3GL1A

Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
383
Chain Sequence
b'AEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein SSB1
publication title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 124
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3gl1A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3gl1A04
3L4IA 3LDOA 5BN8A 2ZGZA 4IJAA 4MO4A 5AQFA 2QWOA 3ENHA 2QWNA 3D2FB 4CZJA 4O8KA 3QBWA 3A5OC 5AQSA 5EVZA 1CZAN 2P9UA 4BREA 2P9SA 1GLAG 3ULEB 3VENA 4RTFD 4CZMA 4PKGA 2FXUA 2E20A 3CJCA 4O5FA 4FO0A 4JHDA 2W40A 3QFUA 3MDQA 1G99A 1NMDA 4CZHA 4QS7A 3O1BA 2P9KB 2F9WA 2BTFA 2QM1A 3SLCA 4IJNA 4FSVA 2YI1A 3GG4A 3BUZB 1K8KB 3CETA 3WQUA 5KPTA 1X3NA 2Q97A 5JLHA 3GDQA 2QWRA 3HM8A 5JLFA 2Q1NA 3D2FA 2ASPA 3DJCA 2Q36A 3LDQA 4CBWA 3BP8A 4M7XA 2A6AA 3ID8A 4Y0WA 4BR9A 3WUHA 3O6WA 5AZIA 5AQJA 2V7ZA 1Z05A 4WQ4C 3ULEA 2P9IB 3VEYA 2E8AA 1ZBSA 5LJVA 5KQDA 3EN9A 4H0VB 1SAZA 1JCEA 3IDHA 2E2OA 2GTDA 4JN4A 1LOTB 2OANA 2P9KA 4MLEA 4BVPA 5AQVA 4MLHA 4FWLA 2ITMA 2GELA 1K8KA 3CIPA 4CI6A 2I7NA 3MCPA 2IVOA 5LJWA 3SMSA 3ZETB 4EIAA 3C7NA 5AQTA 1MWKA 5BR9A 5FPNA 3U9DA 1ESVA 3EL2A 4JAXA 1U6ZA 1DKGD 1GLDG 1S22A 4K42A 5AQRA 1C0GA 1RFQA 4BC4A 3ATUA 2D0PA 2BUPA 4ISEA 3VGMA 1Y64A 3GL1A 4CZEA 1HKGA 3VEWA 4BQZA 1E4FT 1U2VB 4K41A 1S3XA 1NGJA 5FPMA 1QQMA 2QWPA 4A2BA 3HBTA 1NGEA 4ISGA 4I6MB 2FF6A 3ZETA 1BG3A 3H6EA 4WQ5C 1ATRA 4XEIA 1KAZA 2Q31A 1NGCA 4GY2B 2QWMA 5FPEA 1BA0A 3CQYA 3SK3A 4WQ4A 4BG9A 3JXUA 3P4IA 1KAYA 4PKHA 3QFPA 2NRHA 2NZTA 3H45C 4B1ZA 3ZX2A 2PBDA 4HWIA 2FF3B 1NGAA 5AQWA 5BPLA 3MN6A 4M7YA 4BR0A 3UKRB 4FWPA 4IXCA 3WXLA 3M3ZA 4RCHA 3QMLA 2ASOA 4H5TA 2ZF5O 5BREA 3H3OB 2VYPA 1QZ6A 3SMPA 4M63C 4I6MA 5F0XA 5F2RA 1LCUA 1V4TA 3M6GA 3ZX3A 2E1YA 3H1QA 5AQOA 3EO3A 4BR7A 4FWMA 4RWTA 5EXWA 4BRQA 3VERA 3VOVA 1NWKA 2DPNA 4IZ9A 3BF3A 2YHYA 1QQNA 5KPZA 4IWVA 4DHYA 2A3ZA 2GEMA 2QXLA 4A61A 1HLUA 4NO7A 4DQ8A 1ZXOA 2D0OA 4BRLA 2GUPA 4BGAA 3OHRA 3EZWA 3DAWA 3FLCO 4C23A 1BO5O 3UKRA 5ADXH 2GWJA 3AY9A 3FZKA 3O8MA 3GBTA 1JCFA 2Q0RA 5JICA 3M1FA 3ENOA 3FZMA 1HJOA 4H5WA 2CGKA 3UB5A 1V4SA 2HF4A 1SQKA 4B1YB 1J6ZA 3LDLA 4FL9A 1JCGA 1RGIA 3U4LA 3VF4A 2FSKA 1NGHA 5AQZA 4BRAA 5ADXA 2YCHA 3VF2A 3VPZA 3UE5A 1QHAA 3MN9A 2CGLA 3L6QA 3W0LA 4BVOA 4BR2A 4FWRA 3MMVA 1HX1A 1T6DA 3JS6A 3VETA 2E2QA 3WXIA 3WXKA 4H5VA 3A0IX 3ATVA 3VEOA 4E1JA 1SZ2A 3LM2A 2QW9A 1BU6O 3FE1A 4CBXA 1YUWA 3CQXA 3O5BA 3S41A 4B1VA 2CH6A 2CGJA 4HTLA 1HKCA 1RDWX 4FWOA 5AQQA 2E2NA 3LL3A 4BRFA 3HI0A 3A8YA 3VEZA 4AM7A 4ISFA 1MWMA 2P9IA 3CI5A 5CE3A 3J8AA 4NB4A 3DWLA 1D4XA 4JNEA 3I33A 3VESA 2VWBA 2YHWA 4FPBA 4LC9B 4QS8A 3ZX0A 1TUUA 5AR0A 2IVPA 1Z6RA 1T6CA 1Q18A 4B1UB 3O4WA 3H1VX 2Q0UA 5E84A 2NLXA 3HZ6A 1YAGA 4BC5A 2J4RA 3R8EA 1HUXA 4BRDA 5AQKA 4FWNA 4BRKA 3DXKB 1TYQB 1YXQA 3AAPA 2AP1A 4DCHA 4PL7A 2QWLA 5AQGA 2E2PA 5EOYA 3IFRA 1X9JA 3D2EB 3EKSA 5ELZA 4BROA 3L0QA 4CZGA 4B1XB 3AAQA 3FFKB 3CJAA 4J8FA 2EWSA 3KZBA 3FZLA 4KBOA 2V51B 3F9MA 2YJEA 3ZEUB 1HKBA 4H0TB 4BR5A 3U9ZA 4FWSA 3G25A 4CZFA 4H0OA 5AQNA 4FWQA 4QS9A 1U2VA 2WUSA 3CJ1A 4XH5A 4AM6A 1BOTO 4BRGA 5AQUA 3IMXA 4CZLA 5AQXA 3DXKA 2P9NB 2V52B 3LM9A 4DB3A 1XC3A 2HOEA 2H3GX 4EHTA 3QICA 4PL8A 2A41A 2HMPA 3CJBA 3VGLA 3HTVA 3D2EA 1ATSA 1NGBA 3WXJA 2CH5A 3R9PA 1NGIA 2I7PA 5F1XA 3BEXA 2YJFA 3ZEUA 2Q2RA 4H5RA 3EKUA 1EQYA 4A62A 5BRFA 1R59O 5AZIB 1NBWA 5JMVA 4H0XB 3A5NC 2P9NA 5FPDA 4BC3A 4EHUA 3QDKA 4YDUC 1BWFO 4WQ5A 2D1KA 3GOIA 1C0FA 2P9LB 1BDGA 3KHYA 3KVGA 4H0YB 3VEXA 4B9QA 2PAVA 3UKUB 1KXPA 3WEEB 3MN5A 5AQMA 4H5NA 3A5MC 2FSNA 4CD3A 1NM1A 4FOIA 3VEVA 5EX5A 2ZWHA 2A5XA 3O08A 2ASMA 4BG8A 1ZC6A 4WYBA 3A5LC 1HPMA 3C7NB 1OKJA 2IVNA 5AQYA 5AQLA 3DXMB 1GLJO 4FPAA 5E26A 4CZKA 5LY3A 3LDNA 5I9EB 4IO8A 3MK6A 1DEJA 2HF3A 3I8BA 4GNIA 2FSJA 1WOQA 4XH1A 4B1WB 3W3DA 1E4GT 1XQSC 3WT0A 3FR0A 2P9LA 4FOEA 4BGBA 4CJ7A 4Z94A 1NGDA 1ATNA 5AZJB 3UKUA 2QWQA 3CHWA 1BUPA 3FZHA 1MA9B 3WEEA 1H1VA 1QZ5A 3CJ9A 4BR4A 3O80A 1QQOA 3VF6A 1MDUB 4EFHA 4K43A 2A42A 5BPMA 5B8HA 1KAXA 4PKIA 3D7EO 5AFUH 4BRIA 4BRPA 2YHXA 1TUYA 3B8AX 4XH4A 4F9OA 2V7YA 3DXMA 1DGKN 4JD2B 3QBXA 3SJHA 5AQPA 4EAHD 2A40A 3VGKA 5KQ8A 2VCPA 3RSEB 4BRMA 1T44A 3WQTA 1NLVA 2P9PB 1GLEG 2FLOA 3BF1A 5AFUA 3IUCA 5BN9A 4YDUA 5AQIA 4BRNA 3O1WA 5AZJA 3U8XA 1WUAA 3H3NO 3AARA 3LDPA 2E1ZA 1YVNA 2ZGYA 4BRHA 2AA4A 1P8ZA 3QB0A 5BRDA 1BA1A 2D4WA 3FZFA 4MO5A 4H03B 3CERA 2UYTA 4CD1A 4JD2A 2W41A 3R6MA 3C0BA 1X3MA 2P9UB 3RSEA 4L3QA 4CZIA 2F9TA 2P9SB 3CJ7A 2P9PA 1NGFA 1IG8A 1TYQA 5BPNA 2IIRA 2KHOA 3MN7A 1IJJA 1GLLO 3H46O 1XUPO 2E88A 1GLCG 4JHDB 3HSCA 4CBUA 3TPQA 4BC2A 5KPRA 4H0PA 5BRHA 4FWKA 5TKYA 4BQLA 4BRCA 3TU5A 3GE1A 5EY4A 1NGGA 4A2AA 1GLBG 4K25A 5AQHA 3FGUA 1GLFO 2GWKA
chains in the Genus database with same CATH superfamily
2ZGZA 4Y1DA 2OZSA 2HHIA 4KREA 3HPGA 1ZU3A 1JXEA 3NGIA 3K59A 4CZJA 3T1YK 2Z1GA 2O8CA 1WT7A 5AQSA 5EVZA 4CFDA 4B9NA 3O3FA 4FLVA 4BREA 3ULEB 3ZT1A 1NNEA 5KRSA 2YX6A 1ZYVA 4B9VA 2NRWA 3QEXA 1HMVA 5J2QA 4EP5A 2W40A 1GPSA 4CK1A 3CFRA 3O1BA 1LAVA 4KV8A 2HNZA 3TTDA 4FSVA 3RVCA 4CFBA 2ATQA 3WQUA 1C1BA 4DTUA 3NBPA 5JLHA 1A5XA 4CJEA 4JI7K 4OGCA 4KI4A 2IOCA 1ZUTA 3HM8A 3THVA 1Q9XA 4JRQA 4DSEA 4ELUA 4LD0A 3ALYA 5KGWA 1NJWA 4X64K 4B3SK 5AZIA 2O8EA 1J53A 1HRHA 1IO2A 1VNAA 3VEYA 5CHIA 2AJQA 1SEGA 1VHXA 5LJVA 3EN9A 1QQCA 1SAZA 4C8OA 1JCEA 2E2OA 4JN4A 4MLEA 2OANA 4M3TA 1S6QA 1C1AA 1SV5A 1QVGM 4MLHA 1YI2N 2I7NA 3V9ZA 3VQDA 1XHXA 2IVOA 3VQPA 3K57A 3C7NA 3NGZA 5LMNK 1ESVA 2OTJN 3L4QA 3M5RA 1U6ZA 1WB9A 4HHFA 1GLDG 2YNIA 4IG0A 4CHZA 1J9AA 1SUQA 3TAQA 1JXCA 3TTCA 4CHPA 3EE8A 4FJGA 4J2EA 4JKEA 1SKRA 2BUPA 4ISEA 3SV4A 2A1RA 1KV0A 1U48A 4V1DC 2M8BB 4BQZA 1T3VA 4DSFA 1B9DA 5C42A 5J2NA 1ICAA 4A2BA 1NGEA 4I6MB 4FJ7A 4KHWA 3ZSYA 1BG3A 1U45A 1WSGA 1HNWK 4JKAA 4RW7A 4AHCA 3EE9A 3NDKA 4CQKA 4F3TA 1KCFA 3KKSA 2LN8A 4HWIA 2G8UA 4YOYA 3F73A 2G8KA 5BPLA 3E7UX 3HOSA 4B3RK 4MQ3A 4RCHA 2VG7A 2P5GA 4H5TA 4CFCA 1QZ6A 3MX2A 4OPAA 3DLHA 1E3MA 1VSFA 2ZM6K 3M6GA 1GOBA 3H1QA 4J2AA 1KFSA 2F4VK 4FWMA 2GMOA 4DHYA 1JKHA 3WNEA 4O55A 2QXLA 1WSFA 1HLUA 1ZXOA 3I0RA 2D56A 3HVRA 2EX3A 3C6TA 3OVNA 2HHVA 3EZWA 3NVKA 4E1MA 3UKRA 1Q81O 2E5LK 3AY9A 3O8MA 3GBTA 1A5WA 2DFFA 2JGUA 2IGIA 4CERA 3V4IA 4JI1K 4PQUA 4AHTA 4CFAA 1V4SA 1VSDA 1REVA 4B1YB 5C2FA 1XC9A 3VF4A 4Z4HA 2O8DA 5AQZA 5CY0A 4KPYA 3ZT4A 5M1KA 1QS4A 4CK3A 4C1NI 1C1CA 1IKYA 1QHAA 4DFMA 3THXA 1ITGA 4BR2A 3OYEA 1I6FA 3JS6A 3N4QA 3WXKA 4H5VA 5LL6Z 4Z4IA 2KSKA 4BWJA 4JKDA 4BE0A 4EZ6A 2QA4N 2F8SA 3PSFA 1UOCA 1BIUA 4E1JA 3K9KA 1KLNA 5FRMA 2X6SA 3O5BA 4CJ3A 3SBTA 3CCEN 2B3CA 4M3UA 1IKWA 2CGJA 4FVUA 3V9UA 2XO7A 3VA0A 4CESA 3JYTA 2O8BB 4ISFA 1MWMA 3CI5A 4NXMK 2QEXN 3VESA 4FPBA 2YHWA 3SYZA 4FJKA 1NOYA 2QXFA 3Q7CA 3R1XA 4E7KA 3NCIA 1Z6RA 4KO0A 4CJPA 4I9QA 3CCSN 3P5JA 3B6OA 1HNVA 3CCVN 3DOKA 2QKBA 2J4RA 4OVLA 2E6LA 1NJYA 3TAPA 3E7RL 1NJXA 4FK0A 1TL3A 3DXKB 3QI7A 1OH6A 4KH5A 4PL7A 3O9UA 3DI6A 1RBSA 3EKSA 2BGGA 5ELZA 2JLEA 3PX0A 1NJZA 1WBBA 3L0QA 4Z4CA 4FZZA 3K5MA 4DQIA 2A1SA 3KK3A 3CJAA 2VWJA 4DKWA 3OYJA 4FLTA 3V1RA 1WSHA 1C6VA 1GOAA 1X9WA 1PX9A 5TKWA 3F9MA 2DFEA 3U9ZA 4H0OA 3IKMA 3RMAA 4QS9A 1P00A 3CJ1A 3LANA 1BI4A 1CXUA 1BOTO 1RILA 3O9SA 4DB3A 4NCAA 4DF8A 4CGIA 4GVMA 1ASWA 4ILHA 1VSKA 3QICA 3MCAB 2XRIA 1BQNA 2MN5A 2ZD1A 1YIJN 4H4OA 3WXJA 4I9LA 3AVAA 4H4MA 4WCEL 1YF5L 1RTJA 2I7PA 1I94K 1VQ4N 1HPZA 1VQ6N 5F1XA 3BEXA 1T7PA 4DSJA 3E9PA 1NE5A 4HCCA 3E01A 5GIOA 2Z1HA 1T7AA 4IG3A 3THWB 3AVGA 4IEIA 4X66K 1VSEA 1HYZA 2D0AA 2ATBA 5BRFA 2YEOA 2P9NA 1NK7A 2G2KA 1RBRA 5KK4A 1XNQK 1C0FA 1HNZK 4KHPK 3KVGA 4H0YB 3IG1A 3VEXA 3UKUB 3KLHA 1ILYA 1DQ7A 1I3AA 4CF2A 3WEEB 5AQMA 4H5NA 3K5OA 4Z4EA 1TVRA 2ZE2A 2GV9A 1ZBHA 3ZSRA 3DXMB 3KP0A 1B9FA 4MDBA 2HHHK 1TK8A 3RR8A 1Q82O 3LDNA 1NKBA 3I8BA 2E4LA 4GNIA 3SNNA 1WOQA 3RMDA 3QEPA 4BGBA 2KBHA 3NF6A 3CHWA 1RTIA 1WMTA 3FZHA 4FCYA 3CC2N 1FK9A 4BR4A 1QQOA 4JYAK 1MDUB 3LP2A 3ASMA 1KAXA 1S1XA 3D7EO 3MXJA 4BRPA 2PFUA 2I5JA 1LW0A 4DQPA 4CEOA 2KLAA 3QBXA 3SJHA 4ELTA 1N34K 3OYKA 1VQON 2HBJA 5KQ8A 2VCPA 3J7YP 2IDOA 5HRSA 5M1FA 1M90O 3DRRA 2OPQA 3IUCA 4Z0UA 1NKCA 3WNHA 3O1WA 1MU2A 3L3UA 3HSTB 2B4JA 1RDDA 3LDPA 2ZGYA 4DSLA 1OH8A 3ZT3A 2HSTA 1O1WA 3QB0A 5BRDA 3SUNA 3SQ2A 2YIPA 2Z1IA 