3GL1A

Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
383
Chain Sequence
AEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Heat shock protein SSB1
publication title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
total genus 124
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3gl1A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3gl1A04
2ZGYA 2W41A 3MCPA 3JS6A 5FPMA 3BUZB 1ATSA 4H5TA 3G25A 4H0VB 3AY9A 2V52B 4AM6A 4A61A 4IWVA 4XH5A 1HKBA 1QQOA 3BEXA 4BR4A 2FSKA 3EO3A 3L0QA 4BC5A 3KZBA 4H0XB 3LDLA 4GNIA 3D7EO 3SJHA 4BRFA 5AQKA 1YAGA 2NLXA 3ULEA 2V7ZA 4WQ5A 3ZETA 5AQHA 3H45C 3VENA 2P9IB 1BOTO 2H3GX 1HPMA 4BRNA 1BDGA 1RDWX 3H3NO 2QWLA 1RGIA 5F0XA 2Q97A 3H46O 3O1WA 2QWMA 2YHXA 4FPAA 1K8KA 1TUUA 3B8AX 3EKUA 1WOQA 3W0LA 2VCPA 3LDQA 4B1WB 3VGMA 3WT0A 3DXMA 3VGKA 2HF4A 3VPZA 4IJNA 3ATVA 1NGAA 4BRGA 3H3OB 2QWNA 4FWNA 2V7YA 4WQ4A 3ZX3A 3UKUB 2E1ZA 2QWRA 5FPEA 1QHAA 1XUPO 1T44A 2QXLA 4CZKA 2A5XA 5AQOA 2YJFA 3BF1A 4H0OA 1NWKA 5BPNA 5AQMA 1ZC6A 2E2OA 3FZMA 2PAVA 3HZ6A 4K43A 4O8KA 4QS7A 2ITMA 1X3NA 1NGDA 2VWBA 3IMXA 5E84A 1GLLO 2AP1A 1RFQA 2KHOA 5I9EB 1MWKA 2D0PA 2YCHA 3FZHA 4B1UB 3MN7A 2QM1A 3VEYA 2AA4A 4FSVA 4FOEA 5AQYA 3CJAA 3O6WA 3RSEB 3CETA 4GY2B 4H5WA 3EKSA 1NGGA 3QMLA 2FSJA 3D2FA 1H1VA 3FFKB 4IJAA 3CJBA 3WXIA 2FSNA 1YUWA 2P9SA 1KAXA 3SMSA 1Z05A 3FLCO 3SK3A 4ISGA 1LOTB 1NBWA 4M7XA 4PL7A 4B9QA 4BQZA 2F9WA 2P9PB 4XEIA 1BA0A 2CGLA 3ZEUA 4CBXA 2A41A 3CJ7A 4HTLA 4BRPA 3CJ1A 3WXJA 3FGUA 3O4WA 4B1YB 4K25A 3SLCA 1U6ZA 4BRHA 5ELZA 2I7PA 5AFUH 5EY4A 3EN9A 3I8BA 5AQWA 2QWQA 2ASOA 3MDQA 3BF3A 2IVOA 3CERA 3UE5A 4Z94A 2YJEA 4Y0WA 4AM7A 4YDUA 4PKGA 1E4GT 1SQKA 5TKYA 3ZX0A 5LY3A 3CI5A 1U2VB 2Q0UA 4FWLA 4JD2B 4PL8A 2HMPA 4WQ4C 4BGBA 3M6GA 5AQJA 5AQXA 1LCUA 1NM1A 1V4SA 2YHWA 3ID8A 1HX1A 4B1VA 4BVOA 2P9IA 3VEZA 5ADXH 1E4FT 4BREA 1HLUA 2ZWHA 4BC2A 3FR0A 4I6MA 3CQXA 4CZLA 4DCHA 3FZLA 5AQQA 5B8HA 4BR7A 5FPNA 4IZ9A 2A40A 5LJVA 3CJ9A 1WUAA 2P9KA 4EFHA 3DXKA 5EX5A 2Q0RA 5LJWA 3DAWA 1ESVA 1SAZA 3O5BA 4IXCA 5EOYA 3U9DA 4RCHA 2DPNA 3LDNA 3GBTA 4B1ZA 2YI1A 1X9JA 3EZWA 2NRHA 4L3QA 5AQFA 3WXLA 1BO5O 5EXWA 3D2EB 4BRIA 2FXUA 5AQLA 1SZ2A 1T6CA 4MO4A 4QS9A 3UKRA 3HBTA 2GTDA 1TYQA 1QZ5A 1T6DA 3MN9A 3GDQA 3VF6A 2Q1NA 5AQTA 5BPLA 3AAQA 4A2AA 4EAHD 3O8MA 2E88A 4JN4A 3HM8A 2YHYA 4MLEA 2QW9A 5EVZA 2GELA 2VYPA 3CHWA 3CQYA 4MLHA 2P9LB 1XQSC 5AZIA 3R9PA 5JICA 1JCGA 4BG8A 5KQ8A 2GWJA 4BRMA 3GOIA 4BC3A 3QFUA 4K41A 3SMPA 2P9NB 4LC9B 2J4RA 2QWOA 3DWLA 4YDUC 5AQUA 2P9PA 5AQPA 4FWSA 1BA1A 4PKHA 4H0YB 3LDPA 3ULEB 3QFPA 4FWQA 3KVGA 4DQ8A 4XH4A 4O5FA 3DJCA 4A2BA 1NGBA 1NMDA 1J6ZA 3MN5A 2FLOA 2P9UA 4K42A 3H1QA 3VOVA 3I33A 1C0FA 5AZJB 4BR2A 3FZFA 3A0IX 5F1XA 3M3ZA 4BRLA 2IVPA 2W40A 5BN8A 3LM2A 4FWRA 4BRQA 5BREA 1MWMA 3HSCA 4BR9A 3A8YA 3IUCA 3MMVA 4BGAA 4FOIA 4C23A 3L6QA 5KPZA 5KPTA 3H1VX 2A3ZA 2E2PA 3ATUA 4JHDB 2CH6A 1ZBSA 4E1JA 4BQLA 2E2QA 4ISEA 5F2RA 3C7NB 5AQVA 3VF4A 1ATRA 2HOEA 2D0OA 1R59O 3GE1A 3WQTA 4M63C 3A5OC 2Q2RA 4CZGA 1MA9B 2FF3B 3ENOA 5JMVA 3U4LA 4CZJA 4CD1A 1GLBG 1Q18A 2BTFA 4EHUA 4EIAA 1JCFA 1BUPA 1CZAN 1QQMA 2D1KA 4F9OA 1IJJA 2CGJA 1KAZA 4BC4A 3UB5A 1NGCA 3P4IA 2CH5A 3VGLA 3GL1A 2P9LA 3UKUA 3M1FA 3ZEUB 3CJCA 5AQRA 1NGHA 3QBWA 3QDKA 3VEVA 3QICA 3A5NC 4BRKA 5AQIA 3LM9A 2ZF5O 3U9ZA 3WEEB 4CI6A 2P9NA 4KBOA 1ZXOA 1YXQA 4MO5A 2E20A 4CZEA 1XC3A 3JXUA 3WXKA 3L4IA 4JNEA 3S41A 1D4XA 4DHYA 4RTFD 3A5MC 1QQNA 3KHYA 4RWTA 3CIPA 4DB3A 1OKJA 3O1BA 2A6AA 5AFUA 3A5LC 5FPDA 4FWPA 2GUPA 2ZGZA 5KQDA 5BRHA 1QZ6A 5JLFA 3VETA 5BPMA 1GLFO 3LL3A 4CZIA 4JAXA 4XH1A 3RSEA 5AZJA 3IFRA 1KAYA 4BR0A 3AARA 3F9MA 1YVNA 4I6MB 5BR9A 5AQZA 2BUPA 1JCEA 2E1YA 2HF3A 4WYBA 1HUXA 5AR0A 1G99A 1C0GA 3U8XA 1GLAG 5ADXA 3FE1A 3VEOA 2IIRA 2EWSA 5CE3A 3OHRA 5E26A 3MK6A 4CD3A 5AQSA 2D4WA 3HTVA 2E8AA 4CZMA 2P9KB 1S3XA 3DXKB 3ZETB 3ZX2A 1BU6O 1IG8A 2E2NA 4JHDA 1MDUB 4H03B 4H0TB 2QWPA 4ISFA 3VESA 1NGIA 2GEMA 3QB0A 1GLDG 1X3MA 1Z6RA 2UYTA 3UKRB 3J8AA 3C7NA 4CZFA 4BRAA 3ENHA 1TYQB 2PBDA 3EL2A 3HI0A 2A42A 1K8KB 1U2VA 5JLHA 3VEXA 4FPBA 4BRDA 4JD2A 2V51B 3MN6A 4PKIA 4B1XB 3DXMB 1EQYA 4BG9A 1NGFA 3R6MA 1NGEA 4FO0A 4CBUA 3VF2A 1DKGD 1HJOA 2ASMA 3QBXA 5AZIB 3BP8A 2GWKA 4EHTA 3AAPA 2CGKA 4H5VA 3IDHA 4BR5A 1BWFO 4FWMA 1HKGA 3O08A 4QS8A 4CZHA 4M7YA 3FZKA 2FF6A 4H5NA 2I7NA 3WQUA 3LDOA 2Q36A 4BROA 4H0PA 5BRDA 4WQ5C 2ASPA 1S22A 3C0BA 4BRCA 4NO7A 4NB4A 1DGKN 2F9TA 3O80A 4CBWA 3TPQA 3WEEA 1ATNA 3R8EA 3D2EA 4FL9A 2Q31A 1GLCG 1NLVA 3VERA 2P9UB 1V4TA 5AQGA 1HKCA 4BVPA 4A62A 1BG3A 1DEJA 5AQNA 2OANA 2NZTA 3D2FB 2WUSA 4CJ7A 1GLEG 1NGJA 2P9SB 1Y64A 4H5RA 1P8ZA 3H6EA 4J8FA 3GG4A 5BRFA 3W3DA 4HWIA 4FWKA 1KXPA 5KPRA 1GLJO 4IO8A 3TU5A 4FWOA 2IVNA 1TUYA 3WUHA 3VEWA 5BN9A
chains in the Genus database with same CATH superfamily
3SAHA 3BUZB 1ATSA 3AY9A 4W5OA 2NRWA 1QTMA 4IWVA 4XH5A 4JKGB 3CCJN 1QQOA 2ATQA 1J54A 2FSKA 4H8KA 5JVHL 3V9XA 1ITGA 4H0XB 3VQ5A 3HM9A 1N34K 4OGCA 3KLIA 1NRAA 3HXMA 2UUAK 2HHQA 4M3RA 4DSJA 2V7ZA 4DLEA 3ZETA 3OY9A 3VQQA 4CF0A 1IH7A 2UXDK 2EX3A 2Y1JA 3BY5A 1Y97A 4BE7B 5M1NA 4QOZB 1BCOA 2VGMA 4CEAA 1ZU3A 2N2QA 2QTDA 3DI6A 4HVJA 3O1WA 1Z26A 1OZZA 1RT4A 2YHXA 1TUUA 3C95A 4JKFA 3S3NA 4B1WB 3DXMA 3CYMA 2HF4A 2DFEA 5LL6Z 4N56A 3ATVA 2F4VK 4FLWA 3LALA 1RTJA 3THVA 3FFIA 4AHRA 1OH7A 4KRFA 3NF8A 5HBMA 2E1ZA 2RKIA 5J2MA 2QWRA 3CCVN 4IOCL 2QA4N 3PLAA 2YHBA 4Z4FA 1KV0A 2A5XA 4H0OA 5BPNA 4DV5K 3NFAA 3V1QA 4J2BA 1JXBA 4BE1A 1X3NA 2VWBA 2Z1IA 5E84A 1K73O 1GLLO 3QEVA 2AP1A 3DLRA 2WC9A 3RVCA 3E9LA 5EU7A 1CN2A 3KD1E 4CCHA 4DKWA 2GL1A 3L3UA 2YCHA 3FZHA 4B1UB 3MN7A 1X9MA 4FZZA 4FOEA 3NH1A 5AQYA 3SYZA 2OYQA 3BGRA 3TTCA 3RSEB 3CETA 3CMAN 2O8DB 4AILC 4A5BA 3D2FA 1H1VA 4LF5K 3LWLA 3WXIA 2FSNA 4N5SA 1RBRA 1RDCA 2I61A 1I6GA 2P9SA 4DSKA 2WBNA 3PSFA 3SK3A 1LOTB 5J2PA 5D3GA 1RCHA 4BQZA 1IV0A 4YOYA 3M5RA 2P9PB 4XEIA 1BA0A 3L2QA 2CGLA 2VY6A 3ZEUA 1RBVA 2HVIA 4JV5K 3T1YK 3CW4A 1X9WA 2LR3A 1HQEA 3THYB 1VSEA 2HHHK 3EN9A 2KTQA 3OTOK 4YOVA 5AQWA 2QWQA 2IVOA 4DU3A 4CJTA 4FJ5A 4E19A 3UE5A 4YDUA 5FDLA 1SQKA 3MEDA 1IG9A 5LY3A 2XY5A 3L2WA 1VSJA 4O55A 4WQ4C 3M6GA 2YHWA 1NM1A 3ID8A 1NK9A 3VEZA 3V81A 4BREA 2AJQA 5IT9O 2QXFA 1REVA 3CFOA 2D5RA 3ULDA 3V4IA 3SNNA 1TK0A 3OYKA 1S9EA 3PY8A 1E3MA 4Z4GA 2VQFK 1WSGA 1WNSA 2OPPA 2BDPA 5AQQA 1G15A 3OYAA 3L2RA 3RRGA 4W5QA 4OO1J 3MEEA 2ASCA 1WUAA 3G0ZA 1SAZA 4IXCA 3U9DA 3CYGA 