENB A;  4MO5 A;  2P9I B;  5CHI A;  3NVM A;  1TUY A;  4Y0W A;  1XC3 A;  4E1J A;  5TKW A;  5HOO A;  5EX5 A;  4UAD E;  3R8E A;  1BA1 A;  4A5B A;  3R9P A;  5AQF A;  2NZT A;  2CGJ A;  4NB4 A;  4BRN A;  2YHY A;  1LOT B;  4R79 A;  5CE3 A;  4BRD A;  5MLC Q;  3CMA N;  3FR0 A;  5JIC A;  4WQ5 A;  4DHY A;  5BRH A;  4UY8 O;  1K8K B;  4YOX A;  3LM2 A;  3WEE A;  5KPR A;  5EY4 A;  2GTD A;  1VQ9 N;  5F0X A;  3H1Q A;  3I55 N;  1QQN A;  2RE2 A;  3G25 A;  3WXI A;  4RWT A;  4H0O A;  4JK8 A;  2GEM A;  4BC2 A;  3U9Z A;  1VQ4 N;  3A8Y A;  4IZ9 A;  4BEC A;  5E84 A;  2E8A A;  1S3X A;  1RDW X;  4L3Q A;  4H5T A;  4RCH A;  5KPZ A;  3OW2 M;  1DT9 A;  3FZH A;  4JAX A;  2Q0U A;  1X3N A;  2IVN A;  3O9S A;  4IOX A;  2YIP A;  4BGB A;  2IIR A;  4H5W A;  3ENO A;  2VWB A;  1J6Z A;  3WEE B;  5JLH A;  4U7B A;  3R1X A;  2E2O A;  3FZL A;  5AQO A;  2UYT A;  5AQT A;  3C0B A;  4JKF A;  3GOI A;  3VF6 A;  3O5B A;  4NLC A;  1NJI O;  4H0P A;  3TU5 A;  3VGK A;  4B1W B;  3CPW M;  1S72 N;  2HOE A;  1T6C A;  4BR5 A;  2NRR A;  1OVY A;  5JVG L;  2VY6 A;  2PBD A;  5AQK A;  1HKG A;  2FF3 B;  5GIO A;  3E9L A;  3MWT A;  3BUZ B;  1ATR A;  3CCR N;  1VQK N;  4FWS A;  3DXM A;  4XJX A;  4EHU A;  1VQ8 N;  4GNI A;  3CET A;  3L0Q A;  3ENH A;  2HBM A;  2QWO A;  1HPM A;  4O5F A;  2ZGZ A;  5AZJ A;  4WFB L;  2FF6 A;  3T7Z A;  3N4Q A;  3R6M A;  1QZ5 A;  3L6Q A;  1RGI A;  2V51 B;  2E1Z A;  2YIO A;  2D0O A;  3MK6 A;  4GY2 B;  3EO3 A;  5AQV A;  1QQM A;  3VPZ A;  3D2E A;  4IJN A;  4WFA L;  3IUC A;  3O9U A;  3SMS A;  3A0I X;  4K43 A;  4PKG A;  1MDU B;  5GAD P;  3ZX3 A;  2Q97 A;  4H03 B;  1CZA N;  5AZJ B;  2F9W A;  5C2F A;  1YUW A;  4FSV A;  3SK3 A;  2KHO A;  5AZI B;  4BRA A;  1Z6R A;  1H1V A;  3MWP A;  3KC6 A;  3CHW A;  2VGN A;  4H5N A;  3FZK A;  2MN5 A;  4CZH A;  3KHW A;  3KK7 A;  5FPN A;  3TSQ A;  4DCH A;  4CZF A;  2BUP A;  1BUP A;  2A5X A;  3HRG A;  3F9M A;  3CJA A;  3M5R A;  2PAV A;  5FPD A;  4XH1 A;  2QWN A;  2YCH A;  1LCU A;  3EKS A;  4PL7 A;  2HST A;  2Q0R A;  3HBT A;  3O08 A;  2QWM A;  3CQY A;  2KKZ A;  1E4G T;  1NM1 A;  4MLH A;  3EE9 A;  1T44 A;  2ZJQ L;  4KH5 A;  4GV3 A;  1X3M A;  5AQH A;  3CCE N;  1P90 A;  3DJC A;  1EQY A;  3U9D A;  2HBJ A;  3UKU B;  5BPL A;  5AFU H;  4B1Y B;  4IEE A;  2VCP A;  3LDL A;  3GL1 A;  4YDU C;  1VQ6 