3MEDA 2O8CB 1TV6A 1X3MA 4GKJK 3P83D 3LP3A 1Q9YA 3CJ7A 3VA3A 2P9PA 1IG8A 2KFZA 1W97L 4QCLA 4CJUA 4QOZB 4HE7A 1S9GA 1POIA 3MN7A 1XMOK 3H46O 1GLCG 3L2WA 2XY6A 1VQPN 3VN5A 3CYGA 5HOOA 4BC2A 1Q8IA 3QETA 2HNDA 4BRCA 1QTMA 3TU5A 2Y1JA 1SNBA 1W2BM 4K25A 5CZ2A 3NVMA 3OYIA 5HLFA 4CHQA 1WBDA 3SAFA 4O8KA 4U67L 3QBWA 4KB0A 2D0BA 3A5OC 4A5BA 2GBZA 4LF7K 1NG9A 2MZ0A 2O8EB 4GV3A 5JENA 2VGMA 2O4IA 3VENA 4RTFD 1ASVA 3HRGA 1RNHA 3CJCA 1WNSA 3SAGA 3L2RA 3I55N 3LAKA 1UGLA 4QS7A 2F9WA 2BTFA 4OKKA 3C6UA 1VQ5N 3DOLA 2YI1A 5M1PA 3BUZB 2F8TA 1X3NA 2G8IA 2F96A 2QWRA 4XIUA 3O4QA 4MDAA 3D2FA 2ASPA 3DJCA 2Q36A 3CG7A 4O4GA 3VTHA 4CBWA 3CD6N 4M7XA 1RT2A 3ID8A 4Y0WA 5KGXA 4KH4A 3WUHA 2HMIA 4BDPA 2QK9A 3CYMA 1Z05A 4F8RA 3NF8A 2E3FA 2E8AA 4DU1A 1MYNA 4U7BA 5KQDA 3I8DA 4H0VB 3J80O 3EYZA 2IS3A 2O4GA 3CM6A 2P9KA 5AQVA 4FWLA 4FVMA 3TAMA 4FZYA 1K8KA 4DS4A 3K5NA 3M8QA 3BY5A 1NMNA 1IKVA 5DMRA 5LJWA 3SMSA 4EIAA 1MWKA 2NRZA 2KTQA 1VSIA 4ICLA 4JAXA 4CJ4A 3CFOA 4AB0A 2JWLA 1C0GA 1Y97A 3NHGA 4CGGA 3CMAN 1T03A 1TKTA 5C24A 3IAYA 2RKIA 2X6NA 1LW2A 1LQIA 2OZMA 3ATUA 1MR4A 1Y64A 3GL1A 4DV4K 3E9LA 4CZEA 3CPEA 3VEWA 4IOXA 2RHKA 4K41A 2RN2A 1S3XA 3G0ZA 4E19A 5FPMA 3AO1A 3HL8A 1QQMA 1NRAA 2WC9A 4PHTX 5MLCQ 4J2BA 1BHLA 2QKKA 3AVHA 3NMUA 3RRHA 5CR4A 4DR5K 1KAZA 2JDQD 1NGCA 1X9MA 3SUPA 1BA0A 3CQYA 3MXIA 3ZT0A 4WQ4A 2VGNA 2N2QA 3JXUA 4CEDA 3V1OA 4X65K 3H45C 2KYQA 2PBDA 2XHBA 1VRUA 4C8MA 4FJ5A 2FF3B 3F9KA 3V1QA 3UKRB 4FWPA 1A5VA 1ZYQA 2B68A 2OA8A 4M3ZA 5F0XA 1NU0A 5F2RA 1LCUA 3NH2A 3ZX3A 3EO3A 3L2QA 4RWTA 4CIFA 3WXMB 4IFVA 2O8DB 3VOVA 4DU3A 3KP1A 2YHYA 1QQNA 4DUYK 4NCGA 1TKXA 3THXB 4UADE 4NO7A 4LF8K 4BRLA 3G71N 2GUPA 1J54A 4B8AB 4JI5K 1KSPA 3FLCO 1VQ9N 5ADXH 3I56N 2DY4A 1JCFA 2Q0RA 1NK5A 1BRZA 4DV1K 3HO1A 1N4NA 3HYFA 3GKUA 4BE7B 1KQSM 3SQ0A 1J6ZA 4E0DA 4FL9A 3U4LA 4LF4K 4BRAA 3KOYA 3L6QA 1UWBA 4BVOA 2YILA 1SS6A 1VSJA 3K5LA 1EO1A 4DTOA 3AO5A 4WF9L 2D0CA 4RW9A 3ATVA 3OYFA 3L8BA 1O13A 3ZCMA 3KC6A 4CGDA 3ID6A 2PYJA 3KTQA 1EP4A 3LM2A 2QW9A 1BU6O 4HUEA 1F21A 4WE1A 4AF1A 4CBXA 1YUWA 4N5SA 3CQXA 5DK5A 4QAGA 4B1VA 4HTLA 1HKCA 1RDWX 3LL3A 4B3OA 3SBGA 4DR1K 3VEZA 3OYCA 4AM7A 4NB4A 2VQEK 1D4XA 4DR6K 2VWBA 4LC9B 4A57A 5FROA 4IFEA 2E3GA 4R5PA 3FFIA 3OYAA 1YJNN 2PZSA 2IVPA 1Q18A 4B1UB 4N41A 1I39A 2FBXA 3AVFA 4KH6A 4C8KA 1RBUA 1IV0A 3HXMA 3HZ6A 4F4KA 1RDCA 4E89A 3R8EA 1NK8A 4JKFA 1BI4B 5IT9O 1HUXA 4BRDA 5AQKA 4FJ9A 4MFBA 1K73O 4CJRA 1BMRA 3AAPA 3OBYA 4JK9A 3TSUA 5EOYA 4JS4A 4M41A 4IFYA 4B9MA 1JZAA 3DRSA 4AH9A 4DU4A 3BK3C 1RTDA 4CCHA 3E66A 2EWSA 4KBOA 3PO4A 2KZMA 2V51B 3K58A 4DTRA 4W5RA 4FWSA 3ZYYX 4CZFA 1QSLA 4AAZA 5CY4A 4AHSA 2HBLA 5AQUA 3IS9A 4CZLA 5I42A 5AQXA 2HNYA 2P9NB 3CM5A 3LM9A 1XC3A 2HOEA 1JL2A 4JI3K 3HP6A 4BACA 4R79A 3P1GA 1BL3A 2NNWA 3DLKA 2P1JA 2HVIA 4PA1A 3ZEUA 2GL1A 3MXMA 4H5RA 1OMYA 4AQYK 3AVNA 3EKUA 2UU9K 3CCLN 4DR3K 4B8CA 4A62A 3NF7A 4N56A 1NBWA 3KLEA 4H0XB 3A5NC 3KOWA 4EHUA 4LSNA 4YOWA 1TL1A 1S6PA 2YBRC 1BWFO 3GOIA 3PSMA 3G4SN 3S5TA 4EP4A 4CIGA 1NRBA 4DV2K 3T69A 4B9QA 3LDSA 1S1VA 5J1EA 3AA4A 1L3UA 3AO2A 4CEAA 4CD3A 1NM1A 2YIOA 3VEVA 2ZWHA 4ZTJA 2FBTA 4KHUA 3O08A 4DLGA 2ASMA 4OO1J 2ETJA 5FDLA 2LT8A 1GOCA 2IVNA 3MEEA 4FPAA 5E26A 5GAEP 4CJKA 4IO8A 3MK6A 1HJRA 3ZSVA 4OPHA 2OCEA 4B1WB 1E4GT 3L2VA 4KRFA 1C0MA 1UA0A 2P9LA 2Q3SA 1NGDA 4IDHA 1ATNA 4YNQA 2QWQA 1BUPA 1T1TA 3C94A 5GAHP 3SZ2A 2HHXA 5BPMA 4CW7B 1NK0A 5AFUH 1UA1A 3LPUA 3TAEA 3VQEA 2ITGA 2V7YA 1HQEA 3AO3A 3ENBA 1HYSA 5AQPA 1W9HA 2FBYA 3O4NA 3WQTA 2P9PB 2XY5A 2VQFK 1HQUA 3VTIA 2FLOA 3BF1A 4OX9K 4YOUA 4DSIA 3KLFA 5BN9A 1W0HA 3MX5A 3ZSQA 3CCMN 4BRNA 1D9FA 1D5AA 2G8WA 3R2VA 4IDKA 3DLRA 3H3NO 3AARA 4J2DA 2E1ZA 1VQNN 4CJVA 1KTQA 3B6PA 3CW4A 4DR7K 4DV5K 1P8ZA 1YITN 1BA1A 2ZQBA 4H03B 3NE6A 3CERA 4O44A 2BE2A 4JRPA 3QEWA 4CD1A 1U47A 3R6MA 2OYQA 1SL2A 4DV7K 1XNRK 3C6HA 1W7AA 1NGFA 3TWHA 4BDZA 1SN1A 4DLEA 2KHOA 1IJJA 3J7ZO 3RR7A 3LALA 4Q0BA 1IH7A 1XHZA 1WSIA 5EY4A 1AYJA 2GX9A 1GLBG 2KGQA 4E1NA 1GLFO 3MWPA 3L4IA 3CQ8A 1VQMN 4MO4A 2QWOA 3D2FB 2P9UA 1NK6A 1IBKK 1LWEA 2P9SA 2LSNA 1SKSA 2E20A 2Y1IA 3TR8A 3R3LA 3AVCA 4JHDA 3QFUA 4CEFA 3MDQA 1NMDA 1NK9A 1QVFM 4CZHA 2P9KB 2LY6A 4NXNK 3SLCA 4IJNA 2RE2A 3GG4A 1K8KB 3CETA 4JI2K 4DTSA 1NJIO 4CEQA 4KHNA 2Q97A 3OTOK 3GDQA 4JKGA 5H1SQ 5DM6L 2Q1NA 4ELVA 3SJJA 1JL1A 2VG5A 3CC4N 1PE4A 4FLYA 3BP8A 4KB1A 2ASCA 4AHVA 2EHGA 3G10A 2PY5A 2HHWA 4WQ4C 2V7ZA 1WLJA 2E0HA 2P9IB 3OYDA 3OW2M 3RRGA 1C0UA 5JVGL 3OYMA 3QERA 1SL1A 1NKEA 3OJUA 4B9UA 3IDHA 4LH5A 2GTDA 4BVPA 3I0SA 4WFAL 3TARA 2ITMA 2GELA 3HVTA 1ASUA 2FC0A 5K14A 3VQCA 3MCPA 4DFPA 1TKDA 1VQ8N 2NY9X 5AQTA 4EZ9A 1YJWN 5FPNA 4WFNL 3VQ8A 3U9DA 1LWCA 1YTAA 4K8XA 5J2PA 1DKGD 3KK1A 1YTUA 3MAQA 4NYFA 5JS1A 3TAFA 3KJVA 1RFQA 3ISNC 3DLLL 4OJRA 4H8KA 2N2RA 2E2FA 3J81O 1IKXA 3HP9A 3SQ4A 1CXQA 1RT1A 4HTUA 3VGMA 1LQQA 4GW6A 1HKGA 3ZSOA 3T1HK 4G9ZA 1U2VB 1NGJA 4HHTA 3CC7N 2QWPA 4ISGA 3ZETA 2RF2A 3DYAA 4O5BA 2VG6A 3H6EA 4DR4K 1ATRA 2QWMA 4KI6A 1TKZA 2UXCK 5FPEA 3V9SA 1HYVA 4DV6K 3SK3A 4BWMA 4BG9A 3AVMA 4ILJA 5HROA 4AEIA 3ITHA 4PKHA 4CHYA 4AILC 3QFPA 2NZTA 3NGYA 4B1ZA 4KYPA 5J2MA 3RMCA 3KOZA 3LWLA 2LI7A 4M7YA 2OPRA 4BR0A 3SUOA 4IXCA 3M3ZA 4HCBA 3L3VA 2ZF5O 3H3OB 2VYPA 4JKBA 4M63C 2KJAA 4FW2A 3O3GA 3DLGA 2HW3A 1V4TA 2VY6A 2E1YA 4CECA 5EXWA 3VERA 4A5AA 3BGRA 2KBJA 3BF3A 2YNGA 5KPZA 3CPWM 4IWVA 1EWQA 2GEMA 2HBMA 4KKOA 4BGAA 4FLXA 3QNOA 4F2RA 4V19S 4C23A 2XY8A 2G8VA 2GWJA 3FZKA 1UAXA 5JICA 3M1FA 4E7IA 1K8AO 1T8EA 3FZMA 3PV8A 1HJOA 5HL7L 3S3MA 2CGKA 1JLQA 2W00A 3UB5A 1DT9A 4JI8K 2HF4A 3KD1E 4IOCL 4K8ZA 1JCGA 3KOXA 1VK0A 2FSKA 4HVJA 3RWUA 4AHUA 5ADXA 3T7ZA 1J5EK 1VQLN 3UE5A 4LFCK 2NY8X 3W0LA 1FJGK 3OS1A 3CCRN 1I6GA 3WXIA 3S3OA 3SAHA 3A0IX 4DV3K 3ZSZA 4B3MK 3VEOA 3OYHA 4JS5A 1SZ2A 2YHAA 2DFHA 5CZ1A 3U3GA 4K0KK 4RW4A 3S41A 2CH6A 3J7AP 2ZJRL 1SL0A 2E2NA 3A8YA 3LP1A 1B3CA 3VQ5A 4WFBL 1FKPA 2P9IA 2R7YA 1XMQK 1OH5A 4F2SA 1N6QA 4QS8A 3ZX0A 5IWAK 3C95A 3QLHA 4DS5A 1TUUA 5AR0A 1T6CA 3O4WA 5CYQA 3CCUN 1JLAA 2Q0UA 4M3YA 2LJ7A 2SN3A 5E84A 2NRRA 4M42A 2NLXA 1CLQA 2F7TA 2K35A 4RW8A 1YT3A 4B9LA 1VSMA 4DV0K 1JLGA 2C1GA 1RT5A 1KC8O 1TYQB 1YXQA 3TSQA 2QWLA 1NOZA 3O9RA 5AQGA 2E2PA 4FXDA 4JI0K 3THYA 4FZXC 4BROA 4BEBA 4CZGA 1BCGA 1BISA 3NH1A 3FFKB 4J8FA 4BY9C 4XJXA 4UAFE 3HPOA 4A59A 3ZEUB 1HKBA 4BR5A 4M3RA 1KVAA 1CHZA 2FBVA 2W6KA 4FWQA 2UUAK 1U2VA 4XH5A 3PY8A 4JKHA 1RDBA 5A2QO 2QTDA 4AM6A 1BCMA 4GMJB 3VQBA 5C15A 3C65A 3T3FA 3DM2A 4L8RB 2H3GX 4EHTA 1L4VA 4PL8A 2HMPA 4YOVA 3CJBA 1RT4A 3HTVA 4Z4FA 3D2EA 2Z1JA 4GV9A 1NGBA 3JAMO 2CH5A 3QIPA 4KTWA 3R9PA 1JLFA 4BE2A 3PIOL 3TANA 1VQKN 3QEIA 1JLEA 2VWKA 4FYDA 3ZSXA 1OH7A 1JXBA 2YJFA 2ZJQL 3D6RA 4E3SA 1NK4A 3AVKA 1VQ7N 1EQYA 3SUQA 4CF1A 1R59O 1VAZA 3OY9A 3M8PA 5FPDA 4BC3A 3TAGA 2KW4A 2P9LB 4DG1A 1BDGA 2YKMA 2OPSA 3SPZA 3QIOA 1RCHA 4DSKA 3S3NA 3KLGA 4DFKA 4CHNA 3DMJA 3A5MC 2FSNA 4JK7A 4LFBK 4FOIA 1JLCA 2X74A 1DJTA 1JLBA 2QI2A 3G6EN 4DR2K 1LQHA 4M3WA 3A5LC 3KLIA 4LF5K 3VQ9A 1DTQA 1OKJA 2O8FB 5AQLA 4CZKA 5DM7L 1L3VA 4LF6K 5D3GA 1U4BA 2W42A 1DEJA 3LAMA 2BRZA 2FSJA 2KPYA 3TABA 5JVHL 5M1QA 4Z94A 1LV5A 2UUCK 4Z4GA 4CF0A 1QE1A 4ID1A 4FJNA 2NRXA 1KLMA 3F2KA 3KK2A 1QZ5A 3VF6A 3LZJA 2KKZA 1ZBFA 4EFHA 4LFAK 4K43A 2A42A 3OS0A 4PKIA 4BRIA 4DFJA 2C1IA 2YHXA 4IOAL 4CEZA 1JJ2M 2I61A 4XH4A 3LWMA 2HB5A 4F9OA 1SKWA 1DGKN 3AV9A 1CZ9A 3HT3A 1RT6A 2A40A 2W6LA 1P90A 4CJ5A 1G15A 1T44A 2N69A 5M1NA 3ZLJA 4FJHA 1GLEG 3KK7A 2WOMA 4OKJA 5AFUA 4NLCA 3EY1A 4YDUA 5AQIA 4YOTA 4O0IA 4NYNA 5AZJA 1S1TA 1TI5A 1WUAA 1TK0A 2A7TA 3O9TA 3SV3A 1YVNA 1OZZA 4TSXA 5HP1A 3UIQA 2WONA 1WSEA 3FZFA 2D4WA 4MO5A 4C8LA 2UYTA 1X9SA 3HK2A 4JD2A 2W41A 1FKOA 3C0BA 4O0JA 2P9UB 5LMUK 4CHOA 3RSEA 4CZIA 3CF5L 2F9TA 2P9SB 3D0PA 1EKEA 4Y1CA 1TYQA 5BPNA 3RTVA 1YJ9N 1GLLO 2E88A 4CBUA 4JHDB 3VQ6A 1VSHA 4GKKK 1N5YA 5KPRA 5BRHA 1DTTA 4KHSA 4FWKA 3NAEA 3GE1A 5AQHA 1B92A 4LF9K 2GWKA 4UJ0A 3LDOA 5BN8A 4JKGB 2UXDK 4IJAA 5AQFA 3ENHA 5C2DA 2QWNA 1TGOA 4DTMA 1IG9A 4BE1A 4KTQA 1RBTA 2RPIA 5T7BA 1ZFUA 1CZAN 1GLAG 3AGRA 4CZMA 4PKGA 2FXUA 3K0SA 4O5FA 4FO0A 1G99A 4UAEF 3LZIA 2QM1A 5EU7A 2B5JA 4FJ8A 3QEVA 1L3TA 2KZZA 1OVQA 4LSLA 5KPTA 4UQGA 2P5OA 1ZBLA 1GPTA 3IRXA 3WNGA 5JLFA 1S5JA 4CGHA 4NLBA 