3LDNA 1WAFA 4V19S 1ZBFA 4JI2K 3WXLA 3OJSA 2MBKA 3U3YA 5AQLA 3UKRA 1TAUA 2O8CB 4R79A 4IFVA 2BH1A 3PX4A 1LQIA 4M42A 2B5JA 4WFNL 3SCXA 4AHCA 4FW2A 1IKXA 2FBXA 3OYBA 4FLYA 4LF7K 4MLEA 2QW9A 1FKPA 1VQ7N 2VG6A 4ICLA 1K8AO 2NUBA 1AYJA 2P9LB 1XQSC 5AZIA 5JICA 1HNZK 3SUQA 4BC3A 3QETA 4YORA 1U4BA 4DV4K 2P5GA 3L4QA 1KRPA 1WAJA 1RBTA 1ZYWA 5C24A 1U04A 2RHKA 4AHVA 3P5JA 3K9JA 1LAVA 1SL0A 2BGGA 4CJUA 1J6ZA 2P9UA 4K42A 4OKJA 1A5XA 3I33A 3HL8A 3FZFA 4JKAA 4MFBA 4OPHA 2Z1JA 1N6QA 5M1OA 1P90A 1LQQA 1TL1A 4FWRA 3MXIA 5BREA 3C6TA 5KGXA 1W7AA 1XHXA 3A8YA 1VQ8N 1QSYA 1SN1A 4GMJB 3TSUA 3NH0A 1J5EK 4UADE 4FK0A 4DV6K 1EWRA 2JWLA 2X78A 4X64K 4NXNK 4JS4A 4HCBA 2RE2A 3DRPA 3SBTA 4JKBA 4JI8K 4LD0A 2F96A 2E2QA 5DM7L 3CC7N 4J2AA 3U6FA 3S3OA 5GADP 5F2RA 4NLBA 4CJPA 3BDPA 1ATRA 2Y1IA 1C0MA 2D0OA 3GE1A 3VN5A 4CF2A 5JENA 3A5OC 4OJRA 4YY3K 1DQ7A 3MXJA 5HP1A 4B3MK 4CEZA 4CZGA 3VQPA 1JXCA 4KHUA 3ENOA 1VQON 1OVQA 2IS3A 3O9SA 2BTFA 4OKKA 3AA3A 3THXA 3QI7A 1WWNA 3ZSWA 4JI1K 3KTQA 2E3GA 3NVMA 4LFCK 1BUPA 4IO9L 1L5UA 2KFNA 1QQMA 4F9OA 4I2QA 2CGJA 5IWAK 4BC4A 2C1GA 3G10A 3GL1A 1XRSB 4KTWA 1GOCA 1ICAA 3PV8A 5J1EA 3HPHA 4F2RA 3KLGA 2HHWA 1RBUA 2ZE2A 5HROA 5MLCQ 4FK2A 3VEVA 4O0IA 1NRBA 1JLGA 3NF9A 2D0CA 4CI6A 5FROA 3VA3A 1ZXOA 3SV4A 3NE6A 3E66A 4DHYA 1D4XA 1KCFA 1JLQA 4RTFD 3ZSZA 4IDHA 3RTVA 4KH5A 4DB3A 1OKJA 1BK8A 2A6AA 5AFUA 1O1WA 1WT7A 2GUPA 1WLJA 2ZGZA 5KQDA 2KKZA 4KKOA 1VSLA 3OJUA 1N36K 3VETA 1L3VA 4CZIA 3RSEA 4YOWA 3NMUA 3D45A 1YJNN 4I6MB 5BR9A 4KHWA 5AR0A 1C0GA 1JLEA 2VG7A 1U47A 1GLAG 5ADXA 4FJ8A 3E1YA 3QO9A 4UQGA 5E26A 3OYJA 1NKEA 4DQIA 3O4NA 1SL2A 3TTFA 2P9KB 4I9LA 2VWJA 3THYA 1VK0A 3ZETB 3ZT0A 4BDYA 2JGUA 1IG8A 4JHDA 1RTHA 1MDUB 4BECA 4H03B 1VSKA 4ISFA 3VESA 1RT3A 3ITHA 2KBJA 3LPTA 1GLDG 2A1SA 1VQ5N 3J8AA 4KHNA 5J2QA 5C42A 1XI1A 3CMEN 1TYQB 2UXCK 4DS5A 3PO5A 2LSNA 4I7FA 5CYMA 5JLHA 4IEEA 4DV1K 2V51B 4PKIA 3DXMB 4DG1A 3DYAA 1NGEA 4CBUA 1LAWA 5GIOA 3IKMA 4Y1CA 2IOCA 4HCCA 3TARA 3NF7A 4BR5A 3IDHA 1BMRA 1BWFO 1HYVA 2EHGA 4CZHA 4M7YA 2F8SA 4FJHA 1D9DA 4BWMA 4H0PA 1W2BM 2YNHA 3O9UA 4DF4A 1S22A 2KBKA 4CJVA 3T7ZA 3C0BA 4E7IA 4NB4A 3O80A 4W5RA 4IG3A 4CK2A 4HTUA 3TPQA 3WEEA 4LF6K 3O3FA 2Q31A 5J2NA 1XMOK 1NLVA 3VERA 1KQSM 1S9GA 5HRRA 4JI6K 4BVPA 4A62A 1BG3A 1YJWN 5CZ2A 3HYFA 1T1TA 1DEJA 4FJJA 5AQNA 4JYAK 3D2FB 2E0HA 5AJ3K 1NGJA 2P9SB 3H6EA 3GG4A 2MZ0A 4HWIA 4FWKA 5BR8K 3AA2A 3NHGA 5KPRA 1GLJO 2IVNA 4HUGA 2UUCK 3QESA 2W41A 3ZSYA 4PY5A 3MCPA 4CJLA 5SWMA 5FPMA 1BQMA 3HPGA 4H0VB 4OX9K 1EETA 1L3TA 4K8XA 3HT3A 1S1TA 2LJ7A 4BR4A 3PSIA 5TKWA 3ZCMA 3AVBA 3D7EO 1P0AA 4BWJA 1LQHA 5C25A 3H45C 2LI7A 3VENA 3AVJA 3JSMA 3IG1A 3RMAA 4BRNA 4LFBK 1RDWX 5KTQA 3H3NO 4IOAL 1RGIA 2Q97A 3H46O 4CGHA 2QWMA 3EKUA 3B8AX 3VTIA 3SUNA 3W0LA 1C55A 2OPQA 4I2PA 4ILHA 1NJXA 4IJNA 2RF2A 3L2UA 1SL1A 2G8HA 4M3WA 4OVLA 4RG8A 4CHZA 4O4GA 1ZVGA 2X6SA 3OYNA 5FPEA 1XUPO 2C1IA 2QXLA 3I56N 5AQOA 3BF1A 5HRSA 1NWKA 3IAYA 1HYSA 2PAVA 4O8KA 4QS7A 3J81O 3IMXA 4R5PA 2UXBK 1KVAA 1RFQA 3PSMA 3MWPA 5I9EB 1MWKA 2ZD1A 4GVEA 5KGWA 1DTQA 1D5AA 3MAQA 4IG0A 1WSEA 4GW6A 3CJAA 4LF4K 1W9HA 3SBGA 1NK5A 2KBHA 4DFKA 4DSIA 1NGGA 3FFKB 1N4NA 4DS4A 1YUWA 3L56A 2N2RA 1Z05A 4X65K 3K5OA 1YJ9N 4M7XA 3CCUN 3HK2A 4CESA 1M90O 2F9WA 4W5NA 4CBXA 2A41A 4JKHA 1Q9YA 2LY5A 3OYLA 3CJ7A 4HTLA 5M1KA 4BRPA 4M3XA 3WXJA 3FGUA 3O4WA 3WNEA 3NH2A 4K25A 4CIGA 1BCMA 1U6ZA 2I7PA 4DR2K 1VQNN 3PO4A 4DLGA 4JI4K 1JLBA 3AVHA 5GAEP 2QK9A 3AVNA 4NXMK 3J80O 4Z94A 1CLQA 2QEXN 3CCQN 4AM7A 1RDBA 2KGQA 1E4GT 4CJKA 3CG7A 1NKBA 2E5LK 3OW2M 4FWLA 2KJAA 1UA1A 4WFAL 1HRHA 4L8RB 3HRGA 1LCUA 1WSIA 1IKWA 4BVOA 1HX1A 4BACA 1HLUA 4BC2A 4V1DC 1JZAA 1VRUA 4CGFA 4KPYA 4I6MA 1KSPA 3CQXA 4B8AB 2E6MA 3FZLA 4PUOA 2PY5A 2G2KA 4BR7A 4IZ9A 2A40A 2D0AA 5GINA 4JRQA 3TAFA 2XY6A 3TAEA 2P9KA 3SPYA 4JS5A 3DAWA 1ESVA 4RCHA 4OPKA 3NGYA 4B1ZA 2O4GA 3DM2A 5M1FA 4L3QA 3K57A 3KP1A 3C94A 1T6CA 4QAGA 3NF6A 4MO4A 3HBTA 3THXB 1LWFA 1TYQA 3MN9A 3GDQA 1YITN 2Q1NA 4KYPA 2I5JA 4FJKA 4B3TK 5DK5A 5C15A 3JAMO 1Z25A 4GV6A 2GX9A 3AO2A 2YHYA 2GELA 2VYPA 3QEWA 3DMJA 3V9WA 4E7HA 4FZYA 2HHVA 2YC1C 1C0TA 4HUEA 3R1XA 3RMBA 1PX9A 4BRMA 5GAGP 3QFUA 4B9LA 3SMPA 4M45A 2ZJRL 4KAZA 2QWOA 2B3CA 3DWLA 3CCLN 5AQUA 4KFBA 5GAHP 4E1NA 4YOUA 5AQPA 4CHOA 4FWSA 1JZBA 1BA1A 3HP6A 4YOXA 4XIUA 4DQ8A 2HMIA 4O5FA 3DJCA 1XNRK 3R3LA 4A2BA 1DJTA 3MN5A 1HYZA 2P51A 4ILGB 1T0ZA 2ZJPL 1VSHA 1GOAA 2G8UA 3A0IX 1YT3A 3M3ZA 1I2VA 3V1RA 3CC2N 2W40A 3LM2A 1NU0A 5JVGL 3SPZA 1WSJA 4BR9A 3J7AP 2DY4A 4TSXA 4DTRA 3MMVA 2HBLA 4BGAA 3AVGA 4FOIA 4DQRA 3K5MA 5FRMA 4DR1K 5KPZA 4CFBA 3G71N 4FVUA 4FCYA 3LANA 2IDOA 5KPTA 2A3ZA 3LZJA 4JHDB 4OGEA 3TAMA 2LKBA 1N33K 2D56A 4FM0A 5HRNA 4MDBA 3KLHA 3EY1A 3EYZA 1Q81O 2O8EB 2FC0A 1GPSA 5AQVA 3VF4A 4AHSA 3DRSA 1ASWA 1UA0A 1R59O 1VAZA 3CD6N 4M63C 1B9FA 3N4PA 1QSLA 1MA9B 4CEEA 5JMVA 3AVKA 4CE9A 1VHXA 3AVAA 1ASUA 4BY9C 1LW0A 1CZAN 4DV3K 4CEQA 3KOZA 1NOYA 3UB5A 3P4IA 1NOZA 3THWA 2HHXA 1RILA 3M1FA 1LV5A 3CJCA 5AQRA 4Z4CA 2BE2A 3DOLA 4WF9L 2XO7A 3T69A 2YILA 4FW1A 3MWTA 2O8BA 3KHWA 2ZF5O 3WEEB 3ZSRA 2E3FA 4ZTFA 4JNEA 4CERA 3S41A 3P83D 1R0AA 1RTDA 1QQNA 3KHYA 4X66K 4RWTA 3CIPA 4Q5VA 1CXQA 4ELVA 5HOOA 3O1BA 4DTJA 3A5LC 4FWPA 3OYFA 1VQKN 5BRHA 3CF5L 4DTUA 3C6HA 5C0YA 5BPMA 1GOBA 4JAXA 4XH1A 1KAYA 4BR0A 4PWDA 3AARA 1YVNA 4E7LA 1SKRA 4WYBA 4E3SA 1HUXA 1G99A 4C8MA 2YV0X 3JYTA 4UY8O 1I94K 3VEOA 2EWSA 4DTXA 2QKBA 1VRTA 4LY7A 3DLEA 3OVNA 4KHYA 3V9ZA 2D4WA 3DLGA 1YTUA 3DXKB 3E9OA 1NNEA 2E2NA 2RN2A 2X6NA 3AGKA 1NJYA 2GEMA 1RDUA 2P5OA 1KC8O 3BK3C 1X3MA 1Z6RA 2HBMA 4LFAK 4OLBA 4KHSA 1MR4A 1VQ4N 2PBDA 2M8BB 2YNFA 4AEIA 1C6VA 3HI0A 1VQLN 1C1BA 4FPBA 3MN6A 4B1XB 1NGFA 3LP2A 4KI4A 3VF2A 1UOCA 3R2VA 3DLKA 1X1PA 2HW3A 3BP8A 4OLAA 3AAPA 1SV5A 4KHQA 4HHFA 3MCAB 2OTLN 4FWMA 1HKGA 1C1AA 4JI0K 4CVNE 3FZKA 2NNWA 2I7NA 4E1MA 1CHZA 3WQUA 2OA8A 3P31A 3EE8A 3TABA 4BROA 1XC9A 2VWKA 3RR8A 4CIFA 4U7BA 2ASPA 4BRCA 4M3TA 1GPTA 2E4LA 4BDZA 1T7EA 4LH5A 3T3FA 4CHQA 2X74A 5AQGA 2PZSA 1HKCA 2G8FA 3OYDA 3GKUA 2KQ2A 1VSDA 1LW2A 1NK7A 2ZJQL 4OKEA 4HUFA 2G8IA 1YVUA 1Y64A 4J8FA 5BRFA 3W3DA 1KXPA 1Q8IA 1SKWA 5GIPA 4FWOA 2KZMA 1N5YA 3PX6A 4FLVA 3O9TA 5SZTA 4CEBA 4M3YA 3G25A 4H5TA 2V52B 2G8KA 4A61A 1U49A 1HKBA 4IFYA 1HPZA 4DTNA 3EO3A 3NBPA 3MXMA 1RNHA 3HJFA 3KIOA 4WCEL 3LDLA 4GNIA 2KW4A 3SJHA 2ZM6K 4BRFA 5AQKA 2NLXA 4JKDA 3I8DA 2XRIA 4J2EA 5AQHA 