N;  4JK7 A;  1YIJ N;  1VQL N;  1DKG D;  3C6H A;  5GAH P;  3WQU A;  1KC8 O;  4BC5 A;  3R2V A;  3TTF A;  5C15 A;  5M1F A;  2Q31 A;  3CJ1 A;  1T6D A;  4PHT X;  3VEV A;  2VYP A;  4BRM A;  2NNW A;  4CD1 A;  4A59 A;  5ADX A;  3O80 A;  4CZG A;  1HLU A;  3F2K A;  4BR2 A;  4CBX A;  3D2F A;  3L4Q A;  5ELZ A;  4ISF A;  3K9K A;  4J8F A;  2JWL A;  5AQW A;  3H46 O;  3I56 N;  4AM6 A;  2JDQ D;  4QS9 A;  2LN8 A;  3VEN A;  4YOU A;  3M1F A;  2ZJR L;  1VQP N;  5CR4 A;  2P9L B;  1BG3 A;  4BRE A;  3FFK B;  1O13 A;  2BH1 A;  1GLD G;  1RFQ A;  1NBW A;  3W3D A;  4DQ8 A;  4JKC A;  4U67 L;  2V52 B;  3A5N C;  3AAR A;  4JKD A;  1T3V A;  3OA9 A;  3CC7 N;  4FWK A;  2ZGY A;  3QDK A;  3D2F B;  4CZI A;  4JHD A;  4DB3 A;  2KLA A;  1BOT O;  3AGK A;  3WUH A;  2FLO A;  2HF3 A;  2P9K A;  2AP1 A;  4KH6 A;  2A6A A;  4FOI A;  3VEY A;  3C65 A;  4MO4 A;  1KD1 O;  4UAE F;  2E2N A;  3D6R A;  3E1Y A;  4YDU A;  2P9P A;  4BC3 A;  3RVC A;  1N8R O;  1HKC A;  4C1N I;  2HBK A;  3CER A;  3VF4 A;  3NVK A;  2OTJ N;  3LDQ A;  1D4X A;  1WOQ A;  1WUA A;  1Z05 A;  3SBT A;  4CZJ A;  5C2D A;  4CBU A;  4UAF E;  4JKH A;  3MN5 A;  4BQL A;  3DLL L;  5BR9 A;  2YX6 A;  3L56 A;  3OBY A;  3DAW A;  4JHD B;  1K73 O;  1POI A;  2ZWH A;  5F1X A;  2P9K B;  3PIO L;  4BG9 A;  3O9Q A;  5AR0 A;  2NRZ A;  4BRP A;  3GG4 A;  2P9P B;  4KBO A;  2I7N A;  4NLB A;  2NRT A;  3VOV A;  2FSN A;  1VQM N;  4GV9 A;  1ESV A;  1V4T A;  1G99 A;  2H3G X;  4WFN L;  3MX5 A;  3WQT A;  3CCL N;  2GX9 A;  4HWI A;  2YIL A;  3BK3 C;  2Q2R A;  2GMO A;  4BE7 B;  3P38 A;  3VGL A;  1YXQ A;  2CH6 A;  3RSE A;  5M1N A;  1K9M O;  3CCS N;  4IEI A;  1Q81 O;  1Y64 A;  4B9Q A;  4BY9 C;  3CQX A;  2YI1 A;  5AQL A;  4A5A A;  3CXC M;  2GEL A;  3LL3 A;  3MCP A;  3UB5 A;  2JWK A;  4LC9 B;  4FWP A;  3CCU N;  2IVO A;  4YOT A;  1EO1 A;  2ZF5 O;  4MDB A;  5H1S Q;  3H3N O;  1W97 L;  1KQS M;  5AQX A;  3FZM A;  2QWR A;  3Q7B A;  2GUP A;  4JN4 A;  3RSE B;  4PKH A;  5AZI A;  1YIT N;  4EAH D;  3CIP A;  3P31 A;  4H5V A;  1MA9 B;  1ZBS A;  4BEB A;  2QWQ A;  2V7Z A;  4CJ7 A;  4YOV A;  4WQ4 C;  3O1B A;  2E1Y A;  1NGA A;  3I33 A;  4G9Z A;  3O9T A;  3U8X A;  4M7Y A;  2E88 A;  5EXW A;  5DM6 L;  3IFR A;  3SJH A;  3CPE A;  5GIP A;  2YJF A;  2BTF A;  3SLC A;  4IOA L;  5C0Y A;  4IO8 A;  5AQN A;  1DGK N;  