3LDQA 4DQSA 1CN2A 2N66A 4CK2A 3OS2A 2A6AA 1WN7A 4BR9A 1U49A 1T7BA 3O6WA 1WWNA 1LWFA 1HR0K 3E9OA 4CJSA 5AQJA 3ULEA 5GADP 4FJIA 3DLEA 4JEPA 2NUBA 1ZBSA 1BQMA 3H08A 2BH1A 1R0AA 3CCJN 1LOTB 3KWGA 4FJMA 3CIPA 4CI6A 1D9DA 1RT3A 2WTUA 3SQ1A 3F5TA 3QESA 3ZETB 3PO5A 4UY8O 1KFDA 4IO9L 5BR9A 2O8FA 2G8HA 2LY5A 3EL2A 4CE9A 1S22A 4K42A 4I2PA 4FJJA 5AQRA 1EXQA 2OTLN 1N32K 4BC4A 3SPYA 2KBKA 4JKCA 2UXBK 4CEBA 4YHHK 2D0PA 1B7DA 1C56A 2HHUA 1ZVEA 2NRVA 1E4FT 2P51A 4LY7A 2BANA 3HBTA 3ZSWA 2FF6A 4FM1A 4E72A 4WQ5C 4XEIA 2Q31A 1K9MO 1VRTA 4GY2B 3V81A 1I2VA 1BK8A 4B3TK 3AVLA 5I3UA 3OBWA 3P4IA 1KAYA 2NRHA 3VQ7A 3ZX2A 3V6DA 3CXCM 4GVEA 5SWMA 3PUFA 1NGAA 5AQWA 3MN6A 3NH0A 3P31A 1RDUA 3E1YA 3WXLA 3QMLA 2ASOA 4LH4A 4OGEA 5BREA 1AHOA 3SMPA 4I6MA 1RT7A 5AQOA 1QSYA 4BR7A 1YHQN 4PUOA 1T7EA 3AGKA 5C25A 4BRQA 2WFBA 3M8SA 1NWKA 2DPNA 5JS2A 1Q86O 4IZ9A 3T1AA 4JV5K 3SI6A 1KD1O 2A3ZA 4PY5A 2IAJA 4A61A 1WAFA 3CFPA 4CF9A 4DQ8A 2D0OA 4CJWA 1ZYWA 1QSSA 3OHRA 3ZT2A 2NRTA 3DAWA 4W5TA 3EEQA 4CGJA 1BO5O 3NFAA 1ZVGA 2HHQA 3ULDA 4JI4K 4KTZA 1OVYA 4W5OA 3T19A 1XRSB 3U3YA 3ENOA 2YHBA 4DTJA 4H5WA 5CYMA 2DTUA 5HRNA 4OPJA 3HPHA 1PTXA 3KHWA 1SQKA 4ID5A 4HUGA 3MWTA 4FLWA 3LDLA 1TK5A 5SZTA 1RGIA 4FM0A 4B08A 3RMBA 1NGHA 1EWRA 5KI6A 2YCHA 3DLBA 3VF2A 3VPZA 5GIPA 5FRNA 3MN9A 2CGLA 4I7FA 2XY7A 4FWRA 3MMVA 1HX1A 1T6DA 3VETA 4CEEA 1M1KO 4FK4A 2E2QA 5M1OA 4YY3K 4E7JA 4FJLA 3EZ5A 4CJQA 5KTQA 2D5RA 2MBKA 1S9EA 4DTNA 4W5NA 4C8NA 3FE1A 4CGFA 3JSMA 2LKBA 3VQAA 1FW6A 1CZBA 2KQ2A 4G1QA 4FWOA 3PSIA 5AQQA 4DTPA 4BRFA 1L3SA 1XWLA 3HI0A 1S1UA 3D45A 4KFBA 3THYB 5CE3A 3J8AA 1BIZA 3DWLA 2X78A 3Q7BA 4JNEA 3I33A 1KVBA 2WBNA 5FLXO 4M45A 3H1VX 5AJ3K 1VSLA 3A2FA 4DTXA 1TAQA 1YAGA 4BC5A 4HUFA 3PX4A 4FWNA 4BRKA 4X62K 1FH3A 1C55A 3QNNA 3VQ4A 5C10A 2AP1A 4DCHA 3CCQN 1J5OA 2G8FA 3OYLA 2HBKA 4BECA 3IFRA 1X9JA 3D2EB 4B9TA 2O8BA 2E6MA 5C0YA 4B1XB 3AAQA 4FJXA 3VQQA 1KVCA 5E41A 4DQRA 3V9XA 3KZBA 1RBVA 3FZLA 1T0ZA 2YJEA 4JK8A 4RW6A 3AVBA 3AA3A 3HOTA 4H0TB 3U6FA 3G25A 1IBMK 1QHTA 1HNXK 5AQNA 2WUSA 4NCBA 4RG8A 1VNBA 4BRGA 3IMXA 1WAJA 3QINA 3DXKA 2V52B 2OPPA 3P38A 4N76A 2HHTA 2GUIA 1KRPA 3QO9A 3KKRA 2A41A 4E7HA 3HJFA 1Z25A 1DLOA 1WSJA 3LPTA 4E7LA 3VGLA 2HVHA 3P39A 4OLBA 4YFUA 3PLAA 3KIOA 4CVNE 1ATSA 1RTHA 1S72N 4KHYA 1NGIA 4GV6A 4C1NK 3SCXA 4CF8A 2Q2RA 3C6AA 4ILGB 3TTFA 1D8YA 3S9HA 4FW1A 3OJSA 5AZIB 3TI0A 4Q5VA 3PX6A 5JMVA 4OLAA 4IBNA 3QDKA 1K6YA 4YDUC 2YKNA 4WQ5A 2D1KA 4CIEA 5HRRA 3HM9A 4DQQA 3KHYA 3BZKA 4CJLA 2KFNA 4O8UA 2PAVA 4FM2A 1KXPA 3BZCA 1TAUA 4IEEA 3OYNA 2IC3A 5BR8K 3MN5A 3K9JA 3BDPA 5EX5A 3AVJA 2A5XA 3TSPA 4BG8A 1ZC6A 4WYBA 1HPMA 3C7NB 4AHRA 4YOXA 3THWA 1Q7YO 2ZJPL 5AQYA 1BGXT 1GLJO 5LY3A 3PIPL 1N8RO 5I9EB 1N33K 2HF3A 3L2UA 1P0AA 5GINA 3CMEN 1ZBIA 4JI6K 1NH5A 4XH1A 3W3DA 5KRTA 4N47A 1XQSC 3AA5X 1JZBA 4IKFA 3WT0A 3FR0A 1LAWA 4FOEA 4CJ7A 3KD5E 2HHSA 4DMNA 3LP0A 5AZJB 3UKUA 4KAZA 4KHQA 1MA9B 1U04A 1I2UA 2B6AA 3WEEA 1H1VA 3CJ9A 5GAGP 2YNFA 3O80A 3OYBA 2BDPA 3AVIA 3V9WA 5B8HA 4OPKA 4YORA 1BCOA 4ZHRA 1TUYA 3AO4A 4F3OA 3B8AX 3DXMA 3L56A 4JD2B 1S1WA 4EAHD 1ZBUA 3O3HA 4PWDA 3VGKA 3RSEB 1Z26A 4BRMA 2UUBK 3VMFB 1XI1A 1NLVA 1NPIA 4CJFA 4DUZK 1K8BA 1N36K 3NF9A 4FK2A 3M8RA 4W5QA 3U8XA 3WNFA 4ZTFA 2YC1C 4BRHA 3K2PA 2AA4A 4DWIA 3MEGA 3OA9A 3SF4D 4CJTA 3KWIA 1RDAA 1FXXA 1JKZA 2JWKA 4OKEA 1YVUA 5C12A 1IBLK 1EX4A 4M3XA 1EETA 3N4PA 4L3QA 3O9QA 4I2QA 1T05A 1SN4A 4DF4A 4JLHA 4FLUA 4B9SA 2YV0X 3DRPA 3OYGA 2LR3A 2IIRA 5HBMA 1L5UA 3AA2A 1XUPO 5HRPA 2LJMA 3HSCA 3TPQA 3MECA 1C0TA 4BDYA 4H0PA 2YNHA 1HNIA 4FLZA 5TKYA 4BQLA 2PYLA 1NGGA 4A2AA 1X1PA 3FGUA
chains in the Genus database with same CATH topology
3L4IA 3LDOA 5BN8A 2ZGZA 4JKGB 4IJAA 1VQMN 4MO4A 5AQFA 2QWOA 3ENHA 2QWNA 5C2DA 3D2FB 3SAFA 4CZJA 4O8KA 4U67L 3QBWA 3A5OC 4A5BA 5AQSA 5EVZA 1CZAN 2P9UA 4GV3A 4BREA 2P9SA 1GLAG 2VGMA 3ULEB 3VENA 3AGRA 4RTFD 4CZMA 4PKGA 2FXUA 3HRGA 2E20A 2YX6A 3CJCA 2NRWA 3R3LA 4O5FA 4FO0A 3SAGA 4JHDA 2W40A 3QFUA 3MDQA 1G99A 1NMDA 3I55N 4UAEF 1QVFM 4CZHA 4QS7A 3O1BA 2P9KB 2F9WA 2BTFA 2QM1A 3SLCA 4IJNA 4FSVA 3RVCA 3TTDA 2RE2A 2YI1A 1VQ5N 3GG4A 3BUZB 1K8KB 3CETA 5M1PA 1NJIO 3WQUA 5KPTA 1X3NA 2Q97A 5JLHA 3GDQA 4JKGA 2QWRA 5H1SQ 3HM8A 5JLFA 5DM6L 2Q1NA 4MDAA 3D2FA 2ASPA 3DJCA 2Q36A 3CC4N 4NLBA 3VTHA 3LDQA 4CBWA 3CD6N 3BP8A 4M7XA 2A6AA 3ID8A 4Y0WA 4KH4A 4BR9A 3WUHA 3O6WA 5AZIA 3E9OA 5AQJA 2V7ZA 1Z05A 4WQ4C 3ULEA 2P9IB 5GADP 3OW2M 3VEYA 5CHIA 4JEPA 2E8AA 4U7BA 1ZBSA 5LJVA 5JVGL 5KQDA 3EN9A 4H0VB 1SAZA 1JCEA 3IDHA 2BH1A 2E2OA 2GTDA 4JN4A 1LOTB 2OANA 2P9KA 3KWGA 4MLEA 4BVPA 3CCJN 4WFAL 1QVGM 5AQVA 4MLHA 4FWLA 2ITMA 2GELA 1K8KA 1YI2N 3CIPA 4CI6A 2I7NA 3MCPA 2IVOA 3F5TA 1VQ8N 5LJWA 3SMSA 3ZETB 4EIAA 3C7NA 5AQTA 1MWKA 2NRZA 4UY8O 4IO9L 1YJWN 5BR9A 5FPNA 4WFNL 3U9DA 1ESVA 3EL2A 4JAXA 2OTJN 3L4QA 3M5RA 1U6ZA 1DKGD 1GLDG 1S22A 4K42A 5AQRA 2JWLA 1C0GA 1RFQA 3DLLL 3TTCA 2OTLN 3EE8A 3CMAN 4BC4A 2E2FA 4JKCA 4JKEA 3ATUA 2D0PA 2BUPA 4ISEA 3VGMA 1Y64A 3GL1A 3E9LA 1HKGA 3CPEA 4CZEA 3VEWA 4IOXA 2NRVA 4BQZA 2RHKA 1E4FT 1T3VA 1U2VB 4K41A 4G9ZA 1S3XA 1NGJA 5FPMA 3CC7N 1QQMA 2QWPA 4A2BA 3HBTA 1NGEA 2WC9A 4ISGA 4PHTX 4I6MB 2FF6A 5MLCQ 3ZETA 3NMUA 1BG3A 5CR4A 3H6EA 4WQ5C 1ATRA 4XEIA 1KAZA 2Q31A 1K9MO 2JDQD 1NGCA 4GY2B 2QWMA 5FPEA 1BA0A 3CQYA 3SK3A 4WQ4A 4BG9A 2VGNA 4JKAA 3OBWA 3EE9A 4ILJA 3JXUA 3P4IA 1KAYA 4PKHA 3QFPA 2NRHA 2NZTA 3H45C 4B1ZA 3ZX2A 2LN8A 2PBDA 4HWIA 4YOYA 3CXCM 4GVEA 2FF3B 1NGAA 5AQWA 5BPLA 3MN6A 4M7YA 3P31A 4BR0A 3UKRB 1RDUA 4FWPA 4IXCA 3HOSA 3E1YA 3M3ZA 4RCHA 3WXLA 3QMLA 2ASOA 4H5TA 2ZF5O 5BREA 3H3OB 2VYPA 1QZ6A 3MX2A 4JKBA 4M63C 3SMPA 4I6MA 4OPAA 5F0XA 5F2RA 1LCUA 2VY6A 1V4TA 3M6GA 3ZX3A 2E1YA 3H1QA 5AQOA 3EO3A 4BR7A 1YHQN 3AGKA 4FWMA 4RWTA 5EXWA 3WXMB 2WFBA 4BRQA 3VERA 4A5AA 3VOVA 1NWKA 2DPNA 2GMOA 1Q86O 4IZ9A 3BF3A 2YHYA 1QQNA 5KPZA 3CPWM 4IWVA 1KD1O 4DHYA 2A3ZA 2GEMA 2QXLA 4A61A 1HLUA 4UADE 4NO7A 4DQ8A 1ZXOA 2D0OA 2HBMA 4BRLA 2D56A 3G71N 2GUPA 4BGAA 3OHRA 3EZWA 3NVKA 2NRTA 3DAWA 3FLCO 4C23A 1VQ9N 1BO5O 3UKRA 5ADXH 1Q81O 3I56N 2GWJA 3AY9A 3FZKA 3O8MA 1OVYA 3GBTA 1JCFA 2Q0RA 5JICA 3M1FA 1K8AO 3ENOA 3FZMA 1HJOA 5HL7L 4H5WA 2CGKA 4BE7B 2W00A 3UB5A 1DT9A 1V4SA 1KQSM 3KHWA 1SQKA 2HF4A 4B1YB 5C2FA 3MWTA 1J6ZA 3LDLA 4IOCL 4FL9A 1JCGA 1RGIA 3U4LA 3VF4A 2FSKA 1NGHA 5AQZA 4BRAA 5ADXA 2YCHA 5M1KA 3T7ZA 4C1NI 3VF2A 3VPZA 1VQLN 5GIPA 3UE5A 1QHAA 3MN9A 2CGLA 3L6QA 3W0LA 4BVOA 2YILA 1SS6A 4BR2A 3MWPA 4FWRA 3MMVA 1HX1A 1T6DA 3JS6A 3VETA 3CCRN 1M1KO 2E2QA 1EO1A 3N4QA 5M1OA 3WXIA 4H5VA 3WXKA 4WF9L 3SAHA 3A0IX 3ATVA 1O13A 3KC6A 4JKDA 2MBKA 2QA4N 3ID6A 3VEOA 4E1JA 3K9KA 1SZ2A 3LM2A 2QW9A 1BU6O 3FE1A 4AF1A 4CBXA 1YUWA 3CQXA 3O5BA 3S41A 4B1VA 2CH6A 3SBTA 3CCEN 2CGJA 4FVUA 4HTLA 2ZJRL 1HKCA 1RDWX 4FWOA 5AQQA 2E2NA 3LL3A 4BRFA 3SBGA 3HI0A 3A8YA 3VEZA 4WFBL 4AM7A 4ISFA 1MWMA 2P9IA 3CI5A 5CE3A 3J8AA 4NB4A 3DWLA 1D4XA 3Q7BA 4JNEA 2QEXN 3I33A 3VESA 2VWBA 2YHWA 4FPBA 4LC9B 4QS8A 3ZX0A 2WBNA 4A57A 3Q7CA 3R1XA 4IFEA 1YJNN 1TUUA 5AR0A 2IVPA 1Z6RA 1T6CA 1Q18A 4B1UB 3O4WA 3H1VX 4KH6A 3CCUN 2Q0UA 3CCSN 5E84A 2NRRA 3CCVN 2NLXA 3HZ6A 2F7TA 2K35A 1YAGA 4BC5A 2J4RA 3R8EA 4JKFA 1HUXA 4BRDA 5AQKA 2C1GA 4FWNA 4BRKA 1K73O 3DXKB 1KC8O 1TYQB 1YXQA 3AAPA 3QI7A 3TSQA 3OBYA 4JK9A 5C10A 2AP1A 4KH5A 4DCHA 4PL7A 2QWLA 3O9RA 5AQGA 3TSUA 3O9UA 2E2PA 3CCQN 2HBKA 5EOYA 3IFRA 1X9JA 3D2EB 3EKSA 4BECA 5ELZA 4BROA 4BEBA 3BK3C 3L0QA 5C0YA 4CZGA 4B1XB 3AAQA 3FFKB 3CJAA 4J8FA 3E66A 4DKWA 2EWSA 4BY9C 3KZBA 3FZLA 4XJXA 4KBOA 5TKWA 2V51B 4UAFE 3F9MA 2YJEA 4JK8A 4A59A 3ZEUB 3HOTA 1HKBA 4H0TB 4BR5A 3U9ZA 4FWSA 3G25A 3ZYYX 4H0OA 4CZFA 3IKMA 5AQNA 4FWQA 4QS9A 1U2VA 2WUSA 3CJ1A 4XH5A 4JKHA 2QTDA 2HBLA 1BOTO 4AM6A 4BRGA 5AQUA 3IMXA 4CZLA 5AQXA 5C15A 3DXKA 2P9NB 2V52B 3LM9A 3O9SA 1XC3A 4DB3A 3C65A 2HOEA 3P38A 4ILHA 2H3GX 4EHTA 3QICA 4PL8A 2A41A 2HMPA 4YOVA 3CJBA 3VGLA 3MCAB 4R79A 3P39A 3HTVA 3PLAA 3D2EA 4GV9A 2MN5A 1YIJN 1ATSA 1NGBA 2NNWA 3WXJA 2CH5A 3R9PA 1S72N 4WCEL 1NGIA 1YF5L 2I7PA 1VQ4N 3PIOL 1VQKN 1VQ6N 5F1XA 3BEXA 4GV6A 3E9PA 2YJFA 2ZJQL 3ZEUA 4C1NK 5GIOA 2Q2RA 3D6RA 4H5RA 3C6AA 3EKUA 4ILGB 4IEIA 3TTFA 1VQ7N 1EQYA 3CCLN 4A62A 5BRFA 1R59O 5AZIB 1VAZA 1NBWA 5JMVA 4H0XB 3A5NC 