4LF8K 1BL3A 1NK6A 3OYCA 1VQ9N 2BRZA 1WB9A 1BOTO 2H3GX 1HPMA 3OBWA 3OS0A 1BDGA 4Z4HA 3S3MA 3LWMA 3K0SA 1BHLA 3K59A 2QWLA 1L3SA 3KD5E 4FPAA 1I3AA 1WOQA 3LDQA 3VGMA 3QEPA 1EKEA 3VGKA 3TAPA 2ETJA 3VPZA 1NGAA 4BRGA 3H3OB 1BRZA 2V7YA 2KLAA 5KRTA 4DR6K 1YIJN 4WQ4A 3ZX3A 4KO0A 3KKSA 4B08A 3UKUB 1XHZA 5A2QO 1ZBHA 4ID5A 1QHAA 1IBKK 1T44A 1QE1A 2OPRA 2YJFA 1TI5A 3HVRA 3TWHA 1HMVA 1IBLK 4CJRA 2O8EA 1XMQK 1S6QA 3HZ6A 2ITMA 3CCMN 1IO2A 3CCRN 3ID6A 3L3VA 4E72A 4UJ0A 4EP5A 1SN4A 2D0PA 1QVFM 2QM1A 4FJ9A 3VEYA 1HR0K 4FSVA 1O13A 2YEOA 4CFDA 1KTQA 2KZZA 4GY2B 4H5WA 3QMLA 4DR3K 2MN5A 4AAZA 1S1WA 4Z4IA 3K9KA 3J7YP 1D8YA 1POIA 4LF9K 3O3HA 1TV6A 2ATBA 4B9QA 4FLXA 3K2PA 4JI3K 3MX2A 2DFFA 4KH6A 1VSFA 3CPWM 1LWEA 4B1YB 1XNQK 1IKYA 4BRHA 1ZUTA 5ELZA 2YKNA 2NY8X 3I8BA 4CW7B 3KK2A 4N76A 2HNZA 3MDQA 1BI4B 3BF3A 2IGIA 1BIUA 2IAJA 3VQ9A 3CERA 4CJ5A 3VTHA 2WFBA 2YJEA 3VQ4A 5TKYA 3CI5A 4DSLA 1U2VB 2Q0UA 3LP3A 3WNGA 1OH5A 3PUFA 2W00A 5AQJA 5AQXA 2QI2A 1NJZA 1ASVA 4B1VA 3EZ5A 2P9IA 2ZWHA 1T7AA 3OYGA 4OPJA 1UGLA 2OPSA 2YNIA 4NCGA 4N47A 4RW7A 4CZLA 4X62K 1TK8A 4DCHA 4C8OA 2HVHA 3M8SA 3CC4N 1WN7A 3CM6A 5B8HA 1J9AA 4CEOA 3OBYA 1OVYA 3VQBA 4EFHA 4B3OA 3DXKA 2Q0RA 3AVLA 1PTXA 3O5BA 2DPNA 3RR7A 1N32K 1SKSA 2YI1A 2KYQA 5AQFA 4F8RA 1BO5O 3Q7BA 4BRIA 1TK5A 1JLAA 1SZ2A 4QS9A 2GTDA 4EZ9A 3DOKA 1S1VA 1JLCA 1QZ5A 1I6FA 3VF6A 5AQTA 1ZBIA 5BPLA 3AAQA 4A2AA 4DUYK 4EAHD 3HSTB 3O8MA 5JS1A 4JN4A 3HM8A 4LH4A 1WBBA 4A5AA 3SQ1A 2HBKA 3CHWA 3THWB 3CQYA 4MLHA 1K9MO 4WE1A 1Q86O 4B9TA 4DSFA 1VSMA 4Q0BA 3K58A 3OYMA 1TVRA 3TTDA 3HP9A 2WONA 2UUBK 4F2SA 3H08A 4PQUA 3MECA 2O8BB 1UAXA 3C6UA 3AO5A 4FLUA 2J4RA 4ILJA 3CFRA 2RPIA 5C2DA 4YDUC 1X9SA 4JI5K 1DT9A 4PKHA 4E7KA 4DF8A 3BZCA 3LDPA 3ULEB 2KSKA 1U45A 3QFPA 1HQUA 1MYNA 4XH4A 4XJXA 1JL2A 1K8BA 4CEFA 2HSTA 4KTZA 4CIEA 1Q7YO 4NCBA 4OPAA 4BR2A 1TKDA 4IOXA 3F5TA 4G9ZA 1RTIA 1AHOA 3D6RA 1PE4A 4BRLA 1RT7A 4DR4K 2IVPA 5BN8A 3KKRA 3E7UX 3A2FA 4RW9A 4BRQA 3KP0A 1S1UA 3QNNA 1MWMA 3PX0A 4CJ4A 2B6AA 3IUCA 4LSLA 3AO3A 3L6QA 1D9FA 3CM5A 3AVMA 3H1VX 2E2PA 3ATUA 1VSIA 4C1NI 5JS2A 4BQLA 4FJIA 4CGDA 3LAKA 3AA5X 2WTUA 2NRTA 2Z1GA 1HNWK 4AH9A 2HOEA 4M3UA 4FK4A 3WQTA 2HB5A 2Q2RA 4FLTA 3VQ7A 3QERA 4FJXA 1WBDA 1JL1A 4KTQA 2VG5A 3U4LA 3NCIA 4CD1A 1GLBG 1OH6A 4HHTA 1Q18A 4U67L 4EHUA 3TAQA 2IC3A 1IJJA 4CF9A 1KAZA 1M1KO 1QQCA 4BDPA 1NGCA 5DM6L 3K5NA 3UKUA 5CR4A 1NGHA 1T05A 3QDKA 1RDDA 3P39A 3VA0A 3A5NC 1CZ9A 5AQIA 2OCEA 1SUQA 3U9ZA 5KK4A 2P9NA 2GUIA 4KBOA 4CJWA 3P1GA 4MO5A 3C6AA 2E20A 2GV9A 1EO1A 3A5MC 3NDKA 3HO1A 1EP4A 5C10A 1NG9A 1SNBA 3L2VA 2PYJA 1B92A 3AVIA 4DSEA 4QCLA 1GLFO 5AZJA 5LMNK 2O8FA 3IFRA 3B6PA 4A59A 5AQZA 2E1YA 3SI6A 3ASMA 1LWCA 3EEQA 4GKJK 1T7BA 1WSFA 2IIRA 1YF5L 3OHRA 1KFSA 3ISNC 3L8BA 1S3XA 3ZYYX 2E2FA 2F8TA 1U48A 3ZX2A 5CHIA 1BU6O 4DQSA 4B9NA 2FBTA 3O9RA 2QWPA 1NGIA 1BI4A 5T7BA 3SAGA 3KK1A 1NH5A 3M8RA 3C7NA 2G8WA 4BRAA 3ENHA 2NRXA 4M41A 4CFAA 1U2VA 1S72N 4BRDA 4DWIA 4FJMA 2Z1HA 3SV3A 1EQYA 1KD1O 4JK7A 3AVCA 1DKGD 1HJOA 2ASMA 2ZQBA 1C0UA 3RMCA 4O8UA 3S5TA 3CCEN 4EHTA 5M1PA 4ZHRA 4QS8A 2FF6A 3D0PA 3B6OA 4CHNA 2QKKA 4FJ7A 5BRDA 1C56A 1EWQA 4KH4A 4DU1A 1SEGA 3OA9A 1IKVA 4NO7A 4DR5K 1Q9XA 4JKCA 1DGKN 4CBWA 1WSHA 4JK9A 4RW4A 3ZSVA 4DTMA 4KB0A 4C8NA 2JWKA 1GLCG 2NRZA 1V4TA 4O5BA 3E01A 3DLHA 1BISA 3QIPA 2UU9K 2NZTA 2WUSA 4CJ7A 1GLEG 1FJGK 4CGJA 3IS9A 3OS1A 4H5RA 1P8ZA 1NK4A 4B9UA 2PFUA 4IO8A 3TU5A 1TUYA 1QVGM 3WUHA 3VEWA 5C12A 5BN9A 2ZGYA 4H4MA 4DTOA 3KWIA 1NPIA 3JS6A 4BE0A 1P00A 4AM6A 1FW6A 5K14A 4CECA 3BEXA 1FH3A 1RT2A 2GBZA 2YIOA 3L0QA 4BC5A 3KZBA 1QSSA 1TKTA 3HOSA 3AO4A 1YAGA 3ULEA 1RT5A 3NAEA 1VQMN 4WQ5A 3EE9A 1RT6A 4GKKK 1TAQA 1BIZA 1IBMK 2P9IB 5HLFA 2LY6A 2F7TA 4AHTA 4E89A 4KI6A 5F0XA 3MEGA 3F9KA 3QEXA 2XHBA 4FJGA 3OYEA 1K8KA 2VCPA 1NK0A 3VQDA 1KFDA 4ELTA 3WT0A 1T03A 3NGIA 1NKCA 4FWNA 2QWNA 4ID1A 5KRSA 4G1QA 1OMYA 2YNGA 1YHQN 5M1QA 3AVFA 3SZ2A 3VQEA 3MX5A 4A57A 3E7RL 4CZKA 1JKZA 4IFEA 5AQMA 1ZC6A 3DLBA 2E2OA 3FZMA 4K43A 1NGDA 1FK9A 2FBVA 4ELUA 4YOTA 2KHOA 3VQ8A 4N41A 3SQ4A 3DLLL 2R7YA 1NJIO 4BE2A 1ZVEA 2AA4A 3O6WA 4C8LA 3T1AA 3KJVA 4DTSA 4DFJA 2DFHA 3PIPL 3G6EN 3EKSA 2FSJA 2HNYA 5FLXO 4IJAA 3CJBA 2YX6A 2LJMA 4C8KA 4FXDA 1KAXA 3SMSA 3FLCO 2E6LA 4ISGA 1NBWA 4PL7A 1NK8A 4FYDA 1T8EA 1T7PA 1N8RO 3QNOA 4J2DA 3C65A 1CXUA 2G8VA 1J5OA 5CY4A 3CJ1A 4B9SA 3ZLJA 3LZIA 3SLCA 1HNXK 5AFUH 3ZT3A 5EY4A 3OYHA 4K8ZA 4JLHA 3WNHA 2ASOA 4JKGA 1QHTA 4Y0WA 4PKGA 1TKZA 3ZX0A 3I55N 4MQ3A 4JRPA 1TKXA 3M8QA 4JD2B 3CXCM 1CZBA 4DFMA 4PL8A 2HMPA 4BGBA 4EP4A 1V4SA 4JI7K 5ADXH 4F4KA 4JK8A 1E4FT 4FVMA 4K0KK 3BZKA 3HVTA 4KREA 1VNBA 2KPYA 3FR0A 3VQ6A 3ZSQA 3KLEA 3TI0A 3T19A 3N4QA 2K35A 1NE5A 2XY7A 3QIOA 5FPNA 4I9QA 3QEIA 5LJVA 3SQ2A 3CJ9A 1DTTA 4MDAA 1A5WA 1OH8A 5I3UA 5EX5A 2NY9X 5LJWA 5EOYA 4FM2A 4DV7K 2VGNA 3GBTA 4W5TA 2A1RA 3SAFA 3OS2A 1X9JA 3EZWA 2NRHA 4DU4A 1JKHA 3ZT2A 5EXWA 3IRXA 4KHPK 3D2EB 4WFBL 2FXUA 2NRRA 3SJJA 3RRHA 4CK3A 1T6DA 4GV3A 3LAMA 4YHHK 1VQ6N 3KC6A 1FKOA 3ZSXA 2E88A 1XWLA 3I0SA 3VMFB 5EVZA 1S5JA 3HPOA 3OYIA 4ZTJA 4DV0K 3P38A 3R9PA 2O8DA 1JCGA 4BG8A 4IEIA 4UAEF 4Y1DA 5KQ8A 3PIOL 1VQPN 3M8PA 2GWJA 3GOIA 4PHTX 3NVKA 4DV2K 4K41A 4GV9A 1RT1A 2P9NB 4LC9B 3LP0A 2B4JA 3WXMB 2P9PA 4IBNA 3O4QA 2NRVA 4CFCA 4H0YB 3ALYA 4EZ6A 2BANA 2JLEA 1W0HA 3HOTA 4FWQA 4RW6A 3KVGA 1I39A 2HHIA 2HBJA 3KOWA 1NGBA 2LN8A 1NMDA 3QLHA 3TR8A 2FLOA 4B3RK 5H1SQ 3H1QA 2P1JA 3VOVA 1C0FA 3AA4A 5AZJB 4FLZA 2O8FB 5F1XA 3SUOA 4JKEA 4NLCA 1FXXA 4IKFA 2Q3SA 4FJNA 2YHAA 2XY8A 3NGZA 1BGXT 4NCAA 1C1CA 3ZT4A 3HSCA 3J7ZO 1EX4A 1BQNA 1W97L 1ZYVA 4C23A 1J53A 3O9QA 4YNQA 3K5LA 4B9VA 1HNIA 4CJEA 3V9UA 2CH6A 4FJLA 3LP1A 4AF1A 4O0JA 1ZBSA 4E1JA 3TANA 4ISEA 3QINA 1HNVA 3VQAA 3C7NB 2SN3A 3V1OA 3G4SN 3RWUA 4Z4EA 2LT8A 4IDKA 1ZBLA 4JEPA 2OTJN 2O4IA 1JJ2M 3V6DA 2FF3B 2JDQD 4CZJA 5HRPA 1RBSA 4CEDA 2O8CA 4DQQA 4EIAA 1JCFA 1A5VA 4PA1A 2WOMA 2D1KA 1NJWA 1JLFA 5KI6A 3KLFA 3UIQA 2B68A 4C1NK 2CH5A 3VGLA 1TL3A 4KV8A 2HHTA 2ITGA 3AO1A 1KVCA 2HNDA 2HHUA 2P9LA 3ZEUB 2YKMA 4FZXC 4DQPA 1ZBUA 2W6LA 3QBWA 1QS4A 5CZ1A 1SS6A 2W42A 3QICA 1K6YA 4BRKA 3LPUA 4KB1A 3LM9A 4CJSA 3TAGA 1EXQA 2GMOA 4CJFA 1KLMA 1YXQA 4CZEA 3ZT1A 1XC3A 3JXUA 3WXKA 3L4IA 4AB0A 2YBRC 3ENBA 4AHUA 1ILYA 4B3SK 2DTUA 4CF1A 5HL7L 3CCSN 2W6KA 3WNFA 4E0DA 2YIPA 1ZYQA 1VNAA 5FPDA 1YTAA 2HHSA 2OZSA 2N66A 3O3GA 1DLOA 4FM1A 3CFPA 1QZ6A 4CJ3A 5JLFA 1Q82O 3LL3A 4H4OA 3F9MA 4F3OA 1MU2A 1JCEA 2BUPA 2HF3A 1B7DA 3U8XA 3SUPA 3FE1A 3KOXA 3LDSA 3AV9A 3TSPA 5CE3A 1F21A 3F2KA 3MK6A 4CD3A 5AQSA 2PYLA 3HTVA 2E8AA 4CZMA 2OZMA 4DMNA 4UAFE 1S6PA 3TSQA 3CPEA 1UWBA 3I0RA 3Q7CA 4CJQA 3SF4D 4H0TB 4CHPA 4GVMA 3QB0A 4BEBA 2UYTA 3CQ8A 3AGRA 4CGIA 1WMTA 3UKRB 5LMUK 4CGGA 4CZFA 1ZFUA 5CYQA 3EL2A 5DMRA 1S1XA 2A42A 1K8KB 4LSNA 5CY0A 3VEXA 4JD2A 2VQEK 1NMNA 4BG9A 3R6MA 4FO0A 4M3ZA 3KK3A 2KFZA 4B9MA 3QBXA 4CHYA 1RDAA 3E9PA 4B8CA 5AZIB 4NYNA 2GWKA 4O44A 2CGKA 4H5VA 4RW8A 3O08A 1HJRA 3DRRA 1BCGA 4H5NA 3T1HK 1I2UA 3LDOA 5C2FA 3KK7A 2N69A 2Q36A 4HE7A 1B3CA 3F73A 3ZSOA 5E41A 1TGOA 4WQ5C 3KOYA 4CQKA 4YFUA 4DUZK 4E7JA 3RMDA 1L4VA 2D0BA 2F9TA 5I42A 1B9DA 3U3GA 4DR7K 1ATNA 3R8EA 4CK1A 3D2EA 4DFPA 4FL9A 4CF8A 1JXEA 1L3UA 2P9UB 3KWGA 4NYFA 4F3TA 2OANA 4Z0UA 2A7TA 4AQYK 5FRNA 1YI2N 2FBYA 1KVBA 1T3VA 3V9SA 3S9HA 1KLNA 3SQ0A 3VQCA 4DTPA