3HZ6 A;  5M1O A;  1KXP A;  2OTL N;  1NGF A;  3BEX A;  5FPM A;  3ZET A;  4ISG A;  3M6G A;  1C0G A;  4WYB A;  4H0V B;  1P8Z A;  3LDN A;  4JEP A;  3UKU A;  3HOT A;  1DEJ A;  3CF5 L;  5KPT A;  2NRW A;  2QEX N;  3ATU A;  3PLA A;  4ISE A;  1XQS C;  3VER A;  4EIA A;  5AQY A;  4IDH A;  3VF2 A;  3CME N;  1NGH A;  5BRE A;  4CZK A;  1BA0 A;  3AAQ A;  3CD6 N;  3VEZ A;  5JLF A;  3ID8 A;  2ASM A;  1GLC G;  1U6Z A;  3ZET B;  1VQ7 N;  3JXU A;  5BN9 A;  3G4S N;  3CJB A;  2RHK A;  3AAP A;  3BF1 A;  4BRH A;  4JKE A;  2QTD A;  3MMV A;  2P9U A;  4PKI A;  3ATV A;  3QI7 A;  4FPA A;  5EVZ A;  5EOY A;  5AFU A;  1NGC A;  3Q7C A;  1BU6 O;  1V4S A;  2D1K A;  3P39 A;  2W40 A;  5KQ8 A;  2P9L A;  3IKM A;  4NO7 A;  4OPA A;  1YAG A;  5BN8 A;  4K41 A;  4BQZ A;  1ZXO A;  1Q86 O;  3WXJ A;  3HSC A;  1KAZ A;  2Q1N A;  1W2B M;  1KAX A;  3N4P A;  4WF9 L;  1NGG A;  4CZM A;  3ZX2 A;  4BRO A;  1NGB A;  1SS6 A;  3QB0 A;  5BRF A;  2P9U B;  2MBK A;  5AQU A;  3E66 A;  3LDP A;  4A61 A;  1NGE A;  4C23 A;  4CI6 A;  1QVF M;  4WQ5 C;  2QWL A;  4GVE A;  2A41 A;  3CJC A;  3GE1 A;  1ATN A;  1X9J A;  1HJO A;  3QBW A;  4BRQ A;  4FL9 A;  3QML A;  3G71 N;  3TTD A;  5LY3 A;  2YHX A;  4QS7 A;  3CC2 N;  4F9O A;  4CD3 A;  4FOE A;  1IJJ A;  2CGL A;  4IJA A;  3VEW A;  1SQK A;  1VAZ A;  3CJ9 A;  5AQP A;  4IXC A;  5TKY A;  3MN6 A;  3KZB A;  2QXL A;  4H0T B;  3WXM B;  3H45 C;  3VEX A;  2ASP A;  4ILH A;  3EZW A;  2IVP A;  3H6E A;  2NLX A;  1XUP O;  4HTL A;  5C12 A;  1RDU A;  1NGI A;  4ILG B;  5AQI A;  5FPE A;  1E4F T;  2YJE A;  1NGJ A;  4CZL A;  3UKR A;  4AM7 A;  5M1K A;  1BWF O;  3CCM N;  4OO1 J;  3FZF A;  5BPN A;  1MWK A;  3CI5 A;  3VET A;  3HOS A;  2I7P A;  3MN7 A;  1Q7Y O;  3O1W A;  2HF4 A;  5M1P A;  1TYQ A;  1OKJ A;  1S22 A;  5DM7 L;  4FPB A;  2ITM A;  2E2P A;  4JKG A;  3VMF B;  2V7Y A;  2CH5 A;  4A57 A;  5GAG P;  4IOC L;  2FSK A;  4XH4 A;  4A2B A;  3SMP A;  2D4W A;  1NWK A;  3L4I A;  1U2V A;  1VQN N;  3FE1 A;  3O8M A;  3UKR B;  4H5R A;  3VTI A;  2QWP A;  3GDQ A;  3BF3 A;  3FLC O;  4YOR A;  3K9J A;  4XEI A;  5GIN A;  4MLE A;  5M1Q A;  5JVH L;  1M1K O;  4BRG A;  3BP8 A;  3IMX A;  1YI2 N;  1YF5 L;  2E2Q A;  1TYQ B;  3QIC A;  3EKU A;  3KWI A;  4BR0 A;  3IDH A;  3TTC A;  4JKG B;  3LDO A;  3SAH A;  1NMD A;  4OPH A;  5I9E B;  