2P9NA 5FPDA 4BC3A 4EHUA 3QDKA 4YOWA 4YDUC 1BWFO 4WQ5A 2D1KA 3GOIA 3G4SN 1C0FA 2P9LB 1BDGA 3KHYA 3KVGA 4H0YB 3T69A 3VEXA 4B9QA 4O8UA 2PAVA 3UKUB 1ILYA 1KXPA 4IEEA 3WEEB 3MN5A 5AQMA 4H5NA 3A5MC 3K9JA 2FSNA 4JK7A 4CD3A 1NM1A 4FOIA 2YIOA 3VEVA 5EX5A 2ZWHA 2QI2A 3G6EN 2A5XA 3O08A 2ASMA 3TSPA 1ZC6A 4BG8A 4WYBA 3A5LC 4OO1J 1HPMA 3C7NB 4YOXA 1OKJA 1Q7YO 2IVNA 2ZJPL 5AQYA 5AQLA 3DXMB 4MDBA 1GLJO 4FPAA 5E26A 4CZKA 5DM7L 5GAEP 1Q82O 5LY3A 3LDNA 3PIPL 1N8RO 5I9EB 4IO8A 3MK6A 1DEJA 2HF3A 3I8BA 4GNIA 5GINA 2FSJA 4OPHA 3CMEN 1WOQA 4XH1A 4B1WB 3W3DA 5JVHL 1E4GT 1XQSC 5M1QA 3WT0A 3FR0A 2P9LA 4FOEA 4BGBA 4CJ7A 4Z94A 1NGDA 4IDHA 1ATNA 5AZJB 3UKUA 2QWQA 3CHWA 2NRXA 1BUPA 3FZHA 1MA9B 3F2KA 3CC2N 3WEEA 1H1VA 1QZ5A 3CJ9A 4BR4A 3O80A 1QQOA 2KKZA 3VF6A 1MDUB 4EFHA 5GAGP 5GAHP 4K43A 2A42A 5BPMA 5B8HA 1KAXA 4PKIA 3D7EO 5AFUH 4YORA 4BRIA 4BRPA 2C1IA 2PFUA 2YHXA 4IOAL 1TUYA 1JJ2M 3B8AX 4XH4A 4F9OA 2V7YA 3DXMA 1DGKN 3ENBA 3L56A 2KLAA 3QBXA 4JD2B 3SJHA 5AQPA 4EAHD 1VQON 2A40A 3VGKA 2HBJA 5KQ8A 2VCPA 1P90A 3RSEB 4BRMA 1T44A 3WQTA 3VMFB 5M1NA 1NLVA 2P9PB 1GLEG 3KK7A 3VTIA 2FLOA 3BF1A 5M1FA 4YOUA 1M90O 5AFUA 4NLCA 3IUCA 5BN9A 3MX5A 5AQIA 4YDUA 3CCMN 4YOTA 4BRNA 3R2VA 3O1WA 5AZJA 3U8XA 1WUAA 3H3NO 3AARA 3LDPA 3O9TA 2E1ZA 1YVNA 1VQNN 2ZGYA 4BRHA 2AA4A 3CW4A 2HSTA 3OA9A 1P8ZA 3SF4D 3QB0A 5BRDA 3KWIA 1YITN 1BA1A 2JWKA 2D4WA 3FZFA 4MO5A 4H03B 3CERA 2YIPA 2UYTA 5C12A 4CD1A 4JD2A 2W41A 3R6MA 3C0BA 1X3MA 2P9UB 3N4PA 3RSEA 4L3QA 3O9QA 4CZIA 3C6HA 2F9TA 2P9SB 3CJ7A 3CF5L 2P9PA 1NGFA 1IG8A 1W97L 1TYQA 5BPNA 2IIRA 1POIA 2KHOA 1YJ9N 3MN7A 1IJJA 3J7ZO 1GLLO 3H46O 1XUPO 2E88A 1GLCG 4JHDB 3HSCA 4CBUA 3TPQA 1VQPN 5HOOA 4BC2A 5KPRA 4H0PA 5BRHA 4FWKA 5TKYA 4BQLA 4BRCA 3TU5A 3GE1A 5EY4A 1NGGA 2GX9A 4A2AA 1GLBG 4K25A 5AQHA 1W2BM 3NVMA 3FGUA 1GLFO 2GWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4I A;  3LDO A;  5BN8 A;  2ZGZ A;  4IJA A;  4MO4 A;  5AQF A;  2QWO A;  3ENH A;  2QWN A;  3D2F B;  4CZJ A;  4O8K A;  3QBW A;  3A5O C;  5AQS A;  5EVZ A;  1CZA N;  2P9U A;  4BRE A;  2P9S A;  1GLA G;  3ULE B;  3VEN A;  4RTF D;  4CZM A;  4PKG A;  2FXU A;  2E20 A;  3CJC A;  4O5F A;  4FO0 A;  4JHD A;  2W40 A;  3QFU A;  3MDQ A;  1G99 A;  1NMD A;  4CZH A;  4QS7 A;  3O1B A;  2P9K B;  2F9W A;  2BTF A;  2QM1 A;  3SLC A;  4IJN A;  4FSV A;  2YI1 A;  3GG4 A;  3BUZ B;  1K8K B;  3CET A;  3WQU A;  5KPT A;  1X3N A;  2Q97 A;  5JLH A;  3GDQ A;  2QWR A;  3HM8 A;  5JLF A;  2Q1N A;  3D2F A;  2ASP A;  3DJC A;  2Q36 A;  3LDQ A;  4CBW A;  3BP8 A;  4M7X A;  2A6A A;  3ID8 A;  4Y0W A;  4BR9 A;  3WUH A;  3O6W A;  5AZI A;  5AQJ A;  2V7Z A;  1Z05 A;  4WQ4 C;  3ULE A;  2P9I B;  3VEY A;  2E8A A;  1ZBS A;  5LJV A;  5KQD A;  3EN9 A;  4H0V B;  1SAZ A;  1JCE A;  3IDH A;  2E2O A;  2GTD A;  4JN4 A;  1LOT B;  2OAN A;  2P9K A;  4MLE A;  4BVP A;  5AQV A;  4MLH A;  4FWL A;  2ITM A;  2GEL A;  1K8K A;  3CIP A;  4CI6 A;  2I7N A;  3MCP A;  2IVO A;  5LJW A;  3SMS A;  3ZET B;  4EIA A;  3C7N A;  5AQT A;  1MWK A;  5BR9 A;  5FPN A;  3U9D A;  1ESV A;  3EL2 A;  4JAX A;  1U6Z A;  1DKG D;  1GLD G;  1S22 A;  4K42 A;  5AQR A;  1C0G A;  1RFQ A;  4BC4 A;  3ATU A;  2D0P A;  2BUP A;  4ISE A;  3VGM A;  1Y64 A;  3GL1 A;  4CZE A;  1HKG A;  3VEW A;  4BQZ A;  1E4F T;  1U2V B;  4K41 A;  1S3X A;  1NGJ A;  5FPM A;  1QQM A;  2QWP A;  4A2B A;  3HBT A;  1NGE A;  4ISG A;  4I6M B;  2FF6 A;  3ZET A;  1BG3 A;  3H6E A;  4WQ5 C;  1ATR A;  4XEI A;  1KAZ A;  2Q31 A;  1NGC A;  4GY2 B;  2QWM A;  5FPE A;  1BA0 A;  3CQY A;  3SK3 A;  4WQ4 A;  4BG9 A;  3JXU A;  3P4I A;  1KAY A;  4PKH A;  3QFP A;  2NRH A;  2NZT A;  3H45 C;  4B1Z A;  3ZX2 A;  2PBD A;  4HWI A;  2FF3 B;  1NGA A;  5AQW A;  5BPL A;  3MN6 A;  4M7Y A;  4BR0 A;  3UKR B;  4FWP A;  4IXC A;  3WXL A;  3M3Z A;  4RCH A;  3QML A;  2ASO A;  4H5T A;  2ZF5 O;  5BRE A;  3H3O B;  2VYP A;  1QZ6 A;  3SMP A;  4M63 C;  4I6M A;  5F0X A;  5F2R A;  1LCU A;  1V4T A;  3M6G A;  3ZX3 A;  2E1Y A;  3H1Q A;  5AQO A;  3EO3 A;  4BR7 A;  4FWM A;  4RWT A;  5EXW A;  4BRQ A;  3VER A;  3VOV A;  1NWK A;  2DPN A;  4IZ9 A;  3BF3 A;  2YHY A;  1QQN A;  5KPZ A;  4IWV A;  4DHY A;  2A3Z A;  2GEM A;  2QXL A;  4A61 A;  1HLU A;  4NO7 A;  4DQ8 A;  1ZXO A;  2D0O A;  4BRL A;  2GUP A;  4BGA A;  3OHR A;  3EZW A;  3DAW A;  3FLC O;  4C23 A;  1BO5 O;  3UKR A;  5ADX H;  2GWJ A;  3AY9 A;  3FZK A;  3O8M A;  3GBT A;  1JCF A;  2Q0R A;  5JIC A;  3M1F A;  3ENO A;  3FZM A;  1HJO A;  4H5W A;  2CGK A;  3UB5 A;  1V4S A;  2HF4 A;  1SQK A;  4B1Y B;  1J6Z A;  3LDL A;  4FL9 A;  1JCG A;  1RGI A;  3U4L A;  3VF4 A;  2FSK A;  1NGH A;  5AQZ A;  4BRA A;  5ADX A;  2YCH A;  3VF2 A;  3VPZ A;  3UE5 A;  1QHA A;  3MN9 A;  2CGL A;  3L6Q A;  3W0L A;  4BVO A;  4BR2 A;  4FWR A;  3MMV A;  1HX1 A;  1T6D A;  3JS6 A;  3VET A;  2E2Q A;  3WXI A;  3WXK A;  4H5V A;  3A0I X;  3ATV A;  3VEO A;  4E1J A;  1SZ2 A;  3LM2 A;  2QW9 A;  1BU6 O;  3FE1 A;  4CBX A;  1YUW A;  3CQX A;  3O5B A;  3S41 A;  4B1V A;  2CH6 A;  2CGJ A;  4HTL A;  1HKC A;  1RDW X;  4FWO A;  5AQQ A;  2E2N A;  3LL3 A;  4BRF A;  3HI0 A;  3A8Y A;  3VEZ A;  4AM7 A;  4ISF A;  1MWM A;  2P9I A;  3CI5 A;  5CE3 A;  3J8A A;  4NB4 A;  3DWL A;  1D4X A;  4JNE A;  3I33 A;  3VES A;  2VWB A;  2YHW A;  4FPB A;  4LC9 B;  4QS8 A;  3ZX0 A;  1TUU A;  5AR0 A;  2IVP A;  1Z6R A;  1T6C A;  1Q18 A;  4B1U B;  3O4W A;  3H1V X;  2Q0U A;  5E84 A;  2NLX A;  3HZ6 A;  1YAG A;  4BC5 A;  2J4R A;  3R8E A;  1HUX A;  4BRD A;  5AQK A;  4FWN A;  4BRK A;  3DXK B;  1TYQ B;  1YXQ A;  3AAP A;  2AP1 A;  4DCH A;  4PL7 A;  2QWL A;  5AQG A;  2E2P A;  5EOY A;  3IFR A;  1X9J A;  3D2E B;  3EKS A;  5ELZ A;  4BRO A;  3L0Q A;  4CZG A;  4B1X B;  3AAQ A;  3FFK B;  3CJA A;  4J8F A;  2EWS A;  3KZB A;  3FZL A;  4KBO A;  2V51 B;  3F9M A;  2YJE A;  3ZEU B;  1HKB A;  4H0T B;  4BR5 A;  3U9Z A;  4FWS A;  3G25 A;  4CZF A;  4H0O A;  5AQN A;  4FWQ A;  4QS9 A;  1U2V A;  2WUS A;  3CJ1 A;  4XH5 A;  4AM6 A;  1BOT O;  4BRG A;  5AQU A;  3IMX A;  4CZL A;  5AQX A;  3DXK A;  2P9N B;  2V52 B;  3LM9 A;  4DB3 A;  1XC3 A;  2HOE A;  2H3G X;  4EHT A;  3QIC A;  4PL8 A;  2A41 A;  2HMP A;  3CJB A;  3VGL A;  3HTV A;  3D2E A;  1ATS A;  1NGB A;  3WXJ A;  2CH5 A;  3R9P A;  1NGI A;  2I7P A;  5F1X A;  3BEX A;  2YJF A;  3ZEU A;  2Q2R A;  4H5R A;  3EKU A;  1EQY A;  4A62 A;  5BRF A;  1R59 O;  5AZI B;  1NBW A;  5JMV A;  4H0X B;  3A5N C;  2P9N A;  5FPD A;  4BC3 A;  4EHU A;  3QDK A;  4YDU C;  1BWF O;  4WQ5 A;  2D1K A;  3GOI A;  1C0F A;  2P9L B;  1BDG A;  3KHY A;  3KVG A;  4H0Y B;  3VEX A;  4B9Q A;  2PAV A;  3UKU B;  1KXP A;  3WEE B;  3MN5 A;  5AQM A;  4H5N A;  3A5M C;  2FSN A;  4CD3 A;  1NM1 A;  4FOI A;  3VEV A;  5EX5 A;  2ZWH A;  2A5X A;  3O08 A;  2ASM A;  4BG8 A;  1ZC6 A;  4WYB A;  3A5L C;  1HPM A;  3C7N B;  1OKJ A;  2IVN A;  5AQY A;  5AQL A;  3DXM B;  1GLJ O;  4FPA A;  5E26 A;  4CZK A;  5LY3 A;  3LDN A;  5I9E B;  4IO8 A;  3MK6 A;  1DEJ A;  2HF3 A;  3I8B A;  4GNI A;  2FSJ A;  1WOQ A;  4XH1 A;  4B1W B;  3W3D A;  1E4G T;  1XQS C;  3WT0 A;  3FR0 A;  2P9L A;  4FOE A;  4BGB A;  4CJ7 A;  4Z94 A;  1NGD A;  1ATN A;  5AZJ B;  3UKU A;  2QWQ A;  3CHW A;  1BUP A;  3FZH A;  1MA9 B;  3WEE A;  1H1V A;  1QZ5 A;  3CJ9 A;  4BR4 A;  3O80 A;  1QQO A;  3VF6 A;  1MDU B;  4EFH A;  4K43 A;  2A42 A;  5BPM A;  5B8H A;  1KAX A;  4PKI A;  3D7E O;  5AFU H;  4BRI A;  4BRP A;  2YHX A;  1TUY A;  3B8A X;  4XH4 A;  4F9O A;  2V7Y A;  3DXM A;  1DGK N;  4JD2 B;  3QBX A;  3SJH A;  5AQP A;  4EAH D;  2A40 A;  3VGK A;  5KQ8 A;  2VCP A;  3RSE B;  4BRM A;  1T44 A;  3WQT A;  1NLV A;  2P9P B;  1GLE G;  2FLO A;  3BF1 A;  5AFU A;  3IUC A;  5BN9 A;  4YDU A;  5AQI A;  4BRN A;  3O1W A;  5AZJ A;  3U8X A;  1WUA A;  3H3N O;  3AAR A;  3LDP A;  2E1Z A;  1YVN A;  2ZGY A;  4BRH A;  2AA4 A;  1P8Z A;  3QB0 A;  5BRD A;  1BA1 A;  2D4W A;  3FZF A;  4MO5 A;  4H03 B;  3CER A;  2UYT A;  4CD1 A;  4JD2 A;  2W41 A;  3R6M A;  3C0B A;  1X3M A;  2P9U B;  3RSE A;  4L3Q A;  4CZI A;  2F9T A;  2P9S B;  3CJ7 A;  2P9P A;  1NGF A;  1IG8 A;  1TYQ A;  5BPN A;  2IIR A;  2KHO A;  3MN7 A;  1IJJ A;  1GLL O;  3H46 O;  1XUP O;  2E88 A;  1GLC G;  4JHD B;  3HSC A;  4CBU A;  3TPQ A;  4BC2 A;  5KPR A;  4H0P A;  5BRH A;  4FWK A;  5TKY A;  4BQL A;  4BRC A;  3TU5 A;  3GE1 A;  5EY4 A;  1NGG A;  4A2A A;  1GLB G;  4K25 A;  5AQH A;  3FGU A;  1GLF O;  2GWK A; 