chains in the Genus database with same CATH topology
2ZGYA 2W41A 3O9TA 3SAHA 3MCPA 3KWIA 3JS6A 5FPMA 3BUZB 1ATSA 4H5TA 3G25A 4H0VB 3AY9A 2V52B 4AM6A 4A61A 2NRWA 4IWVA 4XH5A 4JKGB 1HKBA 1QQOA 3BEXA 4BR4A 3CCJN 2FSKA 5TKWA 3EO3A 2YIOA 3L0QA 4BC5A 5JVHL 3KZBA 4H0XB 4WCEL 3LDLA 4GNIA 3D7EO 3SJHA 4BRFA 5AQKA 3HOSA 1YAGA 2NLXA 4JKDA 3ULEA 1VQMN 2V7ZA 4WQ5A 3ZETA 3EE9A 5AQHA 3H45C 3VENA 1VQ9N 2P9IB 2F7TA 1BOTO 2H3GX 1HPMA 5M1NA 4BE7B 3OBWA 4BRNA 1BDGA 1RDWX 2VGMA 3H3NO 4IOAL 2QTDA 2QWLA 1RGIA 5F0XA 2Q97A 3H46O 3O1WA 2QWMA 2YHXA 4FPAA 1K8KA 1TUUA 3B8AX 3EKUA 3VTIA 1WOQA 4JKFA 2VCPA 3W0LA 3LDQA 4B1WB 2W00A 3VGMA 5ADXH 3WT0A 3DXMA 3VGKA 2HF4A 3VPZA 4ILHA 4IJNA 3ATVA 1NGAA 4BRGA 3H3OB 2QWNA 4FWNA 2V7YA 2KLAA 1YHQN 1YIJN 4WQ4A 3ZX3A 5M1QA 3UKUB 2E1ZA 2QWRA 3MX5A 5FPEA 1QHAA 1XUPO 3CCVN 2C1IA 4A57A 1T44A 2QXLA 2QA4N 4IOCL 3PLAA 4CZKA 3I56N 2A5XA 5AQOA 2YJFA 3BF1A 4IFEA 4H0OA 1NWKA 5BPNA 5AQMA 1ZC6A 2E2OA 3FZMA 2PAVA 3HZ6A 4K43A 4O8KA 4QS7A 2ITMA 3CCMN 1X3NA 1NGDA 2VWBA 3IMXA 5E84A 1GLLO 3CCRN 3ID6A 2AP1A 1K73O 1RFQA 2WC9A 3RVCA 3MWPA 2KHOA 3E9LA 4YOTA 1MWKA 5I9EB 4GVEA 4DKWA 3DLLL 2D0PA 1NJIO 2YCHA 3FZHA 4B1UB 3MN7A 1QVFM 2QM1A 3VEYA 2AA4A 4FSVA 4FOEA 5AQYA 1O13A 3CJAA 3O6WA 3SBGA 3TTCA 3RSEB 3CETA 3CMAN 4GY2B 3PIPL 4H5WA 3G6EN 3EKSA 1NGGA 3QMLA 2FSJA 4A5BA 3D2FA 2MN5A 1H1VA 3FFKB 4IJAA 3CJBA 3WXIA 2FSNA 2YX6A 3K9KA 1YUWA 2P9SA 1KAXA 3L56A 3SMSA 1POIA 1Z05A 2WBNA 3FLCO 3SK3A 4ISGA 1LOTB 1NBWA 4M7XA 4PL7A 3CCUN 1YJ9N 4B9QA 4BQZA 4YOYA 1M90O 2F9WA 3M5RA 2P9PB 4XEIA 1BA0A 1N8RO 2CGLA 2VY6A 3ZEUA 3C65A 2A41A 4JKHA 4CBXA 3MX2A 4KH6A 3CJ7A 4HTLA 3CW4A 5M1KA 4BRPA 3CPWM 3CJ1A 3WXJA 3FGUA 3O4WA 4B1YB 4K25A 3SLCA 1U6ZA 4BRHA 5ELZA 2I7PA 5AFUH 5EY4A 3EN9A 3I8BA 1VQNN 4YOVA 5AQWA 2QWQA 2ASOA 3MDQA 3BF3A 2IVOA 4JKGA 5GAEP 3CERA 3UE5A 4Z94A 3VTHA 2WFBA 3CCQN 2YJEA 4Y0WA 4AM7A 2QEXN 4YDUA 4PKGA 1E4GT 1SQKA 5TKYA 4WFBL 3ZX0A 3I55N 5LY3A 3CI5A 1U2VB 2Q0UA 3OW2M 4FWLA 4JD2B 4WFAL 3CXCM 4PL8A 2HMPA 4WQ4C 4BGBA 3M6GA 5AQJA 5AQXA 1LCUA 1NM1A 1V4SA 2QI2A 2YHWA 1HX1A 3HRGA 3ID8A 2P9IA 4JK8A 3VEZA 1E4FT 4B1VA 4BREA 1HLUA 2ZWHA 4BC2A 3FR0A 4I6MA 3CQXA 4CZLA 4DCHA 3CC4N 3FZLA 3N4QA 2K35A 5AQQA 5B8HA 4BR7A 5FPNA 4OO1J 4IZ9A 2A40A 5LJVA 5GINA 3OBYA 1OVYA 3CJ9A 1WUAA 4MDAA 2P9KA 4EFHA 3DXKA 5EX5A 2Q0RA 5LJWA 3DAWA 1ESVA 1SAZA 3O5BA 4IXCA 5EOYA 3U9DA 4RCHA 2VGNA 2DPNA 3LDNA 3GBTA 4B1ZA 2YI1A 5M1FA 3SAFA 1X9JA 3EZWA 2NRHA 4L3QA 5AQFA 3WXLA 1BO5O 2MBKA 5EXWA 3D2EB 3Q7BA 4BRIA 2FXUA 5AQLA 1SZ2A 1T6CA 2NRRA 4MO4A 4QS9A 3UKRA 3HBTA 2GTDA 4R79A 1TYQA 1QZ5A 1T6DA 2BH1A 3GDQA 3MN9A 4GV3A 1YITN 4WFNL 3VF6A 2Q1NA 5AQTA 5BPLA 3AAQA 4A2AA 1VQ6N 3KC6A 4EAHD 3O8MA 2E88A 4JN4A 3HM8A 5C15A 4GV6A 2GX9A 2YHYA 4MLEA 2QW9A 4A5AA 3VMFB 1VQ7N 5EVZA 2HBKA 2GELA 1K8AO 2VYPA 3CHWA 3CQYA 4MLHA 1K9MO 1Q86O 2P9LB 1XQSC 3P38A 5AZIA 3R9PA 5JICA 1JCGA 4BG8A 3R1XA 4UAEF 4IEIA 3TTDA 5KQ8A 3PIOL 1VQPN 2GWJA 4BRMA 5GAGP 3GOIA 4BC3A 4PHTX 3QFUA 3NVKA 4YORA 4K41A 4GV9A 3SMPA 2P9NB 4LC9B 2J4RA 4ILJA 2ZJRL 2QWOA 3DWLA 5C2DA 4YDUC 3CCLN 5AQUA 5GAHP 3WXMB 3L4QA 2P9PA 4YOUA 5AQPA 4FWSA 1BA1A 1DT9A 4PKHA 4YOXA 2NRVA 4H0YB 3LDPA 3ULEB 3QFPA 2RHKA 3HOTA 4FWQA 3KVGA 4DQ8A 4XH4A 4XJXA 4O5FA 3DJCA 3K9JA 3R3LA 4A2BA 2HBJA 1NGBA 2LN8A 1NMDA 1J6ZA 3MN5A 2FLOA 2HSTA 2P9UA 5H1SQ 4ILGB 4K42A 3H1QA 1Q7YO 3VOVA 2ZJPL 4OPAA 3I33A 1C0FA 5AZJB 4BR2A 3FZFA 4IOXA 4JKAA 3A0IX 5F1XA 4OPHA 3F5TA 4G9ZA 4JKEA 3D6RA 3M3ZA 4NLCA 4BRLA 3CC2N 2IVPA 2W40A 5M1OA 5BN8A 3LM2A 1P90A 4FWRA 5JVGL 4BRQA 5BREA 1MWMA 3J7ZO 3HSCA 4BR9A 3A8YA 1VQ8N 3IUCA 3MMVA 2HBLA 4BGAA 1W97L 4FOIA 3TSUA 4C23A 4UADE 3L6QA 3O9QA 5KPZA 3G71N 4FVUA 5KPTA 3H1VX 2A3ZA 2E2PA 2JWLA 3ATUA 4JHDB 2CH6A 4AF1A 2RE2A 1ZBSA 3SBTA 4JKBA 2D56A 4C1NI 4E1JA 4MDBA 4BQLA 1Q81O 2E2QA 4ISEA 5DM7L 3CC7N 5GADP 5F2RA 3C7NB 4NLBA 5AQVA 3VF4A 1ATRA 2NRTA 3G4SN 2HOEA 2D0OA 1R59O 3GE1A 1VAZA 3CD6N 3WQTA 4M63C 3A5OC 2Q2RA 2OTJN 3N4PA 4JEPA 1JJ2M 4CZGA 1MA9B 2FF3B 3ENOA 5JMVA 3U4LA 2JDQD 4CZJA 4CD1A 1GLBG 1VQON 3O9SA 1Q18A 2BTFA 4U67L 4BY9C 4EHUA 3QI7A 4EIAA 1JCFA 3NVMA 1BUPA 4IO9L 1CZAN 1QQMA 2D1KA 4F9OA 1IJJA 2CGJA 1KAZA 1M1KO 4BC4A 1VQLN 3UB5A 2C1GA 1NGCA 3P4IA 4C1NK 5DM6L 2CH5A 3VGLA 3GL1A 2P9LA 3UKUA 3M1FA 3ZEUB 3CJCA 5CR4A 5AQRA 1NGHA 3QBWA 3QDKA 1SS6A 4WF9L 5MLCQ 3P39A 3VEVA 3T69A 3QICA 2YILA 3A5NC 4BRKA 3MWTA 3KHWA 5AQIA 3LM9A 2ZF5O 3U9ZA 3WEEB 4CI6A 2P9NA 2GMOA 4KBOA 1ZXOA 1YXQA 3C6AA 2E20A 4MO5A 1XC3A 3JXUA 3WXKA 4CZEA 3L4IA 3E66A 4JNEA 1EO1A 3S41A 1D4XA 4DHYA 4RTFD 3A5MC 1QQNA 3ENBA 3KHYA 4IDHA 3CIPA 4RWTA 1ILYA 5HL7L 4KH5A 3CCSN 4DB3A 1OKJA 5HOOA 3O1BA 2A6AA 5AFUA 2YIPA 3A5LC 5C10A 5FPDA 4FWPA 2GUPA 2ZGZA 5KQDA 1VQKN 5BRHA 2KKZA 3CF5L 3C6HA 5C0YA 1QZ6A 5JLFA 3VETA 5BPMA 1GLFO 3LL3A 1Q82O 4CZIA 4JAXA 4XH1A 3RSEA 5AZJA 4YOWA 3NMUA 3IFRA 1KAYA 4BR0A 3AARA 3F9MA 1YJNN 1YVNA 4I6MB 4A59A 5AQZA 2BUPA 1JCEA 2E1YA 2HF3A 4WYBA 5BR9A 1HUXA 5AR0A 1G99A 1C0GA 3U8XA 4UY8O 1GLAG 5ADXA 3FE1A 3VEOA 2IIRA 3E1YA 2EWSA 1YF5L 3TSPA 4BVOA 3OHRA 5CE3A 5E26A 3F2KA 3MK6A 4CD3A 5AQSA 2D4WA 3HTVA 2E8AA 4CZMA 3TTFA 2P9KB 1S3XA 3ZYYX 2E2FA 4UAFE 3DXKB 3TSQA 3CPEA 3E9OA 3ZETB 3ZX2A 5CHIA 1BU6O 1IG8A 2E2NA 3Q7CA 1MDUB 4JHDA 4BECA 4H03B 3SF4D 3O9RA 4H0TB 2QWPA 4ISFA 3VESA 1NGIA 3AGKA 2GEMA 1RDUA 3QB0A 3SAGA 4BEBA 1GLDG 1KC8O 3BK3C 1X3MA 1Z6RA 2HBMA 2UYTA 3AGRA 3UKRB 1VQ5N 3J8AA 3C7NA 4CZFA 1VQ4N 4BRAA 3CMEN 3ENHA 1TYQB 2NRXA 