4Z94 A;  1GLL O;  1U2V B;  1QZ6 A;  1GLE G;  3QFP A;  2PFU A;  4O8K A;  4BGA A;  3VGM A;  1KAY A;  2E2F A;  2K35 A;  2E20 A;  4H0Y B;  4BRL A;  3KWG A;  4FWO A;  1QQO A;  3E9P A;  5KQD A;  2P9S A;  4BVO A;  4JD2 A;  2WUS A;  4B1X B;  3CCQ N;  2WC9 A;  4I6M A;  3C7N A;  2GWJ A;  4YOY A;  2EWS A;  1YJW N;  1VQO N;  2D56 A;  2NRH A;  3O6W A;  4ILJ A;  2A40 A;  3EN9 A;  3HTV A;  2GWK A;  3EL2 A;  2W00 A;  1Q18 A;  2F7T A;  2F9T A;  1YVN A;  1HKB A;  5AQM A;  5GAE P;  5BRD A;  4FVU A;  3CJ7 A;  3J7Z O;  1GLB G;  2WFB A;  3PIP L;  3TSP A;  4FO0 A;  4IFE A;  2QA4 N;  2QI2 A;  4B1U B;  1R59 O;  3SBG A;  1K8A O;  2P9S B;  3A5L C;  4JKB A;  4JD2 B;  1YJN N;  3KVG A;  1HUX A;  1TUU A;  4I6M B;  3C7N B;  3S41 A;  4GV6 A;  2VGM A;  4XH5 A;  3MCA B;  5C10 A;  4JKA A;  3ID6 A;  4A62 A;  4WCE L;  3C6A A;  3DWL A;  1GLJ O;  2ASO A;  3QFU A;  1GLF O;  3P4I A;  3QBX A;  3UE5 A;  4CBW A;  3O9R A;  4EHT A;  3ULE A;  4B1V A;  3U4L A;  1IG8 A;  1BO5 O;  3WXL A;  2DPN A;  1C0F A;  4PL8 A;  3TPQ A;  3DXM B;  4BRF A;  1QHA A;  3O4W A;  3SF4 D;  5AQZ A;  4CZE A;  3CCV N;  1Q82 O;  2QW9 A;  4IWV A;  2OAN A;  5E26 A;  2QM1 A;  3AY9 A;  5B8H A;  5HL7 L;  3VTH A;  3G6E N;  3F5T A;  1MWM A;  3A5O C;  4KH4 A;  4C1N K;  2NRX A;  3CCJ N;  3CW4 A;  2A42 A;  1M90 O;  4K42 A;  2D0P A;  4WQ4 A;  1JJ2 M;  3ULE B;  2FSJ A;  3H3O B;  4JNE A;  3D2E B;  4RTF D;  3ZEU A;  2NRV A;  3MX2 A;  4M63 C;  1ZC6 A;  4BR9 A;  4FWL A;  1SZ2 A;  4A2A A;  4BR7 A;  1VQ5 N;  2J4R A;  2CGK A;  1JCG A;  5AQQ A;  3GBT A;  5AQG A;  1BDG A;  3LM9 A;  2P9N A;  4BRI A;  2W41 A;  3SAF A;  4IO9 L;  3M3Z A;  1YHQ N;  4FWQ A;  3H1V X;  3VEO A;  4H0X B;  3DXK A;  2ZJP L;  3CC4 N;  5AQR A;  3OHR A;  2HMP A;  1JCF A;  4QS8 A;  4FWN A;  3SAG A;  4FWM A;  4B1Z A;  3MN9 A;  3WXK A;  5LJV A;  3NMU A;  3HM8 A;  3VES A;  3ZEU B;  5BPM A;  3ZX0 A;  4BRC A;  4BRK A;  4FWR A;  2FXU A;  4M7X A;  3T69 A;  3HI0 A;  4AF1 A;  3J8A A;  2P9N B;  3EE8 A;  5F2R A;  4BG8 A;  3MDQ A;  2P9I A;  5ADX H;  4K25 A;  5JMV A;  1ILY A;  4BC4 A;  3TSU A;  1NLV A;  3DXK B;  3OBW A;  4BR4 A;  1QVG M;  2A3Z A;  3A5M C;  2C1I A;  1ATS A;  1NGD A;  4EFH A;  2HBL A;  4YOW A;  5AQJ A;  3ZYY X;  3D7E O;  1GLA G;  3R3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...