#chains in the Genus database with same CATH topology
 2ZGZ A;  4Y1D A;  2OZS A;  2HHI A;  4KRE A;  3HPG A;  1ZU3 A;  1JXE A;  3NGI A;  3K59 A;  4CZJ A;  3T1Y K;  2Z1G A;  2O8C A;  1WT7 A;  5AQS A;  5EVZ A;  4CFD A;  4B9N A;  3O3F A;  4FLV A;  4BRE A;  3ULE B;  3ZT1 A;  1NNE A;  5KRS A;  2YX6 A;  1ZYV A;  4B9V A;  2NRW A;  3QEX A;  1HMV A;  5J2Q A;  4EP5 A;  2W40 A;  1GPS A;  4CK1 A;  3CFR A;  3O1B A;  1LAV A;  4KV8 A;  2HNZ A;  3TTD A;  4FSV A;  3RVC A;  4CFB A;  2ATQ A;  3WQU A;  1C1B A;  4DTU A;  3NBP A;  5JLH A;  1A5X A;  4CJE A;  4JI7 K;  4OGC A;  4KI4 A;  2IOC A;  1ZUT A;  3HM8 A;  3THV A;  1Q9X A;  4JRQ A;  4DSE A;  4ELU A;  4LD0 A;  3ALY A;  5KGW A;  1NJW A;  4X64 K;  4B3S K;  5AZI A;  2O8E A;  1J53 A;  1HRH A;  1IO2 A;  1VNA A;  3VEY A;  5CHI A;  2AJQ A;  1SEG A;  1VHX A;  5LJV A;  3EN9 A;  1QQC A;  1SAZ A;  4C8O A;  1JCE A;  2E2O A;  4JN4 A;  4MLE A;  2OAN A;  4M3T A;  1S6Q A;  1C1A A;  1SV5 A;  1QVG M;  4MLH A;  1YI2 N;  2I7N A;  3V9Z A;  3VQD A;  1XHX A;  2IVO A;  3VQP A;  3K57 A;  3C7N A;  3NGZ A;  5LMN K;  1ESV A;  2OTJ N;  3L4Q A;  3M5R A;  1U6Z A;  1WB9 A;  4HHF A;  1GLD G;  2YNI A;  4IG0 A;  4CHZ A;  1J9A A;  1SUQ A;  3TAQ A;  1JXC A;  3TTC A;  4CHP A;  3EE8 A;  4FJG A;  4J2E A;  4JKE A;  1SKR A;  2BUP A;  4ISE A;  3SV4 A;  2A1R A;  1KV0 A;  1U48 A;  4V1D C;  2M8B B;  4BQZ A;  1T3V A;  4DSF A;  1B9D A;  5C42 A;  5J2N A;  1ICA A;  4A2B A;  1NGE A;  4I6M B;  4FJ7 A;  4KHW A;  3ZSY A;  1BG3 A;  1U45 A;  1WSG A;  1HNW K;  4JKA A;  4RW7 A;  4AHC A;  3EE9 A;  3NDK A;  4CQK A;  4F3T A;  1KCF A;  3KKS A;  2LN8 A;  4HWI A;  2G8U A;  4YOY A;  3F73 A;  2G8K A;  5BPL A;  3E7U X;  3HOS A;  4B3R K;  4MQ3 A;  4RCH A;  2VG7 A;  2P5G A;  4H5T A;  4CFC A;  1QZ6 A;  3MX2 A;  4OPA A;  3DLH A;  1E3M A;  1VSF A;  2ZM6 K;  3M6G A;  1GOB A;  3H1Q A;  4J2A A;  1KFS A;  2F4V K;  4FWM A;  2GMO A;  4DHY A;  1JKH A;  3WNE A;  4O55 A;  2QXL A;  1WSF A;  1HLU A;  1ZXO A;  3I0R A;  2D56 A;  3HVR A;  2EX3 A;  3C6T A;  3OVN A;  2HHV A;  3EZW A;  3NVK A;  4E1M A;  3UKR A;  1Q81 O;  2E5L K;  3AY9 A;  3O8M A;  3GBT A;  1A5W A;  2DFF A;  2JGU A;  2IGI A;  4CER A;  3V4I A;  4JI1 K;  4PQU A;  4AHT A;  4CFA A;  1V4S A;  1VSD A;  1REV A;  4B1Y B;  5C2F A;  1XC9 A;  3VF4 A;  4Z4H A;  2O8D A;  5AQZ A;  5CY0 A;  4KPY A;  3ZT4 A;  5M1K A;  1QS4 A;  4CK3 A;  4C1N I;  1C1C A;  1IKY A;  1QHA A;  4DFM A;  3THX A;  1ITG A;  4BR2 A;  3OYE A;  1I6F A;  3JS6 A;  3N4Q A;  3WXK A;  4H5V A;  5LL6 Z;  4Z4I A;  2KSK A;  4BWJ A;  4JKD A;  4BE0 A;  4EZ6 A;  2QA4 N;  2F8S A;  3PSF A;  1UOC A;  1BIU A;  4E1J A;  3K9K A;  1KLN A;  5FRM A;  2X6S A;  3O5B A;  4CJ3 A;  3SBT A;  3CCE N;  2B3C A;  4M3U A;  1IKW A;  2CGJ A;  4FVU A;  3V9U A;  2XO7 A;  3VA0 A;  4CES A;  3JYT A;  2O8B B;  4ISF A;  1MWM A;  3CI5 A;  4NXM K;  2QEX N;  3VES A;  4FPB A;  2YHW A;  3SYZ A;  4FJK A;  1NOY A;  2QXF A;  3Q7C A;  3R1X A;  4E7K A;  3NCI A;  1Z6R A;  4KO0 A;  4CJP A;  4I9Q A;  3CCS N;  3P5J A;  3B6O A;  1HNV A;  3CCV N;  3DOK A;  2QKB A;  2J4R A;  4OVL A;  2E6L A;  1NJY A;  3TAP A;  3E7R L;  1NJX A;  4FK0 A;  1TL3 A;  3DXK B;  3QI7 A;  1OH6 A;  4KH5 A;  4PL7 A;  3O9U A;  3DI6 A;  1RBS A;  3EKS A;  2BGG A;  5ELZ A;  2JLE A;  3PX0 A;  1NJZ A;  1WBB A;  3L0Q A;  4Z4C A;  4FZZ A;  3K5M A;  4DQI A;  2A1S A;  3KK3 A;  3CJA A;  2VWJ A;  4DKW A;  3OYJ A;  4FLT A;  3V1R A;  1WSH A;  1C6V A;  1GOA A;  1X9W A;  1PX9 A;  5TKW A;  3F9M A;  2DFE A;  3U9Z A;  4H0O A;  3IKM A;  3RMA A;  4QS9 A;  1P00 A;  3CJ1 A;  3LAN A;  1BI4 A;  1CXU A;  1BOT O;  1RIL A;  3O9S A;  4DB3 A;  4NCA A;  4DF8 A;  4CGI A;  4GVM A;  1ASW A;  4ILH A;  1VSK A;  3QIC A;  3MCA B;  2XRI A;  1BQN A;  2MN5 A;  2ZD1 A;  1YIJ N;  4H4O A;  3WXJ A;  4I9L A;  3AVA A;  4H4M A;  4WCE L;  1YF5 L;  1RTJ A;  2I7P A;  1I94 K;  1VQ4 N;  1HPZ A;  1VQ6 N;  5F1X A;  3BEX A;  1T7P A;  4DSJ A;  3E9P A;  1NE5 A;  4HCC A;  3E01 A;  5GIO A;  2Z1H A;  1T7A A;  4IG3 A;  3THW B;  3AVG A;  4IEI A;  4X66 K;  1VSE A;  1HYZ A;  2D0A A;  2ATB A;  5BRF A;  2YEO A;  2P9N A;  1NK7 A;  2G2K A;  1RBR A;  5KK4 A;  1XNQ K;  1C0F A;  1HNZ K;  4KHP K;  3KVG A;  4H0Y B;  3IG1 A;  3VEX A;  3UKU B;  3KLH A;  1ILY A;  1DQ7 A;  1I3A A;  4CF2 A;  3WEE B;  5AQM A;  4H5N A;  3K5O A;  4Z4E A;  1TVR A;  2ZE2 A;  2GV9 A;  1ZBH A;  3ZSR A;  3DXM B;  3KP0 A;  1B9F A;  4MDB A;  2HHH K;  1TK8 A;  3RR8 A;  1Q82 O;  3LDN A;  1NKB A;  3I8B A;  2E4L A;  4GNI A;  3SNN A;  1WOQ A;  3RMD A;  3QEP A;  4BGB A;  2KBH A;  3NF6 A;  3CHW A;  1RTI A;  1WMT A;  3FZH A;  4FCY A;  3CC2 N;  1FK9 A;  4BR4 A;  1QQO A;  4JYA K;  1MDU B;  3LP2 A;  3ASM A;  1KAX A;  1S1X A;  3D7E O;  3MXJ A;  4BRP A;  2PFU A;  2I5J A;  1LW0 A;  4DQP A;  4CEO A;  2KLA A;  3QBX A;  3SJH A;  4ELT A;  1N34 K;  3OYK A;  1VQO N;  2HBJ A;  5KQ8 A;  2VCP A;  3J7Y P;  2IDO A;  5HRS A;  5M1F A;  1M90 O;  3DRR A;  2OPQ A;  3IUC A;  4Z0U A;  1NKC A;  3WNH A;  3O1W A;  1MU2 A;  3L3U A;  3HST B;  2B4J A;  1RDD A;  3LDP A;  2ZGY A;  4DSL A;  1OH8 A;  3ZT3 A;  2HST A;  1O1W A;  3QB0 A;  5BRD A;  3SUN A;  3SQ2 A;  2YIP A;  2Z1I A;  3MED A;  2O8C B;  1TV6 A;  1X3M A;  4GKJ K;  3P83 D;  3LP3 A;  1Q9Y A;  3CJ7 A;  3VA3 A;  2P9P A;  1IG8 A;  2KFZ A;  1W97 L;  4QCL A;  4CJU A;  4QOZ B;  4HE7 A;  1S9G A;  1POI A;  3MN7 A;  1XMO K;  3H46 O;  1GLC G;  3L2W A;  2XY6 A;  1VQP N;  3VN5 A;  3CYG A;  5HOO A;  4BC2 A;  1Q8I A;  3QET A;  2HND A;  4BRC A;  1QTM A;  3TU5 A;  2Y1J A;  1SNB A;  1W2B M;  4K25 A;  5CZ2 A;  3NVM A;  3OYI A;  5HLF A;  4CHQ A;  1WBD A;  3SAF A;  4O8K A;  4U67 L;  3QBW A;  4KB0 A;  2D0B A;  3A5O C;  4A5B A;  2GBZ A;  4LF7 K;  1NG9 A;  2MZ0 A;  2O8E B;  4GV3 A;  5JEN A;  2VGM A;  2O4I A;  3VEN A;  4RTF D;  1ASV A;  3HRG A;  1RNH A;  3CJC A;  1WNS A;  3SAG A;  3L2R A;  3I55 N;  3LAK A;  1UGL A;  4QS7 A;  2F9W A;  2BTF A;  4OKK A;  3C6U A;  1VQ5 N;  3DOL A;  2YI1 A;  5M1P A;  3BUZ B;  2F8T A;  1X3N A;  2G8I A;  2F96 A;  2QWR A;  4XIU A;  3O4Q A;  4MDA A;  3D2F A;  2ASP A;  3DJC A;  2Q36 A;  3CG7 A;  4O4G A;  3VTH A;  4CBW A;  3CD6 N;  4M7X A;  1RT2 A;  3ID8 A;  4Y0W A;  5KGX A;  4KH4 A;  3WUH A;  2HMI A;  4BDP A;  2QK9 A;  3CYM A;  1Z05 A;  4F8R A;  3NF8 A;  2E3F A;  2E8A A;  4DU1 A;  1MYN A;  4U7B A;  5KQD A;  3I8D A;  4H0V B;  3J80 O;  3EYZ A;  2IS3 A;  2O4G A;  3CM6 A;  2P9K A;  5AQV A;  4FWL A;  4FVM A;  3TAM A;  4FZY A;  1K8K A;  4DS4 A;  3K5N A;  3M8Q A;  3BY5 A;  1NMN A;  1IKV A;  5DMR A;  5LJW A;  3SMS A;  4EIA A;  1MWK A;  2NRZ A;  2KTQ A;  1VSI A;  4ICL A;  4JAX A;  4CJ4 A;  3CFO A;  4AB0 A;  2JWL A;  1C0G A;  1Y97 A;  3NHG A;  4CGG A;  3CMA N;  1T03 A;  1TKT A;  5C24 A;  3IAY A;  2RKI A;  2X6N A;  1LW2 A;  1LQI A;  2OZM A;  3ATU A;  1MR4 A;  1Y64 A;  3GL1 A;  4DV4 K;  3E9L A;  4CZE A;  3CPE A;  3VEW A;  4IOX A;  2RHK A;  4K41 A;  2RN2 A;  1S3X A;  3G0Z A;  4E19 A;  5FPM A;  3AO1 A;  3HL8 A;  1QQM A;  1NRA A;  2WC9 A;  4PHT X;  5MLC Q;  4J2B A;  1BHL A;  2QKK A;  3AVH A;  3NMU A;  3RRH A;  5CR4 A;  4DR5 K;  1KAZ A;  2JDQ D;  1NGC A;  1X9M A;  3SUP A;  1BA0 A;  3CQY A;  3MXI A;  3ZT0 A;  4WQ4 A;  2VGN A;  2N2Q A;  3JXU A;  4CED A;  3V1O A;  4X65 K;  3H45 C;  2KYQ A;  2PBD A;  2XHB A;  1VRU A;  4C8M A;  4FJ5 A;  2FF3 B;  3F9K A;  3V1Q A;  3UKR B;  4FWP A;  1A5V A;  1ZYQ A;  2B68 A;  2OA8 A;  4M3Z A;  5F0X A;  1NU0 A;  5F2R A;  1LCU A;  3NH2 A;  3ZX3 A;  3EO3 A;  3L2Q A;  4RWT A;  4CIF A;  3WXM B;  4IFV A;  2O8D B;  3VOV A;  4DU3 A;  3KP1 A;  2YHY A;  1QQN A;  4DUY K;  4NCG A;  1TKX A;  3THX B;  4UAD E;  4NO7 A;  4LF8 K;  4BRL A;  3G71 N;  2GUP A;  1J54 A;  4B8A B;  4JI5 K;  1KSP A;  3FLC O;  1VQ9 N;  5ADX H;  3I56 N;  2DY4 A;  1JCF A;  2Q0R A;  1NK5 A;  1BRZ A;  4DV1 K;  3HO1 A;  1N4N A;  3HYF A;  3GKU A;  4BE7 B;  1KQS M;  3SQ0 A;  1J6Z A;  4E0D A;  4FL9 A;  3U4L A;  4LF4 K;  4BRA A;  