2PBDA 3EL2A 3HI0A 2A42A 1K8KB 1U2VA 5JLHA 3VEXA 4FPBA 4IEEA 4BRDA 4JD2A 1S72N 2V51B 3MN6A 4PKIA 4B1XB 3DXMB 1EQYA 4BG9A 1NGFA 1KD1O 4JK7A 3R6MA 1NGEA 4FO0A 4CBUA 5GIOA 3VF2A 3R2VA 1DKGD 1HJOA 2ASMA 3QBXA 3IKMA 3E9PA 4O8UA 5AZIB 3BP8A 2GWKA 3CCEN 4EHTA 3AAPA 2CGKA 4H5VA 3IDHA 5M1PA 4BR5A 3MCAB 1BWFO 2OTLN 4FWMA 1HKGA 3O08A 4QS8A 4CZHA 4M7YA 3FZKA 2FF6A 4H5NA 2NNWA 2I7NA 3WQUA 3P31A 3LDOA 5C2FA 3EE8A 3KK7A 2Q36A 4BROA 4H0PA 5BRDA 4KH4A 1W2BM 3O9UA 3OA9A 4WQ5C 4U7BA 2ASPA 1S22A 3T7ZA 3C0BA 4BRCA 4NO7A 4JKCA 4NB4A 1DGKN 2F9TA 3O80A 4CBWA 4JK9A 3TPQA 3WEEA 1ATNA 3R8EA 3D2EA 4FL9A 2Q31A 2JWKA 1GLCG 1NLVA 2NRZA 2P9UB 3VERA 1KQSM 1V4TA 5AQGA 1HKCA 4BVPA 4A62A 1BG3A 1YJWN 3KWGA 1DEJA 5AQNA 2OANA 2NZTA 3D2FB 2WUSA 4CJ7A 1GLEG 2ZJQL 1NGJA 2P9SB 1Y64A 1YI2N 4H5RA 1P8ZA 3H6EA 4J8FA 3GG4A 5BRFA 3W3DA 4HWIA 4FWKA 1T3VA 1KXPA 2PFUA 1GLJO 5KPRA 4IO8A 3TU5A 5GIPA 4FWOA 2IVNA 1TUYA 1QVGM 3WUHA 3VEWA 5C12A 5BN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGY A;  2W41 A;  3MCP A;  3JS6 A;  5FPM A;  3BUZ B;  1ATS A;  4H5T A;  3G25 A;  4H0V B;  3AY9 A;  2V52 B;  4AM6 A;  4A61 A;  4IWV A;  4XH5 A;  1HKB A;  1QQO A;  3BEX A;  4BR4 A;  2FSK A;  3EO3 A;  3L0Q A;  4BC5 A;  3KZB A;  4H0X B;  3LDL A;  4GNI A;  3D7E O;  3SJH A;  4BRF A;  5AQK A;  1YAG A;  2NLX A;  3ULE A;  2V7Z A;  4WQ5 A;  3ZET A;  5AQH A;  3H45 C;  3VEN A;  2P9I B;  1BOT O;  2H3G X;  1HPM A;  4BRN A;  1BDG A;  1RDW X;  3H3N O;  2QWL A;  1RGI A;  5F0X A;  2Q97 A;  3H46 O;  3O1W A;  2QWM A;  2YHX A;  4FPA A;  1K8K A;  1TUU A;  3B8A X;  3EKU A;  1WOQ A;  3W0L A;  2VCP A;  3LDQ A;  4B1W B;  3VGM A;  3WT0 A;  3DXM A;  3VGK A;  2HF4 A;  3VPZ A;  4IJN A;  3ATV A;  1NGA A;  4BRG A;  3H3O B;  2QWN A;  4FWN A;  2V7Y A;  4WQ4 A;  3ZX3 A;  3UKU B;  2E1Z A;  2QWR A;  5FPE A;  1QHA A;  1XUP O;  1T44 A;  2QXL A;  4CZK A;  2A5X A;  5AQO A;  2YJF A;  3BF1 A;  4H0O A;  1NWK A;  5BPN A;  5AQM A;  1ZC6 A;  2E2O A;  3FZM A;  2PAV A;  3HZ6 A;  4K43 A;  4O8K A;  4QS7 A;  2ITM A;  1X3N A;  1NGD A;  2VWB A;  3IMX A;  5E84 A;  1GLL O;  2AP1 A;  1RFQ A;  2KHO A;  5I9E B;  1MWK A;  2D0P A;  2YCH A;  3FZH A;  4B1U B;  3MN7 A;  2QM1 A;  3VEY A;  2AA4 A;  4FSV A;  4FOE A;  5AQY A;  3CJA A;  3O6W A;  3RSE B;  3CET A;  4GY2 B;  4H5W A;  3EKS A;  1NGG A;  3QML A;  2FSJ A;  3D2F A;  1H1V A;  3FFK B;  4IJA A;  3CJB A;  3WXI A;  2FSN A;  1YUW A;  2P9S A;  1KAX A;  3SMS A;  1Z05 A;  3FLC O;  3SK3 A;  4ISG A;  1LOT B;  1NBW A;  4M7X A;  4PL7 A;  4B9Q A;  4BQZ A;  2F9W A;  2P9P B;  4XEI A;  1BA0 A;  2CGL A;  3ZEU A;  4CBX A;  2A41 A;  3CJ7 A;  4HTL A;  4BRP A;  3CJ1 A;  3WXJ A;  3FGU A;  3O4W A;  4B1Y B;  4K25 A;  3SLC A;  1U6Z A;  4BRH A;  5ELZ A;  2I7P A;  5AFU H;  5EY4 A;  3EN9 A;  3I8B A;  5AQW A;  2QWQ A;  2ASO A;  3MDQ A;  3BF3 A;  2IVO A;  3CER A;  3UE5 A;  4Z94 A;  2YJE A;  4Y0W A;  4AM7 A;  4YDU A;  4PKG A;  1E4G T;  1SQK A;  5TKY A;  3ZX0 A;  5LY3 A;  3CI5 A;  1U2V B;  2Q0U A;  4FWL A;  4JD2 B;  4PL8 A;  2HMP A;  4WQ4 C;  4BGB A;  3M6G A;  5AQJ A;  5AQX A;  1LCU A;  1NM1 A;  1V4S A;  2YHW A;  3ID8 A;  1HX1 A;  4B1V A;  4BVO A;  2P9I A;  3VEZ A;  5ADX H;  1E4F T;  4BRE A;  1HLU A;  2ZWH A;  4BC2 A;  3FR0 A;  4I6M A;  3CQX A;  4CZL A;  4DCH A;  3FZL A;  5AQQ A;  5B8H A;  4BR7 A;  5FPN A;  4IZ9 A;  2A40 A;  5LJV A;  3CJ9 A;  1WUA A;  2P9K A;  4EFH A;  3DXK A;  5EX5 A;  2Q0R A;  5LJW A;  3DAW A;  1ESV A;  1SAZ A;  3O5B A;  4IXC A;  5EOY A;  3U9D A;  4RCH A;  2DPN A;  3LDN A;  3GBT A;  4B1Z A;  2YI1 A;  1X9J A;  3EZW A;  2NRH A;  4L3Q A;  5AQF A;  3WXL A;  1BO5 O;  5EXW A;  3D2E B;  4BRI A;  2FXU A;  5AQL A;  1SZ2 A;  1T6C A;  4MO4 A;  4QS9 A;  3UKR A;  3HBT A;  2GTD A;  1TYQ A;  1QZ5 A;  1T6D A;  3MN9 A;  3GDQ A;  3VF6 A;  2Q1N A;  5AQT A;  5BPL A;  3AAQ A;  4A2A A;  4EAH D;  3O8M A;  2E88 A;  4JN4 A;  3HM8 A;  2YHY A;  4MLE A;  2QW9 A;  5EVZ A;  2GEL A;  2VYP A;  3CHW A;  3CQY A;  4MLH A;  2P9L B;  1XQS C;  5AZI A;  3R9P A;  5JIC A;  1JCG A;  4BG8 A;  5KQ8 A;  2GWJ A;  4BRM A;  3GOI A;  4BC3 A;  3QFU A;  4K41 A;  3SMP A;  2P9N B;  4LC9 B;  2J4R A;  2QWO A;  3DWL A;  4YDU C;  5AQU A;  2P9P A;  5AQP A;  4FWS A;  1BA1 A;  4PKH A;  4H0Y B;  3LDP A;  3ULE B;  3QFP A;  4FWQ A;  3KVG A;  4DQ8 A;  4XH4 A;  4O5F A;  3DJC A;  4A2B A;  1NGB A;  1NMD A;  1J6Z A;  3MN5 A;  2FLO A;  2P9U A;  4K42 A;  3H1Q A;  3VOV A;  3I33 A;  1C0F A;  5AZJ B;  4BR2 A;  3FZF A;  3A0I X;  5F1X A;  3M3Z A;  4BRL A;  2IVP A;  2W40 A;  5BN8 A;  3LM2 A;  4FWR A;  4BRQ A;  5BRE A;  1MWM A;  3HSC A;  4BR9 A;  3A8Y A;  3IUC A;  3MMV A;  4BGA A;  4FOI A;  4C23 A;  3L6Q A;  5KPZ A;  5KPT A;  3H1V X;  2A3Z A;  2E2P A;  3ATU A;  4JHD B;  2CH6 A;  1ZBS A;  4E1J A;  4BQL A;  2E2Q A;  4ISE A;  5F2R A;  3C7N B;  5AQV A;  3VF4 A;  1ATR A;  2HOE A;  2D0O A;  1R59 O;  3GE1 A;  3WQT A;  4M63 C;  3A5O C;  2Q2R A;  4CZG A;  1MA9 B;  2FF3 B;  3ENO A;  5JMV A;  3U4L A;  4CZJ A;  4CD1 A;  1GLB G;  1Q18 A;  2BTF A;  4EHU A;  4EIA A;  1JCF A;  1BUP A;  1CZA N;  1QQM A;  2D1K A;  4F9O A;  1IJJ A;  2CGJ A;  1KAZ A;  4BC4 A;  3UB5 A;  1NGC A;  3P4I A;  2CH5 A;  3VGL A;  3GL1 A;  2P9L A;  3UKU A;  3M1F A;  3ZEU B;  3CJC A;  5AQR A;  1NGH A;  3QBW A;  3QDK A;  3VEV A;  3QIC A;  3A5N C;  4BRK A;  5AQI A;  3LM9 A;  2ZF5 O;  3U9Z A;  3WEE B;  4CI6 A;  2P9N A;  4KBO A;  1ZXO A;  1YXQ A;  4MO5 A;  2E20 A;  4CZE A;  1XC3 A;  3JXU A;  3WXK A;  3L4I A;  4JNE A;  3S41 A;  1D4X A;  4DHY A;  4RTF D;  3A5M C;  1QQN A;  3KHY A;  4RWT A;  3CIP A;  4DB3 A;  1OKJ A;  3O1B A;  2A6A A;  5AFU A;  3A5L C;  5FPD A;  4FWP A;  2GUP A;  2ZGZ A;  5KQD A;  5BRH A;  1QZ6 A;  5JLF A;  3VET A;  5BPM A;  1GLF O;  3LL3 A;  4CZI A;  4JAX A;  4XH1 A;  3RSE A;  5AZJ A;  3IFR A;  1KAY A;  4BR0 A;  3AAR A;  3F9M A;  1YVN A;  4I6M B;  5BR9 A;  5AQZ A;  2BUP A;  1JCE A;  2E1Y A;  2HF3 A;  4WYB A;  1HUX A;  5AR0 A;  1G99 A;  1C0G A;  3U8X A;  1GLA G;  5ADX A;  3FE1 A;  3VEO A;  2IIR A;  2EWS A;  5CE3 A;  3OHR A;  5E26 A;  3MK6 A;  4CD3 A;  5AQS A;  2D4W A;  3HTV A;  2E8A A;  4CZM A;  2P9K B;  1S3X A;  3DXK B;  3ZET B;  3ZX2 A;  1BU6 O;  1IG8 A;  2E2N A;  4JHD A;  1MDU B;  4H03 B;  4H0T B;  2QWP A;  4ISF A;  3VES A;  1NGI A;  2GEM A;  3QB0 A;  1GLD G;  1X3M A;  1Z6R A;  