3KOY A;  3L6Q A;  1UWB A;  4BVO A;  2YIL A;  1SS6 A;  1VSJ A;  3K5L A;  1EO1 A;  4DTO A;  3AO5 A;  4WF9 L;  2D0C A;  4RW9 A;  3ATV A;  3OYF A;  3L8B A;  1O13 A;  3ZCM A;  3KC6 A;  4CGD A;  3ID6 A;  2PYJ A;  3KTQ A;  1EP4 A;  3LM2 A;  2QW9 A;  1BU6 O;  4HUE A;  1F21 A;  4WE1 A;  4AF1 A;  4CBX A;  1YUW A;  4N5S A;  3CQX A;  5DK5 A;  4QAG A;  4B1V A;  4HTL A;  1HKC A;  1RDW X;  3LL3 A;  4B3O A;  3SBG A;  4DR1 K;  3VEZ A;  3OYC A;  4AM7 A;  4NB4 A;  2VQE K;  1D4X A;  4DR6 K;  2VWB A;  4LC9 B;  4A57 A;  5FRO A;  4IFE A;  2E3G A;  4R5P A;  3FFI A;  3OYA A;  1YJN N;  2PZS A;  2IVP A;  1Q18 A;  4B1U B;  4N41 A;  1I39 A;  2FBX A;  3AVF A;  4KH6 A;  4C8K A;  1RBU A;  1IV0 A;  3HXM A;  3HZ6 A;  4F4K A;  1RDC A;  4E89 A;  3R8E A;  1NK8 A;  4JKF A;  1BI4 B;  5IT9 O;  1HUX A;  4BRD A;  5AQK A;  4FJ9 A;  4MFB A;  1K73 O;  4CJR A;  1BMR A;  3AAP A;  3OBY A;  4JK9 A;  3TSU A;  5EOY A;  4JS4 A;  4M41 A;  4IFY A;  4B9M A;  1JZA A;  3DRS A;  4AH9 A;  4DU4 A;  3BK3 C;  1RTD A;  4CCH A;  3E66 A;  2EWS A;  4KBO A;  3PO4 A;  2KZM A;  2V51 B;  3K58 A;  4DTR A;  4W5R A;  4FWS A;  3ZYY X;  4CZF A;  1QSL A;  4AAZ A;  5CY4 A;  4AHS A;  2HBL A;  5AQU A;  3IS9 A;  4CZL A;  5I42 A;  5AQX A;  2HNY A;  2P9N B;  3CM5 A;  3LM9 A;  1XC3 A;  2HOE A;  1JL2 A;  4JI3 K;  3HP6 A;  4BAC A;  4R79 A;  3P1G A;  1BL3 A;  2NNW A;  3DLK A;  2P1J A;  2HVI A;  4PA1 A;  3ZEU A;  2GL1 A;  3MXM A;  4H5R A;  1OMY A;  4AQY K;  3AVN A;  3EKU A;  2UU9 K;  3CCL N;  4DR3 K;  4B8C A;  4A62 A;  3NF7 A;  4N56 A;  1NBW A;  3KLE A;  4H0X B;  3A5N C;  3KOW A;  4EHU A;  4LSN A;  4YOW A;  1TL1 A;  1S6P A;  2YBR C;  1BWF O;  3GOI A;  3PSM A;  3G4S N;  3S5T A;  4EP4 A;  4CIG A;  1NRB A;  4DV2 K;  3T69 A;  4B9Q A;  3LDS A;  1S1V A;  5J1E A;  3AA4 A;  1L3U A;  3AO2 A;  4CEA A;  4CD3 A;  1NM1 A;  2YIO A;  3VEV A;  2ZWH A;  4ZTJ A;  2FBT A;  4KHU A;  3O08 A;  4DLG A;  2ASM A;  4OO1 J;  2ETJ A;  5FDL A;  2LT8 A;  1GOC A;  2IVN A;  3MEE A;  4FPA A;  5E26 A;  5GAE P;  4CJK A;  4IO8 A;  3MK6 A;  1HJR A;  3ZSV A;  4OPH A;  2OCE A;  4B1W B;  1E4G T;  3L2V A;  4KRF A;  1C0M A;  1UA0 A;  2P9L A;  2Q3S A;  1NGD A;  4IDH A;  1ATN A;  4YNQ A;  2QWQ A;  1BUP A;  1T1T A;  3C94 A;  5GAH P;  3SZ2 A;  2HHX A;  5BPM A;  4CW7 B;  1NK0 A;  5AFU H;  1UA1 A;  3LPU A;  3TAE A;  3VQE A;  2ITG A;  2V7Y A;  1HQE A;  3AO3 A;  3ENB A;  1HYS A;  5AQP A;  1W9H A;  2FBY A;  3O4N A;  3WQT A;  2P9P B;  2XY5 A;  2VQF K;  1HQU A;  3VTI A;  2FLO A;  3BF1 A;  4OX9 K;  4YOU A;  4DSI A;  3KLF A;  5BN9 A;  1W0H A;  3MX5 A;  3ZSQ A;  3CCM N;  4BRN A;  1D9F A;  1D5A A;  2G8W A;  3R2V A;  4IDK A;  3DLR A;  3H3N O;  3AAR A;  4J2D A;  2E1Z A;  1VQN N;  4CJV A;  1KTQ A;  3B6P A;  3CW4 A;  4DR7 K;  4DV5 K;  1P8Z A;  1YIT N;  1BA1 A;  2ZQB A;  4H03 B;  3NE6 A;  3CER A;  4O44 A;  2BE2 A;  4JRP A;  3QEW A;  4CD1 A;  1U47 A;  3R6M A;  2OYQ A;  1SL2 A;  4DV7 K;  1XNR K;  3C6H A;  1W7A A;  1NGF A;  3TWH A;  4BDZ A;  1SN1 A;  4DLE A;  2KHO A;  1IJJ A;  3J7Z O;  3RR7 A;  3LAL A;  4Q0B A;  1IH7 A;  1XHZ A;  1WSI A;  5EY4 A;  1AYJ A;  2GX9 A;  1GLB G;  2KGQ A;  4E1N A;  1GLF O;  3MWP A;  3L4I A;  3CQ8 A;  1VQM N;  4MO4 A;  2QWO A;  3D2F B;  2P9U A;  1NK6 A;  1IBK K;  1LWE A;  2P9S A;  2LSN A;  1SKS A;  2E20 A;  2Y1I A;  3TR8 A;  3R3L A;  3AVC A;  4JHD A;  3QFU A;  4CEF A;  3MDQ A;  1NMD A;  1NK9 A;  1QVF M;  4CZH A;  2P9K B;  2LY6 A;  4NXN K;  3SLC A;  4IJN A;  2RE2 A;  3GG4 A;  1K8K B;  3CET A;  4JI2 K;  4DTS A;  1NJI O;  4CEQ A;  4KHN A;  2Q97 A;  3OTO K;  3GDQ A;  4JKG A;  5H1S Q;  5DM6 L;  2Q1N A;  4ELV A;  3SJJ A;  1JL1 A;  2VG5 A;  3CC4 N;  1PE4 A;  4FLY A;  3BP8 A;  4KB1 A;  2ASC A;  4AHV A;  2EHG A;  3G10 A;  2PY5 A;  2HHW A;  4WQ4 C;  2V7Z A;  1WLJ A;  2E0H A;  2P9I B;  3OYD A;  3OW2 M;  3RRG A;  1C0U A;  5JVG L;  3OYM A;  3QER A;  1SL1 A;  1NKE A;  3OJU A;  4B9U A;  3IDH A;  4LH5 A;  2GTD A;  4BVP A;  3I0S A;  4WFA L;  3TAR A;  2ITM A;  2GEL A;  3HVT A;  1ASU A;  2FC0 A;  5K14 A;  3VQC A;  3MCP A;  4DFP A;  1TKD A;  1VQ8 N;  2NY9 X;  5AQT A;  4EZ9 A;  1YJW N;  5FPN A;  4WFN L;  3VQ8 A;  3U9D A;  1LWC A;  1YTA A;  4K8X A;  5J2P A;  1DKG D;  3KK1 A;  1YTU A;  3MAQ A;  4NYF A;  5JS1 A;  3TAF A;  3KJV A;  1RFQ A;  3ISN C;  3DLL L;  4OJR A;  4H8K A;  2N2R A;  2E2F A;  3J81 O;  1IKX A;  3HP9 A;  3SQ4 A;  1CXQ A;  1RT1 A;  4HTU A;  3VGM A;  1LQQ A;  4GW6 A;  1HKG A;  3ZSO A;  3T1H K;  4G9Z A;  1U2V B;  1NGJ A;  4HHT A;  3CC7 N;  2QWP A;  4ISG A;  3ZET A;  2RF2 A;  3DYA A;  4O5B A;  2VG6 A;  3H6E A;  4DR4 K;  1ATR A;  2QWM A;  4KI6 A;  1TKZ A;  2UXC K;  5FPE A;  3V9S A;  1HYV A;  4DV6 K;  3SK3 A;  4BWM A;  4BG9 A;  3AVM A;  4ILJ A;  5HRO A;  4AEI A;  3ITH A;  4PKH A;  4CHY A;  4AIL C;  3QFP A;  2NZT A;  3NGY A;  4B1Z A;  4KYP A;  5J2M A;  3RMC A;  3KOZ A;  3LWL A;  2LI7 A;  4M7Y A;  2OPR A;  4BR0 A;  3SUO A;  4IXC A;  3M3Z A;  4HCB A;  3L3V A;  2ZF5 O;  3H3O B;  2VYP A;  4JKB A;  4M63 C;  2KJA A;  4FW2 A;  3O3G A;  3DLG A;  2HW3 A;  1V4T A;  2VY6 A;  2E1Y A;  4CEC A;  5EXW A;  3VER A;  4A5A A;  3BGR A;  2KBJ A;  3BF3 A;  2YNG A;  5KPZ A;  3CPW M;  4IWV A;  1EWQ A;  2GEM A;  2HBM A;  4KKO A;  4BGA A;  4FLX A;  3QNO A;  4F2R A;  4V19 S;  4C23 A;  2XY8 A;  2G8V A;  2GWJ A;  3FZK A;  1UAX A;  5JIC A;  3M1F A;  4E7I A;  1K8A O;  1T8E A;  3FZM A;  3PV8 A;  1HJO A;  5HL7 L;  3S3M A;  2CGK A;  1JLQ A;  2W00 A;  3UB5 A;  1DT9 A;  4JI8 K;  2HF4 A;  3KD1 E;  4IOC L;  4K8Z A;  1JCG A;  3KOX A;  1VK0 A;  2FSK A;  4HVJ A;  3RWU A;  4AHU A;  5ADX A;  3T7Z A;  1J5E K;  1VQL N;  3UE5 A;  4LFC K;  2NY8 X;  3W0L A;  1FJG K;  3OS1 A;  3CCR N;  1I6G A;  3WXI A;  3S3O A;  3SAH A;  3A0I X;  4DV3 K;  3ZSZ A;  4B3M K;  3VEO A;  3OYH A;  4JS5 A;  1SZ2 A;  2YHA A;  2DFH A;  5CZ1 A;  3U3G A;  4K0K K;  4RW4 A;  3S41 A;  2CH6 A;  3J7A P;  2ZJR L;  1SL0 A;  2E2N A;  3A8Y A;  3LP1 A;  1B3C A;  3VQ5 A;  4WFB L;  1FKP A;  2P9I A;  2R7Y A;  1XMQ K;  1OH5 A;  4F2S A;  1N6Q A;  4QS8 A;  3ZX0 A;  5IWA K;  3C95 A;  3QLH A;  4DS5 A;  1TUU A;  5AR0 A;  1T6C A;  3O4W A;  5CYQ A;  3CCU N;  1JLA A;  2Q0U A;  4M3Y A;  2LJ7 A;  2SN3 A;  5E84 A;  2NRR A;  4M42 A;  2NLX A;  1CLQ A;  2F7T A;  2K35 A;  4RW8 A;  1YT3 A;  4B9L A;  1VSM A;  4DV0 K;  1JLG A;  2C1G A;  1RT5 A;  1KC8 O;  1TYQ B;  1YXQ A;  3TSQ A;  2QWL A;  1NOZ A;  3O9R A;  5AQG A;  2E2P A;  4FXD A;  4JI0 K;  3THY A;  4FZX C;  4BRO A;  4BEB A;  4CZG A;  1BCG A;  1BIS A;  3NH1 A;  3FFK B;  4J8F A;  4BY9 C;  4XJX A;  4UAF E;  3HPO A;  4A59 A;  3ZEU B;  1HKB A;  4BR5 A;  4M3R A;  1KVA A;  1CHZ A;  2FBV A;  2W6K A;  4FWQ A;  2UUA K;  1U2V A;  4XH5 A;  3PY8 A;  4JKH A;  1RDB A;  5A2Q O;  2QTD A;  4AM6 A;  1BCM A;  4GMJ B;  3VQB A;  5C15 A;  3C65 A;  3T3F A;  3DM2 A;  4L8R B;  2H3G X;  4EHT A;  1L4V A;  4PL8 A;  2HMP A;  4YOV A;  3CJB A;  1RT4 A;  3HTV A;  4Z4F A;  3D2E A;  2Z1J A;  4GV9 A;  1NGB A;  3JAM O;  2CH5 A;  3QIP A;  4KTW A;  3R9P A;  1JLF A;  4BE2 A;  3PIO L;  3TAN A;  1VQK N;  3QEI A;  1JLE A;  2VWK A;  4FYD A;  3ZSX A;  1OH7 A;  1JXB A;  2YJF A;  2ZJQ L;  3D6R A;  4E3S A;  1NK4 A;  3AVK A;  1VQ7 N;  1EQY A;  3SUQ A;  4CF1 A;  1R59 O;  1VAZ A;  3OY9 A;  3M8P A;  5FPD A;  4BC3 A;  3TAG A;  2KW4 A;  2P9L B;  4DG1 A;  1BDG A;  2YKM A;  2OPS A;  3SPZ A;  3QIO A;  1RCH A;  4DSK A;  3S3N A;  3KLG A;  4DFK A;  4CHN A;  3DMJ A;  3A5M C;  2FSN A;  4JK7 A;  4LFB K;  4FOI A;  1JLC A;  2X74 A;  1DJT A;  1JLB A;  2QI2 A;  3G6E N;  4DR2 K;  1LQH A;  4M3W A;  3A5L C;  3KLI A;  4LF5 K;  3VQ9 A;  1DTQ A;  1OKJ A;  2O8F B;  5AQL A;  4CZK A;  5DM7 L;  1L3V A;  4LF6 K;  5D3G A;  1U4B A;  2W42 A;  1DEJ A;  3LAM A;  2BRZ A;  2FSJ A;  2KPY A;  3TAB A;  5JVH L;  5M1Q A;  4Z94 A;  1LV5 A;  2UUC K;  4Z4G A;  4CF0 A;  1QE1 A;  4ID1 A;  4FJN A;  2NRX A;  1KLM A;  3F2K A;  3KK2 A;  1QZ5 A;  3VF6 A;  3LZJ A;  2KKZ A;  1ZBF A;  4EFH A;  4LFA K;  4K43 A;  2A42 A;  3OS0 A;  4PKI A;  4BRI A;  4DFJ A;  2C1I A;  2YHX A;  4IOA L;  4CEZ A;  1JJ2 M;  2I61 A;  4XH4 A;  3LWM A;  2HB5 A;  4F9O A;  1SKW A;  1DGK N;  