2UYT A;  3UKR B;  3J8A A;  3C7N A;  4CZF A;  4BRA A;  3ENH A;  1TYQ B;  2PBD A;  3EL2 A;  3HI0 A;  2A42 A;  1K8K B;  1U2V A;  5JLH A;  3VEX A;  4FPB A;  4BRD A;  4JD2 A;  2V51 B;  3MN6 A;  4PKI A;  4B1X B;  3DXM B;  1EQY A;  4BG9 A;  1NGF A;  3R6M A;  1NGE A;  4FO0 A;  4CBU A;  3VF2 A;  1DKG D;  1HJO A;  2ASM A;  3QBX A;  5AZI B;  3BP8 A;  2GWK A;  4EHT A;  3AAP A;  2CGK A;  4H5V A;  3IDH A;  4BR5 A;  1BWF O;  4FWM A;  1HKG A;  3O08 A;  4QS8 A;  4CZH A;  4M7Y A;  3FZK A;  2FF6 A;  4H5N A;  2I7N A;  3WQU A;  3LDO A;  2Q36 A;  4BRO A;  4H0P A;  5BRD A;  4WQ5 C;  2ASP A;  1S22 A;  3C0B A;  4BRC A;  4NO7 A;  4NB4 A;  1DGK N;  2F9T A;  3O80 A;  4CBW A;  3TPQ A;  3WEE A;  1ATN A;  3R8E A;  3D2E A;  4FL9 A;  2Q31 A;  1GLC G;  1NLV A;  3VER A;  2P9U B;  1V4T A;  5AQG A;  1HKC A;  4BVP A;  4A62 A;  1BG3 A;  1DEJ A;  5AQN A;  2OAN A;  2NZT A;  3D2F B;  2WUS A;  4CJ7 A;  1GLE G;  1NGJ A;  2P9S B;  1Y64 A;  4H5R A;  1P8Z A;  3H6E A;  4J8F A;  3GG4 A;  5BRF A;  3W3D A;  4HWI A;  4FWK A;  1KXP A;  5KPR A;  1GLJ O;  4IO8 A;  3TU5 A;  4FWO A;  2IVN A;  1TUY A;  3WUH A;  3VEW A;  5BN9 A; 
#chains in the Genus database with same CATH topology
 3SAH A;  3BUZ B;  1ATS A;  3AY9 A;  4W5O A;  2NRW A;  1QTM A;  4IWV A;  4XH5 A;  4JKG B;  3CCJ N;  1QQO A;  2ATQ A;  1J54 A;  2FSK A;  4H8K A;  5JVH L;  3V9X A;  1ITG A;  4H0X B;  3VQ5 A;  3HM9 A;  1N34 K;  4OGC A;  3KLI A;  1NRA A;  3HXM A;  2UUA K;  2HHQ A;  4M3R A;  4DSJ A;  2V7Z A;  4DLE A;  3ZET A;  3OY9 A;  3VQQ A;  4CF0 A;  1IH7 A;  2UXD K;  2EX3 A;  2Y1J A;  3BY5 A;  1Y97 A;  4BE7 B;  5M1N A;  4QOZ B;  1BCO A;  2VGM A;  4CEA A;  1ZU3 A;  2N2Q A;  2QTD A;  3DI6 A;  4HVJ A;  3O1W A;  1Z26 A;  1OZZ A;  1RT4 A;  2YHX A;  1TUU A;  3C95 A;  4JKF A;  3S3N A;  4B1W B;  3DXM A;  3CYM A;  2HF4 A;  2DFE A;  5LL6 Z;  4N56 A;  3ATV A;  2F4V K;  4FLW A;  3LAL A;  1RTJ A;  3THV A;  3FFI A;  4AHR A;  1OH7 A;  4KRF A;  3NF8 A;  5HBM A;  2E1Z A;  2RKI A;  5J2M A;  2QWR A;  3CCV N;  4IOC L;  2QA4 N;  3PLA A;  2YHB A;  4Z4F A;  1KV0 A;  2A5X A;  4H0O A;  5BPN A;  4DV5 K;  3NFA A;  3V1Q A;  4J2B A;  1JXB A;  4BE1 A;  1X3N A;  2VWB A;  2Z1I A;  5E84 A;  1K73 O;  1GLL O;  3QEV A;  2AP1 A;  3DLR A;  2WC9 A;  3RVC A;  3E9L A;  5EU7 A;  1CN2 A;  3KD1 E;  4CCH A;  4DKW A;  2GL1 A;  3L3U A;  2YCH A;  3FZH A;  4B1U B;  3MN7 A;  1X9M A;  4FZZ A;  4FOE A;  3NH1 A;  5AQY A;  3SYZ A;  2OYQ A;  3BGR A;  3TTC A;  3RSE B;  3CET A;  3CMA N;  2O8D B;  4AIL C;  4A5B A;  3D2F A;  1H1V A;  4LF5 K;  3LWL A;  3WXI A;  2FSN A;  4N5S A;  1RBR A;  1RDC A;  2I61 A;  1I6G A;  2P9S A;  4DSK A;  2WBN A;  3PSF A;  3SK3 A;  1LOT B;  5J2P A;  5D3G A;  1RCH A;  4BQZ A;  1IV0 A;  4YOY A;  3M5R A;  2P9P B;  4XEI A;  1BA0 A;  3L2Q A;  2CGL A;  2VY6 A;  3ZEU A;  1RBV A;  2HVI A;  4JV5 K;  3T1Y K;  3CW4 A;  1X9W A;  2LR3 A;  1HQE A;  3THY B;  1VSE A;  2HHH K;  3EN9 A;  2KTQ A;  3OTO K;  4YOV A;  5AQW A;  2QWQ A;  2IVO A;  4DU3 A;  4CJT A;  4FJ5 A;  4E19 A;  3UE5 A;  4YDU A;  5FDL A;  1SQK A;  3MED A;  1IG9 A;  5LY3 A;  2XY5 A;  3L2W A;  1VSJ A;  4O55 A;  4WQ4 C;  3M6G A;  2YHW A;  1NM1 A;  3ID8 A;  1NK9 A;  3VEZ A;  3V81 A;  4BRE A;  2AJQ A;  5IT9 O;  2QXF A;  1REV A;  3CFO A;  2D5R A;  3ULD A;  3V4I A;  3SNN A;  1TK0 A;  3OYK A;  1S9E A;  3PY8 A;  1E3M A;  4Z4G A;  2VQF K;  1WSG A;  1WNS A;  2OPP A;  2BDP A;  5AQQ A;  1G15 A;  3OYA A;  3L2R A;  3RRG A;  4W5Q A;  4OO1 J;  3MEE A;  2ASC A;  1WUA A;  3G0Z A;  1SAZ A;  4IXC A;  3U9D A;  3CYG A;  3LDN A;  1WAF A;  4V19 S;  1ZBF A;  4JI2 K;  3WXL A;  3OJS A;  2MBK A;  3U3Y A;  5AQL A;  3UKR A;  1TAU A;  2O8C B;  4R79 A;  4IFV A;  2BH1 A;  3PX4 A;  1LQI A;  4M42 A;  2B5J A;  4WFN L;  3SCX A;  4AHC A;  4FW2 A;  1IKX A;  2FBX A;  3OYB A;  4FLY A;  4LF7 K;  4MLE A;  2QW9 A;  1FKP A;  1VQ7 N;  2VG6 A;  4ICL A;  1K8A O;  2NUB A;  1AYJ A;  2P9L B;  1XQS C;  5AZI A;  5JIC A;  1HNZ K;  3SUQ A;  4BC3 A;  3QET A;  4YOR A;  1U4B A;  4DV4 K;  2P5G A;  3L4Q A;  1KRP A;  1WAJ A;  1RBT A;  1ZYW A;  5C24 A;  1U04 A;  2RHK A;  4AHV A;  3P5J A;  3K9J A;  1LAV A;  1SL0 A;  2BGG A;  4CJU A;  1J6Z A;  2P9U A;  4K42 A;  4OKJ A;  1A5X A;  3I33 A;  3HL8 A;  3FZF A;  4JKA A;  4MFB A;  4OPH A;  2Z1J A;  1N6Q A;  5M1O A;  1P90 A;  1LQQ A;  1TL1 A;  4FWR A;  3MXI A;  5BRE A;  3C6T A;  5KGX A;  1W7A A;  1XHX A;  3A8Y A;  1VQ8 N;  1QSY A;  1SN1 A;  4GMJ B;  3TSU A;  3NH0 A;  1J5E K;  4UAD E;  4FK0 A;  4DV6 K;  1EWR A;  2JWL A;  2X78 A;  4X64 K;  4NXN K;  4JS4 A;  4HCB A;  2RE2 A;  3DRP A;  3SBT A;  4JKB A;  4JI8 K;  4LD0 A;  2F96 A;  2E2Q A;  5DM7 L;  3CC7 N;  4J2A A;  3U6F A;  3S3O A;  5GAD P;  5F2R A;  4NLB A;  4CJP A;  3BDP A;  1ATR A;  2Y1I A;  1C0M A;  2D0O A;  3GE1 A;  3VN5 A;  4CF2 A;  5JEN A;  3A5O C;  4OJR A;  4YY3 K;  1DQ7 A;  3MXJ A;  5HP1 A;  4B3M K;  4CEZ A;  4CZG A;  3VQP A;  1JXC A;  4KHU A;  3ENO A;  1VQO N;  1OVQ A;  2IS3 A;  3O9S A;  2BTF A;  4OKK A;  3AA3 A;  3THX A;  3QI7 A;  1WWN A;  3ZSW A;  4JI1 K;  3KTQ A;  2E3G A;  3NVM A;  4LFC K;  1BUP A;  4IO9 L;  1L5U A;  2KFN A;  1QQM A;  4F9O A;  4I2Q A;  2CGJ A;  5IWA K;  4BC4 A;  2C1G A;  3G10 A;  3GL1 A;  1XRS B;  4KTW A;  1GOC A;  1ICA A;  3PV8 A;  5J1E A;  3HPH A;  4F2R A;  3KLG A;  2HHW A;  1RBU A;  2ZE2 A;  5HRO A;  5MLC Q;  4FK2 A;  3VEV A;  4O0I A;  1NRB A;  1JLG A;  3NF9 A;  2D0C A;  4CI6 A;  5FRO A;  3VA3 A;  1ZXO A;  3SV4 A;  3NE6 A;  3E66 A;  4DHY A;  1D4X A;  1KCF A;  1JLQ A;  4RTF D;  3ZSZ A;  4IDH A;  3RTV A;  4KH5 A;  4DB3 A;  1OKJ A;  1BK8 A;  2A6A A;  5AFU A;  1O1W A;  1WT7 A;  2GUP A;  1WLJ A;  2ZGZ A;  5KQD A;  2KKZ A;  4KKO A;  1VSL A;  3OJU A;  1N36 K;  3VET A;  1L3V A;  4CZI A;  3RSE A;  4YOW A;  3NMU A;  3D45 A;  1YJN N;  4I6M B;  5BR9 A;  4KHW A;  5AR0 A;  1C0G A;  1JLE A;  2VG7 A;  1U47 A;  1GLA G;  5ADX A;  4FJ8 A;  3E1Y A;  3QO9 A;  4UQG A;  5E26 A;  3OYJ A;  1NKE A;  4DQI A;  3O4N A;  1SL2 A;  3TTF A;  2P9K B;  4I9L A;  2VWJ A;  3THY A;  1VK0 A;  3ZET B;  3ZT0 A;  4BDY A;  2JGU A;  1IG8 A;  4JHD A;  1RTH A;  1MDU B;  4BEC A;  4H03 B;  1VSK A;  4ISF A;  3VES A;  1RT3 A;  3ITH A;  2KBJ A;  3LPT A;  1GLD G;  2A1S A;  1VQ5 N;  3J8A A;  4KHN A;  5J2Q A;  5C42 A;  1XI1 A;  3CME N;  1TYQ B;  2UXC K;  4DS5 A;  3PO5 