3AV9 A;  1CZ9 A;  3HT3 A;  1RT6 A;  2A40 A;  2W6L A;  1P90 A;  4CJ5 A;  1G15 A;  1T44 A;  2N69 A;  5M1N A;  3ZLJ A;  4FJH A;  1GLE G;  3KK7 A;  2WOM A;  4OKJ A;  5AFU A;  4NLC A;  3EY1 A;  4YDU A;  5AQI A;  4YOT A;  4O0I A;  4NYN A;  5AZJ A;  1S1T A;  1TI5 A;  1WUA A;  1TK0 A;  2A7T A;  3O9T A;  3SV3 A;  1YVN A;  1OZZ A;  4TSX A;  5HP1 A;  3UIQ A;  2WON A;  1WSE A;  3FZF A;  2D4W A;  4MO5 A;  4C8L A;  2UYT A;  1X9S A;  3HK2 A;  4JD2 A;  2W41 A;  1FKO A;  3C0B A;  4O0J A;  2P9U B;  5LMU K;  4CHO A;  3RSE A;  4CZI A;  3CF5 L;  2F9T A;  2P9S B;  3D0P A;  1EKE A;  4Y1C A;  1TYQ A;  5BPN A;  3RTV A;  1YJ9 N;  1GLL O;  2E88 A;  4CBU A;  4JHD B;  3VQ6 A;  1VSH A;  4GKK K;  1N5Y A;  5KPR A;  5BRH A;  1DTT A;  4KHS A;  4FWK A;  3NAE A;  3GE1 A;  5AQH A;  1B92 A;  4LF9 K;  2GWK A;  4UJ0 A;  3LDO A;  5BN8 A;  4JKG B;  2UXD K;  4IJA A;  5AQF A;  3ENH A;  5C2D A;  2QWN A;  1TGO A;  4DTM A;  1IG9 A;  4BE1 A;  4KTQ A;  1RBT A;  2RPI A;  5T7B A;  1ZFU A;  1CZA N;  1GLA G;  3AGR A;  4CZM A;  4PKG A;  2FXU A;  3K0S A;  4O5F A;  4FO0 A;  1G99 A;  4UAE F;  3LZI A;  2QM1 A;  5EU7 A;  2B5J A;  4FJ8 A;  3QEV A;  1L3T A;  2KZZ A;  1OVQ A;  4LSL A;  5KPT A;  4UQG A;  2P5O A;  1ZBL A;  1GPT A;  3IRX A;  3WNG A;  5JLF A;  1S5J A;  4CGH A;  4NLB A;  3LDQ A;  4DQS A;  1CN2 A;  2N66 A;  4CK2 A;  3OS2 A;  2A6A A;  1WN7 A;  4BR9 A;  1U49 A;  1T7B A;  3O6W A;  1WWN A;  1LWF A;  1HR0 K;  3E9O A;  4CJS A;  5AQJ A;  3ULE A;  5GAD P;  4FJI A;  3DLE A;  4JEP A;  2NUB A;  1ZBS A;  1BQM A;  3H08 A;  2BH1 A;  1R0A A;  3CCJ N;  1LOT B;  3KWG A;  4FJM A;  3CIP A;  4CI6 A;  1D9D A;  1RT3 A;  2WTU A;  3SQ1 A;  3F5T A;  3QES A;  3ZET B;  3PO5 A;  4UY8 O;  1KFD A;  4IO9 L;  5BR9 A;  2O8F A;  2G8H A;  2LY5 A;  3EL2 A;  4CE9 A;  1S22 A;  4K42 A;  4I2P A;  4FJJ A;  5AQR A;  1EXQ A;  2OTL N;  1N32 K;  4BC4 A;  3SPY A;  2KBK A;  4JKC A;  2UXB K;  4CEB A;  4YHH K;  2D0P A;  1B7D A;  1C56 A;  2HHU A;  1ZVE A;  2NRV A;  1E4F T;  2P51 A;  4LY7 A;  2BAN A;  3HBT A;  3ZSW A;  2FF6 A;  4FM1 A;  4E72 A;  4WQ5 C;  4XEI A;  2Q31 A;  1K9M O;  1VRT A;  4GY2 B;  3V81 A;  1I2V A;  1BK8 A;  4B3T K;  3AVL A;  5I3U A;  3OBW A;  3P4I A;  1KAY A;  2NRH A;  3VQ7 A;  3ZX2 A;  3V6D A;  3CXC M;  4GVE A;  5SWM A;  3PUF A;  1NGA A;  5AQW A;  3MN6 A;  3NH0 A;  3P31 A;  1RDU A;  3E1Y A;  3WXL A;  3QML A;  2ASO A;  4LH4 A;  4OGE A;  5BRE A;  1AHO A;  3SMP A;  4I6M A;  1RT7 A;  5AQO A;  1QSY A;  4BR7 A;  1YHQ N;  4PUO A;  1T7E A;  3AGK A;  5C25 A;  4BRQ A;  2WFB A;  3M8S A;  1NWK A;  2DPN A;  5JS2 A;  1Q86 O;  4IZ9 A;  3T1A A;  4JV5 K;  3SI6 A;  1KD1 O;  2A3Z A;  4PY5 A;  2IAJ A;  4A61 A;  1WAF A;  3CFP A;  4CF9 A;  4DQ8 A;  2D0O A;  4CJW A;  1ZYW A;  1QSS A;  3OHR A;  3ZT2 A;  2NRT A;  3DAW A;  4W5T A;  3EEQ A;  4CGJ A;  1BO5 O;  3NFA A;  1ZVG A;  2HHQ A;  3ULD A;  4JI4 K;  4KTZ A;  1OVY A;  4W5O A;  3T19 A;  1XRS B;  3U3Y A;  3ENO A;  2YHB A;  4DTJ A;  4H5W A;  5CYM A;  2DTU A;  5HRN A;  4OPJ A;  3HPH A;  1PTX A;  3KHW A;  1SQK A;  4ID5 A;  4HUG A;  3MWT A;  4FLW A;  3LDL A;  1TK5 A;  5SZT A;  1RGI A;  4FM0 A;  4B08 A;  3RMB A;  1NGH A;  1EWR A;  5KI6 A;  2YCH A;  3DLB A;  3VF2 A;  3VPZ A;  5GIP A;  5FRN A;  3MN9 A;  2CGL A;  4I7F A;  2XY7 A;  4FWR A;  3MMV A;  1HX1 A;  1T6D A;  3VET A;  4CEE A;  1M1K O;  4FK4 A;  2E2Q A;  5M1O A;  4YY3 K;  4E7J A;  4FJL A;  3EZ5 A;  4CJQ A;  5KTQ A;  2D5R A;  2MBK A;  1S9E A;  4DTN A;  4W5N A;  4C8N A;  3FE1 A;  4CGF A;  3JSM A;  2LKB A;  3VQA A;  1FW6 A;  1CZB A;  2KQ2 A;  4G1Q A;  4FWO A;  3PSI A;  5AQQ A;  4DTP A;  4BRF A;  1L3S A;  1XWL A;  3HI0 A;  1S1U A;  3D45 A;  4KFB A;  3THY B;  5CE3 A;  3J8A A;  1BIZ A;  3DWL A;  2X78 A;  3Q7B A;  4JNE A;  3I33 A;  1KVB A;  2WBN A;  5FLX O;  4M45 A;  3H1V X;  5AJ3 K;  1VSL A;  3A2F A;  4DTX A;  1TAQ A;  1YAG A;  4BC5 A;  4HUF A;  3PX4 A;  4FWN A;  4BRK A;  4X62 K;  1FH3 A;  1C55 A;  3QNN A;  3VQ4 A;  5C10 A;  2AP1 A;  4DCH A;  3CCQ N;  1J5O A;  2G8F A;  3OYL A;  2HBK A;  4BEC A;  3IFR A;  1X9J A;  3D2E B;  4B9T A;  2O8B A;  2E6M A;  5C0Y A;  4B1X B;  3AAQ A;  4FJX A;  3VQQ A;  1KVC A;  5E41 A;  4DQR A;  3V9X A;  3KZB A;  1RBV A;  3FZL A;  1T0Z A;  2YJE A;  4JK8 A;  4RW6 A;  3AVB A;  3AA3 A;  3HOT A;  4H0T B;  3U6F A;  3G25 A;  1IBM K;  1QHT A;  1HNX K;  5AQN A;  2WUS A;  4NCB A;  4RG8 A;  1VNB A;  4BRG A;  3IMX A;  1WAJ A;  3QIN A;  3DXK A;  2V52 B;  2OPP A;  3P38 A;  4N76 A;  2HHT A;  2GUI A;  1KRP A;  3QO9 A;  3KKR A;  2A41 A;  4E7H A;  3HJF A;  1Z25 A;  1DLO A;  1WSJ A;  3LPT A;  4E7L A;  3VGL A;  2HVH A;  3P39 A;  4OLB A;  4YFU A;  3PLA A;  3KIO A;  4CVN E;  1ATS A;  1RTH A;  1S72 N;  4KHY A;  1NGI A;  4GV6 A;  4C1N K;  3SCX A;  4CF8 A;  2Q2R A;  3C6A A;  4ILG B;  3TTF A;  1D8Y A;  3S9H A;  4FW1 A;  3OJS A;  5AZI B;  3TI0 A;  4Q5V A;  3PX6 A;  5JMV A;  4OLA A;  4IBN A;  3QDK A;  1K6Y A;  4YDU C;  2YKN A;  4WQ5 A;  2D1K A;  4CIE A;  5HRR A;  3HM9 A;  4DQQ A;  3KHY A;  3BZK A;  4CJL A;  2KFN A;  4O8U A;  2PAV A;  4FM2 A;  1KXP A;  3BZC A;  1TAU A;  4IEE A;  3OYN A;  2IC3 A;  5BR8 K;  3MN5 A;  3K9J A;  3BDP A;  5EX5 A;  3AVJ A;  2A5X A;  3TSP A;  4BG8 A;  1ZC6 A;  4WYB A;  1HPM A;  3C7N B;  4AHR A;  4YOX A;  3THW A;  1Q7Y O;  2ZJP L;  5AQY A;  1BGX T;  1GLJ O;  5LY3 A;  3PIP L;  1N8R O;  5I9E B;  1N33 K;  2HF3 A;  3L2U A;  1P0A A;  5GIN A;  3CME N;  1ZBI A;  4JI6 K;  1NH5 A;  4XH1 A;  3W3D A;  5KRT A;  4N47 A;  1XQS C;  3AA5 X;  1JZB A;  4IKF A;  3WT0 A;  3FR0 A;  1LAW A;  4FOE A;  4CJ7 A;  3KD5 E;  2HHS A;  4DMN A;  3LP0 A;  5AZJ B;  3UKU A;  4KAZ A;  4KHQ A;  1MA9 B;  1U04 A;  1I2U A;  2B6A A;  3WEE A;  1H1V A;  3CJ9 A;  5GAG P;  2YNF A;  3O80 A;  3OYB A;  2BDP A;  3AVI A;  3V9W A;  5B8H A;  4OPK A;  4YOR A;  1BCO A;  4ZHR A;  1TUY A;  3AO4 A;  4F3O A;  3B8A X;  3DXM A;  3L56 A;  4JD2 B;  1S1W A;  4EAH D;  1ZBU A;  3O3H A;  4PWD A;  3VGK A;  3RSE B;  1Z26 A;  4BRM A;  2UUB K;  3VMF B;  1XI1 A;  1NLV A;  1NPI A;  4CJF A;  4DUZ K;  1K8B A;  1N36 K;  3NF9 A;  4FK2 A;  3M8R A;  4W5Q A;  3U8X A;  3WNF A;  4ZTF A;  2YC1 C;  4BRH A;  3K2P A;  2AA4 A;  4DWI A;  3MEG A;  3OA9 A;  3SF4 D;  4CJT A;  3KWI A;  1RDA A;  1FXX A;  1JKZ A;  2JWK A;  4OKE A;  1YVU A;  5C12 A;  1IBL K;  1EX4 A;  4M3X A;  1EET A;  3N4P A;  4L3Q A;  3O9Q A;  4I2Q A;  1T05 A;  1SN4 A;  4DF4 A;  4JLH A;  4FLU A;  4B9S A;  2YV0 X;  3DRP A;  3OYG A;  2LR3 A;  2IIR A;  5HBM A;  1L5U A;  3AA2 A;  1XUP O;  5HRP A;  2LJM A;  3HSC A;  3TPQ A;  3MEC A;  1C0T A;  4BDY A;  4H0P A;  2YNH A;  1HNI A;  4FLZ A;  5TKY A;  4BQL A;  2PYL A;  1NGG A;  4A2A A;  1X1P A;  3FGU A; 
#chains in the Genus database with same CATH homology
 3L4I A;  3LDO A;  5BN8 A;  2ZGZ A;  4JKG B;  4IJA A;  1VQM N;  4MO4 A;  5AQF A;  2QWO A;  3ENH A;  2QWN A;  5C2D A;  3D2F B;  3SAF A;  4CZJ A;  4O8K A;  4U67 L;  3QBW A;  3A5O C;  4A5B A;  5AQS A;  5EVZ A;  1CZA N;  2P9U A;  4GV3 A;  4BRE A;  2P9S A;  1GLA G;  2VGM A;  3ULE B;  3VEN A;  3AGR A;  4RTF D;  4CZM A;  4PKG A;  2FXU A;  3HRG A;  2E20 A;  2YX6 A;  3CJC A;  2NRW A;  3R3L A;  4O5F A;  4FO0 A;  3SAG A;  4JHD A;  2W40 A;  3QFU A;  3MDQ A;  1G99 A;  1NMD A;  3I55 N;  4UAE F;  1QVF M;  4CZH A;  4QS7 A;  3O1B A;  2P9K B;  2F9W A;  2BTF A;  2QM1 A;  3SLC A;  4IJN A;  4FSV A;  3RVC A;  3TTD A;  2RE2 A;  2YI1 A;  1VQ5 N;  3GG4 A;  3BUZ B;  1K8K B;  3CET A;  5M1P A;  1NJI O;  3WQU A;  5KPT A;  1X3N A;  2Q97 A;  5JLH A;  3GDQ A;  4JKG A;  2QWR A;  5H1S Q;  3HM8 A;  5JLF A;  5DM6 L;  2Q1N A;  4MDA A;  3D2F A;  2ASP A;  3DJC A;  2Q36 A;  3CC4 N;  4NLB A;  3VTH A;  3LDQ A;  4CBW A;  3CD6 N;  3BP8 A;  4M7X A;  2A6A A;  3ID8 A;  4Y0W A;  4KH4 A;  4BR9 A;  3WUH A;  3O6W A;  5AZI A;  3E9O A;  5AQJ A;  2V7Z A;  1Z05 A;  4WQ4 C;  3ULE A;  2P9I B;  5GAD P;  3OW2 M;  3VEY A;  5CHI A;  4JEP A;  2E8A A;  4U7B A;  1ZBS A;  5LJV A;  5JVG L;  5KQD A;  3EN9 A;  4H0V B;  1SAZ A;  1JCE A;  3IDH A;  2BH1 A;  2E2O A;  2GTD A;  4JN4 A;  1LOT B;  2OAN A;  2P9K A;  3KWG A;  4MLE A;  4BVP A;  3CCJ N;  4WFA L;  1QVG M;  5AQV