A;  2LSN A;  4I7F A;  5CYM A;  5JLH A;  4IEE A;  4DV1 K;  2V51 B;  4PKI A;  3DXM B;  4DG1 A;  3DYA A;  1NGE A;  4CBU A;  1LAW A;  5GIO A;  3IKM A;  4Y1C A;  2IOC A;  4HCC A;  3TAR A;  3NF7 A;  4BR5 A;  3IDH A;  1BMR A;  1BWF O;  1HYV A;  2EHG A;  4CZH A;  4M7Y A;  2F8S A;  4FJH A;  1D9D A;  4BWM A;  4H0P A;  1W2B M;  2YNH A;  3O9U A;  4DF4 A;  1S22 A;  2KBK A;  4CJV A;  3T7Z A;  3C0B A;  4E7I A;  4NB4 A;  3O80 A;  4W5R A;  4IG3 A;  4CK2 A;  4HTU A;  3TPQ A;  3WEE A;  4LF6 K;  3O3F A;  2Q31 A;  5J2N A;  1XMO K;  1NLV A;  3VER A;  1KQS M;  1S9G A;  5HRR A;  4JI6 K;  4BVP A;  4A62 A;  1BG3 A;  1YJW N;  5CZ2 A;  3HYF A;  1T1T A;  1DEJ A;  4FJJ A;  5AQN A;  4JYA K;  3D2F B;  2E0H A;  5AJ3 K;  1NGJ A;  2P9S B;  3H6E A;  3GG4 A;  2MZ0 A;  4HWI A;  4FWK A;  5BR8 K;  3AA2 A;  3NHG A;  5KPR A;  1GLJ O;  2IVN A;  4HUG A;  2UUC K;  3QES A;  2W41 A;  3ZSY A;  4PY5 A;  3MCP A;  4CJL A;  5SWM A;  5FPM A;  1BQM A;  3HPG A;  4H0V B;  4OX9 K;  1EET A;  1L3T A;  4K8X A;  3HT3 A;  1S1T A;  2LJ7 A;  4BR4 A;  3PSI A;  5TKW A;  3ZCM A;  3AVB A;  3D7E O;  1P0A A;  4BWJ A;  1LQH A;  5C25 A;  3H45 C;  2LI7 A;  3VEN A;  3AVJ A;  3JSM A;  3IG1 A;  3RMA A;  4BRN A;  4LFB K;  1RDW X;  5KTQ A;  3H3N O;  4IOA L;  1RGI A;  2Q97 A;  3H46 O;  4CGH A;  2QWM A;  3EKU A;  3B8A X;  3VTI A;  3SUN A;  3W0L A;  1C55 A;  2OPQ A;  4I2P A;  4ILH A;  1NJX A;  4IJN A;  2RF2 A;  3L2U A;  1SL1 A;  2G8H A;  4M3W A;  4OVL A;  4RG8 A;  4CHZ A;  4O4G A;  1ZVG A;  2X6S A;  3OYN A;  5FPE A;  1XUP O;  2C1I A;  2QXL A;  3I56 N;  5AQO A;  3BF1 A;  5HRS A;  1NWK A;  3IAY A;  1HYS A;  2PAV A;  4O8K A;  4QS7 A;  3J81 O;  3IMX A;  4R5P A;  2UXB K;  1KVA A;  1RFQ A;  3PSM A;  3MWP A;  5I9E B;  1MWK A;  2ZD1 A;  4GVE A;  5KGW A;  1DTQ A;  1D5A A;  3MAQ A;  4IG0 A;  1WSE A;  4GW6 A;  3CJA A;  4LF4 K;  1W9H A;  3SBG A;  1NK5 A;  2KBH A;  4DFK A;  4DSI A;  1NGG A;  3FFK B;  1N4N A;  4DS4 A;  1YUW A;  3L56 A;  2N2R A;  1Z05 A;  4X65 K;  3K5O A;  1YJ9 N;  4M7X A;  3CCU N;  3HK2 A;  4CES A;  1M90 O;  2F9W A;  4W5N A;  4CBX A;  2A41 A;  4JKH A;  1Q9Y A;  2LY5 A;  3OYL A;  3CJ7 A;  4HTL A;  5M1K A;  4BRP A;  4M3X A;  3WXJ A;  3FGU A;  3O4W A;  3WNE A;  3NH2 A;  4K25 A;  4CIG A;  1BCM A;  1U6Z A;  2I7P A;  4DR2 K;  1VQN N;  3PO4 A;  4DLG A;  4JI4 K;  1JLB A;  3AVH A;  5GAE P;  2QK9 A;  3AVN A;  4NXM K;  3J80 O;  4Z94 A;  1CLQ A;  2QEX N;  3CCQ N;  4AM7 A;  1RDB A;  2KGQ A;  1E4G T;  4CJK A;  3CG7 A;  1NKB A;  2E5L K;  3OW2 M;  4FWL A;  2KJA A;  1UA1 A;  4WFA L;  1HRH A;  4L8R B;  3HRG A;  1LCU A;  1WSI A;  1IKW A;  4BVO A;  1HX1 A;  4BAC A;  1HLU A;  4BC2 A;  4V1D C;  1JZA A;  1VRU A;  4CGF A;  4KPY A;  4I6M A;  1KSP A;  3CQX A;  4B8A B;  2E6M A;  3FZL A;  4PUO A;  2PY5 A;  2G2K A;  4BR7 A;  4IZ9 A;  2A40 A;  2D0A A;  5GIN A;  4JRQ A;  3TAF A;  2XY6 A;  3TAE A;  2P9K A;  3SPY A;  4JS5 A;  3DAW A;  1ESV A;  4RCH A;  4OPK A;  3NGY A;  4B1Z A;  2O4G A;  3DM2 A;  5M1F A;  4L3Q A;  3K57 A;  3KP1 A;  3C94 A;  1T6C A;  4QAG A;  3NF6 A;  4MO4 A;  3HBT A;  3THX B;  1LWF A;  1TYQ A;  3MN9 A;  3GDQ A;  1YIT N;  2Q1N A;  4KYP A;  2I5J A;  4FJK A;  4B3T K;  5DK5 A;  5C15 A;  3JAM O;  1Z25 A;  4GV6 A;  2GX9 A;  3AO2 A;  2YHY A;  2GEL A;  2VYP A;  3QEW A;  3DMJ A;  3V9W A;  4E7H A;  4FZY A;  2HHV A;  2YC1 C;  1C0T A;  4HUE A;  3R1X A;  3RMB A;  1PX9 A;  4BRM A;  5GAG P;  3QFU A;  4B9L A;  3SMP A;  4M45 A;  2ZJR L;  4KAZ A;  2QWO A;  2B3C A;  3DWL A;  3CCL N;  5AQU A;  4KFB A;  5GAH P;  4E1N A;  4YOU A;  5AQP A;  4CHO A;  4FWS A;  1JZB A;  1BA1 A;  3HP6 A;  4YOX A;  4XIU A;  4DQ8 A;  2HMI A;  4O5F A;  3DJC A;  1XNR K;  3R3L A;  4A2B A;  1DJT A;  3MN5 A;  1HYZ A;  2P51 A;  4ILG B;  1T0Z A;  2ZJP L;  1VSH A;  1GOA A;  2G8U A;  3A0I X;  1YT3 A;  3M3Z A;  1I2V A;  3V1R A;  3CC2 N;  2W40 A;  3LM2 A;  1NU0 A;  5JVG L;  3SPZ A;  1WSJ A;  4BR9 A;  3J7A P;  2DY4 A;  4TSX A;  4DTR A;  3MMV A;  2HBL A;  4BGA A;  3AVG A;  4FOI A;  4DQR A;  3K5M A;  5FRM A;  4DR1 K;  5KPZ A;  4CFB A;  3G71 N;  4FVU A;  4FCY A;  3LAN A;  2IDO A;  5KPT A;  2A3Z A;  3LZJ A;  4JHD B;  4OGE A;  3TAM A;  2LKB A;  1N33 K;  2D56 A;  4FM0 A;  5HRN A;  4MDB A;  3KLH A;  3EY1 A;  3EYZ A;  1Q81 O;  2O8E B;  2FC0 A;  1GPS A;  5AQV A;  3VF4 A;  4AHS A;  3DRS A;  1ASW A;  1UA0 A;  1R59 O;  1VAZ A;  3CD6 N;  4M63 C;  1B9F A;  3N4P A;  1QSL A;  1MA9 B;  4CEE A;  5JMV A;  3AVK A;  4CE9 A;  1VHX A;  3AVA A;  1ASU A;  4BY9 C;  1LW0 A;  1CZA N;  4DV3 K;  4CEQ A;  3KOZ A;  1NOY A;  3UB5 A;  3P4I A;  1NOZ A;  3THW A;  2HHX A;  1RIL A;  3M1F A;  1LV5 A;  3CJC A;  5AQR A;  4Z4C A;  2BE2 A;  3DOL A;  4WF9 L;  2XO7 A;  3T69 A;  2YIL A;  4FW1 A;  3MWT A;  2O8B A;  3KHW A;  2ZF5 O;  3WEE B;  3ZSR A;  2E3F A;  4ZTF A;  4JNE A;  4CER A;  3S41 A;  3P83 D;  1R0A A;  1RTD A;  1QQN A;  3KHY A;  4X66 K;  4RWT A;  3CIP A;  4Q5V A;  1CXQ A;  4ELV A;  5HOO A;  3O1B A;  4DTJ A;  3A5L C;  4FWP A;  3OYF A;  1VQK N;  5BRH A;  3CF5 L;  4DTU A;  3C6H A;  5C0Y A;  5BPM A;  1GOB A;  4JAX A;  4XH1 A;  1KAY A;  4BR0 A;  4PWD A;  3AAR A;  1YVN A;  4E7L A;  1SKR A;  4WYB A;  4E3S A;  1HUX A;  1G99 A;  4C8M A;  2YV0 X;  3JYT A;  4UY8 O;  1I94 K;  3VEO A;  2EWS A;  4DTX A;  2QKB A;  1VRT A;  4LY7 A;  3DLE A;  3OVN A;  4KHY A;  3V9Z A;  2D4W A;  3DLG A;  1YTU A;  3DXK B;  3E9O A;  1NNE A;  2E2N A;  2RN2 A;  2X6N A;  3AGK A;  1NJY A;  2GEM A;  1RDU A;  2P5O A;  1KC8 O;  3BK3 C;  1X3M A;  1Z6R A;  2HBM A;  4LFA K;  4OLB A;  4KHS A;  1MR4 A;  1VQ4 N;  2PBD A;  2M8B B;  2YNF A;  4AEI A;  1C6V A;  3HI0 A;  1VQL N;  1C1B A;  4FPB A;  3MN6 A;  4B1X B;  1NGF A;  3LP2 A;  4KI4 A;  3VF2 A;  1UOC A;  3R2V A;  3DLK A;  1X1P A;  2HW3 A;  3BP8 A;  4OLA A;  3AAP A;  1SV5 A;  4KHQ A;  4HHF A;  3MCA B;  2OTL N;  4FWM A;  1HKG A;  1C1A A;  4JI0 K;  4CVN E;  3FZK A;  2NNW A;  2I7N A;  4E1M A;  1CHZ A;  3WQU A;  2OA8 A;  3P31 A;  3EE8 A;  3TAB A;  4BRO A;  1XC9 A;  2VWK A;  3RR8 A;  4CIF A;  4U7B A;  2ASP A;  4BRC A;  4M3T A;  1GPT A;  2E4L A;  4BDZ A;  1T7E A;  4LH5 A;  3T3F A;  4CHQ A;  2X74 A;  5AQG A;  2PZS A;  1HKC A;  2G8F A;  3OYD A;  3GKU A;  2KQ2 A;  1VSD A;  1LW2 A;  1NK7 A;  2ZJQ L;  4OKE A;  4HUF A;  2G8I A;  1YVU A;  1Y64 A;  4J8F A;  5BRF A;  3W3D A;  1KXP A;  