A;  4MLH A;  4FWL A;  2ITM A;  2GEL A;  1K8K A;  1YI2 N;  3CIP A;  4CI6 A;  2I7N A;  3MCP A;  2IVO A;  3F5T A;  1VQ8 N;  5LJW A;  3SMS A;  3ZET B;  4EIA A;  3C7N A;  5AQT A;  1MWK A;  2NRZ A;  4UY8 O;  4IO9 L;  1YJW N;  5BR9 A;  5FPN A;  4WFN L;  3U9D A;  1ESV A;  3EL2 A;  4JAX A;  2OTJ N;  3L4Q A;  3M5R A;  1U6Z A;  1DKG D;  1GLD G;  1S22 A;  4K42 A;  5AQR A;  2JWL A;  1C0G A;  1RFQ A;  3DLL L;  3TTC A;  2OTL N;  3EE8 A;  3CMA N;  4BC4 A;  2E2F A;  4JKC A;  4JKE A;  3ATU A;  2D0P A;  2BUP A;  4ISE A;  3VGM A;  1Y64 A;  3GL1 A;  3E9L A;  1HKG A;  3CPE A;  4CZE A;  3VEW A;  4IOX A;  2NRV A;  4BQZ A;  2RHK A;  1E4F T;  1T3V A;  1U2V B;  4K41 A;  4G9Z A;  1S3X A;  1NGJ A;  5FPM A;  3CC7 N;  1QQM A;  2QWP A;  4A2B A;  3HBT A;  1NGE A;  2WC9 A;  4ISG A;  4PHT X;  4I6M B;  2FF6 A;  5MLC Q;  3ZET A;  3NMU A;  1BG3 A;  5CR4 A;  3H6E A;  4WQ5 C;  1ATR A;  4XEI A;  1KAZ A;  2Q31 A;  1K9M O;  2JDQ D;  1NGC A;  4GY2 B;  2QWM A;  5FPE A;  1BA0 A;  3CQY A;  3SK3 A;  4WQ4 A;  4BG9 A;  2VGN A;  4JKA A;  3OBW A;  3EE9 A;  4ILJ A;  3JXU A;  3P4I A;  1KAY A;  4PKH A;  3QFP A;  2NRH A;  2NZT A;  3H45 C;  4B1Z A;  3ZX2 A;  2LN8 A;  2PBD A;  4HWI A;  4YOY A;  3CXC M;  4GVE A;  2FF3 B;  1NGA A;  5AQW A;  5BPL A;  3MN6 A;  4M7Y A;  3P31 A;  4BR0 A;  3UKR B;  1RDU A;  4FWP A;  4IXC A;  3HOS A;  3E1Y A;  3M3Z A;  4RCH A;  3WXL A;  3QML A;  2ASO A;  4H5T A;  2ZF5 O;  5BRE A;  3H3O B;  2VYP A;  1QZ6 A;  3MX2 A;  4JKB A;  4M63 C;  3SMP A;  4I6M A;  4OPA A;  5F0X A;  5F2R A;  1LCU A;  2VY6 A;  1V4T A;  3M6G A;  3ZX3 A;  2E1Y A;  3H1Q A;  5AQO A;  3EO3 A;  4BR7 A;  1YHQ N;  3AGK A;  4FWM A;  4RWT A;  5EXW A;  3WXM B;  2WFB A;  4BRQ A;  3VER A;  4A5A A;  3VOV A;  1NWK A;  2DPN A;  2GMO A;  1Q86 O;  4IZ9 A;  3BF3 A;  2YHY A;  1QQN A;  5KPZ A;  3CPW M;  4IWV A;  1KD1 O;  4DHY A;  2A3Z A;  2GEM A;  2QXL A;  4A61 A;  1HLU A;  4UAD E;  4NO7 A;  4DQ8 A;  1ZXO A;  2D0O A;  2HBM A;  4BRL A;  2D56 A;  3G71 N;  2GUP A;  4BGA A;  3OHR A;  3EZW A;  3NVK A;  2NRT A;  3DAW A;  3FLC O;  4C23 A;  1VQ9 N;  1BO5 O;  3UKR A;  5ADX H;  1Q81 O;  3I56 N;  2GWJ A;  3AY9 A;  3FZK A;  3O8M A;  1OVY A;  3GBT A;  1JCF A;  2Q0R A;  5JIC A;  3M1F A;  1K8A O;  3ENO A;  3FZM A;  1HJO A;  5HL7 L;  4H5W A;  2CGK A;  4BE7 B;  2W00 A;  3UB5 A;  1DT9 A;  1V4S A;  1KQS M;  3KHW A;  1SQK A;  2HF4 A;  4B1Y B;  5C2F A;  3MWT A;  1J6Z A;  3LDL A;  4IOC L;  4FL9 A;  1JCG A;  1RGI A;  3U4L A;  3VF4 A;  2FSK A;  1NGH A;  5AQZ A;  4BRA A;  5ADX A;  2YCH A;  5M1K A;  3T7Z A;  4C1N I;  3VF2 A;  3VPZ A;  1VQL N;  5GIP A;  3UE5 A;  1QHA A;  3MN9 A;  2CGL A;  3L6Q A;  3W0L A;  4BVO A;  2YIL A;  1SS6 A;  4BR2 A;  3MWP A;  4FWR A;  3MMV A;  1HX1 A;  1T6D A;  3JS6 A;  3VET A;  3CCR N;  1M1K O;  2E2Q A;  1EO1 A;  3N4Q A;  5M1O A;  3WXI A;  4H5V A;  3WXK A;  4WF9 L;  3SAH A;  3A0I X;  3ATV A;  1O13 A;  3KC6 A;  4JKD A;  2MBK A;  2QA4 N;  3ID6 A;  3VEO A;  4E1J A;  3K9K A;  1SZ2 A;  3LM2 A;  2QW9 A;  1BU6 O;  3FE1 A;  4AF1 A;  4CBX A;  1YUW A;  3CQX A;  3O5B A;  3S41 A;  4B1V A;  2CH6 A;  3SBT A;  3CCE N;  2CGJ A;  4FVU A;  4HTL A;  2ZJR L;  1HKC A;  1RDW X;  4FWO A;  5AQQ A;  2E2N A;  3LL3 A;  4BRF A;  3SBG A;  3HI0 A;  3A8Y A;  3VEZ A;  4WFB L;  4AM7 A;  4ISF A;  1MWM A;  2P9I A;  3CI5 A;  5CE3 A;  3J8A A;  4NB4 A;  3DWL A;  1D4X A;  3Q7B A;  4JNE A;  2QEX N;  3I33 A;  3VES A;  2VWB A;  2YHW A;  4FPB A;  4LC9 B;  4QS8 A;  3ZX0 A;  2WBN A;  4A57 A;  3Q7C A;  3R1X A;  4IFE A;  1YJN N;  1TUU A;  5AR0 A;  2IVP A;  1Z6R A;  1T6C A;  1Q18 A;  4B1U B;  3O4W A;  3H1V X;  4KH6 A;  3CCU N;  2Q0U A;  3CCS N;  5E84 A;  2NRR A;  3CCV N;  2NLX A;  3HZ6 A;  2F7T A;  2K35 A;  1YAG A;  4BC5 A;  2J4R A;  3R8E A;  4JKF A;  1HUX A;  4BRD A;  5AQK A;  2C1G A;  4FWN A;  4BRK A;  1K73 O;  3DXK B;  1KC8 O;  1TYQ B;  1YXQ A;  3AAP A;  3QI7 A;  3TSQ A;  3OBY A;  4JK9 A;  5C10 A;  2AP1 A;  4KH5 A;  4DCH A;  4PL7 A;  2QWL A;  3O9R A;  5AQG A;  3TSU A;  3O9U A;  2E2P A;  3CCQ N;  2HBK A;  5EOY A;  3IFR A;  1X9J A;  3D2E B;  3EKS A;  4BEC A;  5ELZ A;  4BRO A;  4BEB A;  3BK3 C;  3L0Q A;  5C0Y A;  4CZG A;  4B1X B;  3AAQ A;  3FFK B;  3CJA A;  4J8F A;  3E66 A;  4DKW A;  2EWS A;  4BY9 C;  3KZB A;  3FZL A;  4XJX A;  4KBO A;  5TKW A;  2V51 B;  4UAF E;  3F9M A;  2YJE A;  4JK8 A;  4A59 A;  3ZEU B;  3HOT A;  1HKB A;  4H0T B;  4BR5 A;  3U9Z A;  4FWS A;  3G25 A;  3ZYY X;  4H0O A;  4CZF A;  3IKM A;  5AQN A;  4FWQ A;  4QS9 A;  1U2V A;  2WUS A;  3CJ1 A;  4XH5 A;  4JKH A;  2QTD A;  2HBL A;  1BOT O;  4AM6 A;  4BRG A;  5AQU A;  3IMX A;  4CZL A;  5AQX A;  5C15 A;  3DXK A;  2P9N B;  2V52 B;  3LM9 A;  3O9S A;  1XC3 A;  4DB3 A;  3C65 A;  2HOE A;  3P38 A;  4ILH A;  2H3G X;  4EHT A;  3QIC A;  4PL8 A;  2A41 A;  2HMP A;  4YOV A;  3CJB A;  3VGL A;  3MCA B;  4R79 A;  3P39 A;  3HTV A;  3PLA A;  3D2E A;  4GV9 A;  2MN5 A;  1YIJ N;  1ATS A;  1NGB A;  2NNW A;  3WXJ A;  2CH5 A;  3R9P A;  1S72 N;  4WCE L;  1NGI A;  1YF5 L;  2I7P A;  1VQ4 N;  3PIO L;  1VQK N;  1VQ6 N;  5F1X A;  3BEX A;  4GV6 A;  3E9P A;  2YJF A;  2ZJQ L;  3ZEU A;  4C1N K;  5GIO A;  2Q2R A;  3D6R A;  4H5R A;  3C6A A;  3EKU A;  4ILG B;  4IEI A;  3TTF A;  1VQ7 N;  1EQY A;  3CCL N;  4A62 A;  5BRF A;  1R59 O;  5AZI B;  1VAZ A;  1NBW A;  5JMV A;  4H0X B;  3A5N C;  2P9N A;  5FPD A;  4BC3 A;  4EHU A;  3QDK A;  4YOW A;  4YDU C;  1BWF O;  4WQ5 A;  2D1K A;  3GOI A;  3G4S N;  1C0F A;  2P9L B;  1BDG A;  3KHY A;  3KVG A;  4H0Y B;  3T69 A;  3VEX A;  4B9Q A;  4O8U A;  2PAV A;  3UKU B;  1ILY A;  1KXP A;  4IEE A;  3WEE B;  3MN5 A;  5AQM A;  4H5N A;  3A5M C;  3K9J A;  2FSN A;  4JK7 A;  4CD3 A;  1NM1 A;  4FOI A;  2YIO A;  3VEV A;  5EX5 A;  2ZWH A;  2QI2 A;  3G6E N;  2A5X A;  3O08 A;  2ASM A;  3TSP A;  1ZC6 A;  4BG8 A;  4WYB A;  3A5L C;  4OO1 J;  1HPM A;  3C7N B;  4YOX A;  1OKJ A;  1Q7Y O;  2IVN A;  2ZJP L;  5AQY A;  5AQL A;  3DXM B;  4MDB A;  1GLJ O;  4FPA A;  5E26 A;  4CZK A;  5DM7 L;  5GAE P;  1Q82 O;  5LY3 A;  3LDN A;  3PIP L;  1N8R O;  5I9E B;  4IO8 A;  3MK6 A;  1DEJ A;  2HF3 A;  3I8B A;  4GNI A;  5GIN A;  2FSJ A;  4OPH A;  3CME N;  1WOQ A;  4XH1 A;  4B1W B;  3W3D A;  5JVH L;  1E4G T;  1XQS C;  5M1Q A;  3WT0 A;  3FR0 A;  2P9L A;  4FOE A;  4BGB A;  4CJ7 A;  4Z94 A;  1NGD A;  4IDH A;  1ATN A;  5AZJ B;  3UKU A;  2QWQ A;  3CHW A;  2NRX A;  1BUP A;  3FZH A;  1MA9 B;  3F2K A;  3CC2 N;  3WEE A;  1H1V A;  1QZ5 A;  3CJ9 A;  4BR4 A;  3O80 A;  1QQO A;  2KKZ A;  3VF6 A;  1MDU B;  4EFH A;  5GAG P;  5GAH P;  4K43 A;  2A42 A;  5BPM A;  5B8H A;  1KAX A;  4PKI A;  3D7E O;  5AFU H;  4YOR A;  4BRI A;  4BRP A;  2C1I A;  2PFU A;  2YHX A;  4IOA L;  1TUY A;  1JJ2 M;  3B8A X;  4XH4 A;  4F9O A;  2V7Y A;  3DXM A;  1DGK N;  3ENB A;  3L56 A;  2KLA A;  3QBX A;  4JD2 B;  3SJH A;  5AQP A;  4EAH D;  1VQO N;  2A40 A;  3VGK A;  2HBJ A;  5KQ8 A;  2VCP A;  1P90 A;  3RSE B;  4BRM A;  1T44 A;  3WQT A;  3VMF B;  5M1N A;  1NLV A;  2P9P B;  1GLE G;  3KK7 A;  3VTI A;  2FLO A;  3BF1 A;  5M1F A;  4YOU A;  1M90 O;  5AFU A;  4NLC A;  3IUC A;  5BN9 A;  3MX5 A;  5AQI A;  4YDU A;  3CCM N;  4YOT A;  4BRN A;  3R2V A;  3O1W A;  5AZJ A;  3U8X A;  1WUA A;  3H3N O;  3AAR A;  3LDP A;  3O9T A;  2E1Z A;  1YVN A;  1VQN N;  2ZGY A;  4BRH A;  2AA4 A;  3CW4 A;  2HST A;  3OA9 A;  1P8Z A;  3SF4 D;  3QB0 A;  5BRD A;  3KWI A;  1YIT N;  1BA1 A;  2JWK A;  2D4W A;  3FZF A;  4MO5 A;  4H03 B;  3CER A;  2YIP A;  2UYT A;  5C12 A;  4CD1 A;  4JD2 A;  2W41 A;  3R6M A;  3C0B A;  1X3M A;  2P9U B;  3N4P A;  3RSE A;  4L3Q A;  3O9Q A;  4CZI A;  3C6H A;  2F9T A;  2P9S B;  3CJ7 A;  3CF5 L;  2P9P A;  1NGF A;  1IG8 A;  1W97 L;  1TYQ A;  5BPN A;  2IIR A;  1POI A;  2KHO A;  1YJ9 N;  3MN7 A;  1IJJ A;  3J7Z O;  1GLL O;  3H46 O;  1XUP O;  2E88 A;  1GLC G;  4JHD B;  3HSC A;  4CBU A;  3TPQ A;  1VQP N;  5HOO A;  4BC2 A;  5KPR A;  4H0P A;  5BRH A;  4FWK A;  5TKY A;  4BQL A;  4BRC A;  3TU5 A;  3GE1 A;  5EY4 A;  1NGG A;  2GX9 A;  4A2A A;  1GLB G;  4K25 A;  5AQH A;  1W2B M;  3NVM A;  3FGU A;  1GLF O;  2GWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...