1Q8I A;  1SKW A;  5GIP A;  4FWO A;  2KZM A;  1N5Y A;  3PX6 A;  4FLV A;  3O9T A;  5SZT A;  4CEB A;  4M3Y A;  3G25 A;  4H5T A;  2V52 B;  2G8K A;  4A61 A;  1U49 A;  1HKB A;  4IFY A;  1HPZ A;  4DTN A;  3EO3 A;  3NBP A;  3MXM A;  1RNH A;  3HJF A;  3KIO A;  4WCE L;  3LDL A;  4GNI A;  2KW4 A;  3SJH A;  2ZM6 K;  4BRF A;  5AQK A;  2NLX A;  4JKD A;  3I8D A;  2XRI A;  4J2E A;  5AQH A;  4LF8 K;  1BL3 A;  1NK6 A;  3OYC A;  1VQ9 N;  2BRZ A;  1WB9 A;  1BOT O;  2H3G X;  1HPM A;  3OBW A;  3OS0 A;  1BDG A;  4Z4H A;  3S3M A;  3LWM A;  3K0S A;  1BHL A;  3K59 A;  2QWL A;  1L3S A;  3KD5 E;  4FPA A;  1I3A A;  1WOQ A;  3LDQ A;  3VGM A;  3QEP A;  1EKE A;  3VGK A;  3TAP A;  2ETJ A;  3VPZ A;  1NGA A;  4BRG A;  3H3O B;  1BRZ A;  2V7Y A;  2KLA A;  5KRT A;  4DR6 K;  1YIJ N;  4WQ4 A;  3ZX3 A;  4KO0 A;  3KKS A;  4B08 A;  3UKU B;  1XHZ A;  5A2Q O;  1ZBH A;  4ID5 A;  1QHA A;  1IBK K;  1T44 A;  1QE1 A;  2OPR A;  2YJF A;  1TI5 A;  3HVR A;  3TWH A;  1HMV A;  1IBL K;  4CJR A;  2O8E A;  1XMQ K;  1S6Q A;  3HZ6 A;  2ITM A;  3CCM N;  1IO2 A;  3CCR N;  3ID6 A;  3L3V A;  4E72 A;  4UJ0 A;  4EP5 A;  1SN4 A;  2D0P A;  1QVF M;  2QM1 A;  4FJ9 A;  3VEY A;  1HR0 K;  4FSV A;  1O13 A;  2YEO A;  4CFD A;  1KTQ A;  2KZZ A;  4GY2 B;  4H5W A;  3QML A;  4DR3 K;  2MN5 A;  4AAZ A;  1S1W A;  4Z4I A;  3K9K A;  3J7Y P;  1D8Y A;  1POI A;  4LF9 K;  3O3H A;  1TV6 A;  2ATB A;  4B9Q A;  4FLX A;  3K2P A;  4JI3 K;  3MX2 A;  2DFF A;  4KH6 A;  1VSF A;  3CPW M;  1LWE A;  4B1Y B;  1XNQ K;  1IKY A;  4BRH A;  1ZUT A;  5ELZ A;  2YKN A;  2NY8 X;  3I8B A;  4CW7 B;  3KK2 A;  4N76 A;  2HNZ A;  3MDQ A;  1BI4 B;  3BF3 A;  2IGI A;  1BIU A;  2IAJ A;  3VQ9 A;  3CER A;  4CJ5 A;  3VTH A;  2WFB A;  2YJE A;  3VQ4 A;  5TKY A;  3CI5 A;  4DSL A;  1U2V B;  2Q0U A;  3LP3 A;  3WNG A;  1OH5 A;  3PUF A;  2W00 A;  5AQJ A;  5AQX A;  2QI2 A;  1NJZ A;  1ASV A;  4B1V A;  3EZ5 A;  2P9I A;  2ZWH A;  1T7A A;  3OYG A;  4OPJ A;  1UGL A;  2OPS A;  2YNI A;  4NCG A;  4N47 A;  4RW7 A;  4CZL A;  4X62 K;  1TK8 A;  4DCH A;  4C8O A;  2HVH A;  3M8S A;  3CC4 N;  1WN7 A;  3CM6 A;  5B8H A;  1J9A A;  4CEO A;  3OBY A;  1OVY A;  3VQB A;  4EFH A;  4B3O A;  3DXK A;  2Q0R A;  3AVL A;  1PTX A;  3O5B A;  2DPN A;  3RR7 A;  1N32 K;  1SKS A;  2YI1 A;  2KYQ A;  5AQF A;  4F8R A;  1BO5 O;  3Q7B A;  4BRI A;  1TK5 A;  1JLA A;  1SZ2 A;  4QS9 A;  2GTD A;  4EZ9 A;  3DOK A;  1S1V A;  1JLC A;  1QZ5 A;  1I6F A;  3VF6 A;  5AQT A;  1ZBI A;  5BPL A;  3AAQ A;  4A2A A;  4DUY K;  4EAH D;  3HST B;  3O8M A;  5JS1 A;  4JN4 A;  3HM8 A;  4LH4 A;  1WBB A;  4A5A A;  3SQ1 A;  2HBK A;  3CHW A;  3THW B;  3CQY A;  4MLH A;  1K9M O;  4WE1 A;  1Q86 O;  4B9T A;  4DSF A;  1VSM A;  4Q0B A;  3K58 A;  3OYM A;  1TVR A;  3TTD A;  3HP9 A;  2WON A;  2UUB K;  4F2S A;  3H08 A;  4PQU A;  3MEC A;  2O8B B;  1UAX A;  3C6U A;  3AO5 A;  4FLU A;  2J4R A;  4ILJ A;  3CFR A;  2RPI A;  5C2D A;  4YDU C;  1X9S A;  4JI5 K;  1DT9 A;  4PKH A;  4E7K A;  4DF8 A;  3BZC A;  3LDP A;  3ULE B;  2KSK A;  1U45 A;  3QFP A;  1HQU A;  1MYN A;  4XH4 A;  4XJX A;  1JL2 A;  1K8B A;  4CEF A;  2HST A;  4KTZ A;  4CIE A;  1Q7Y O;  4NCB A;  4OPA A;  4BR2 A;  1TKD A;  4IOX A;  3F5T A;  4G9Z A;  1RTI A;  1AHO A;  3D6R A;  1PE4 A;  4BRL A;  1RT7 A;  4DR4 K;  2IVP A;  5BN8 A;  3KKR A;  3E7U X;  3A2F A;  4RW9 A;  4BRQ A;  3KP0 A;  1S1U A;  3QNN A;  1MWM A;  3PX0 A;  4CJ4 A;  2B6A A;  3IUC A;  4LSL A;  3AO3 A;  3L6Q A;  1D9F A;  3CM5 A;  3AVM A;  3H1V X;  2E2P A;  3ATU A;  1VSI A;  4C1N I;  5JS2 A;  4BQL A;  4FJI A;  4CGD A;  3LAK A;  3AA5 X;  2WTU A;  2NRT A;  2Z1G A;  1HNW K;  4AH9 A;  2HOE A;  4M3U A;  4FK4 A;  3WQT A;  2HB5 A;  2Q2R A;  4FLT A;  3VQ7 A;  3QER A;  4FJX A;  1WBD A;  1JL1 A;  4KTQ A;  2VG5 A;  3U4L A;  3NCI A;  4CD1 A;  1GLB G;  1OH6 A;  4HHT A;  1Q18 A;  4U67 L;  4EHU A;  3TAQ A;  2IC3 A;  1IJJ A;  4CF9 A;  1KAZ A;  1M1K O;  1QQC A;  4BDP A;  1NGC A;  5DM6 L;  3K5N A;  3UKU A;  5CR4 A;  1NGH A;  1T05 A;  3QDK A;  1RDD A;  3P39 A;  3VA0 A;  3A5N C;  1CZ9 A;  5AQI A;  2OCE A;  1SUQ A;  3U9Z A;  5KK4 A;  2P9N A;  2GUI A;  4KBO A;  4CJW A;  3P1G A;  4MO5 A;  3C6A A;  2E20 A;  2GV9 A;  1EO1 A;  3A5M C;  3NDK A;  3HO1 A;  1EP4 A;  5C10 A;  1NG9 A;  1SNB A;  3L2V A;  2PYJ A;  1B92 A;  3AVI A;  4DSE A;  4QCL A;  1GLF O;  5AZJ A;  5LMN K;  2O8F A;  3IFR A;  3B6P A;  4A59 A;  5AQZ A;  2E1Y A;  3SI6 A;  3ASM A;  1LWC A;  3EEQ A;  4GKJ K;  1T7B A;  1WSF A;  2IIR A;  1YF5 L;  3OHR A;  1KFS A;  3ISN C;  3L8B A;  1S3X A;  3ZYY X;  2E2F A;  2F8T A;  1U48 A;  3ZX2 A;  5CHI A;  1BU6 O;  4DQS A;  4B9N A;  2FBT A;  3O9R A;  2QWP A;  1NGI A;  1BI4 A;  5T7B A;  3SAG A;  3KK1 A;  1NH5 A;  3M8R A;  3C7N A;  2G8W A;  4BRA A;  3ENH A;  2NRX A;  4M41 A;  4CFA A;  1U2V A;  1S72 N;  4BRD A;  4DWI A;  4FJM A;  2Z1H A;  3SV3 A;  1EQY A;  1KD1 O;  4JK7 A;  3AVC A;  1DKG D;  1HJO A;  2ASM A;  2ZQB A;  1C0U A;  3RMC A;  4O8U A;  3S5T A;  3CCE N;  4EHT A;  5M1P A;  4ZHR A;  4QS8 A;  2FF6 A;  3D0P A;  3B6O A;  4CHN A;  2QKK A;  4FJ7 A;  5BRD A;  1C56 A;  1EWQ A;  4KH4 A;  4DU1 A;  1SEG A;  3OA9 A;  1IKV A;  4NO7 A;  4DR5 K;  1Q9X A;  4JKC A;  1DGK N;  4CBW A;  1WSH A;  4JK9 A;  4RW4 A;  3ZSV A;  4DTM A;  4KB0 A;  4C8N A;  2JWK A;  1GLC G;  2NRZ A;  1V4T A;  4O5B A;  3E01 A;  3DLH A;  1BIS A;  3QIP A;  2UU9 K;  2NZT A;  2WUS A;  4CJ7 A;  1GLE G;  1FJG K;  4CGJ A;  3IS9 A;  3OS1 A;  4H5R A;  1P8Z A;  1NK4 A;  4B9U A;  2PFU A;  4IO8 A;  3TU5 A;  1TUY A;  1QVG M;  3WUH A;  3VEW A;  5C12 A;  5BN9 A;  2ZGY A;  4H4M A;  4DTO A;  3KWI A;  1NPI A;  3JS6 A;  4BE0 A;  1P00 A;  4AM6 A;  1FW6 A;  5K14 A;  4CEC A;  3BEX A;  1FH3 A;  1RT2 A;  2GBZ A;  2YIO A;  3L0Q A;  4BC5 A;  3KZB A;  1QSS A;  1TKT A;  3HOS A;  3AO4 A;  1YAG A;  3ULE A;  1RT5 A;  3NAE A;  1VQM N;  4WQ5 A;  3EE9 A;  1RT6 A;  4GKK K;  1TAQ A;  1BIZ A;  1IBM K;  2P9I B;  5HLF A;  2LY6 A;  2F7T A;  4AHT A;  4E89 A;  4KI6 A;  5F0X A;  3MEG A;  3F9K A;  3QEX A;  2XHB A;  4FJG A;  3OYE A;  1K8K A;  2VCP A;  1NK0 A;  3VQD A;  1KFD A;  4ELT A;  3WT0 A;  1T03 A;  3NGI A;  1NKC A;  4FWN A;  2QWN A;  4ID1 A;  5KRS A;  4G1Q A;  1OMY A;  2YNG A;  1YHQ N;  5M1Q A;  3AVF A;  3SZ2 A;  3VQE A;  3MX5 A;  4A57 A;  3E7R L;  4CZK A;  1JKZ A;  4IFE A;  5AQM A;  1ZC6 A;  3DLB A;  2E2O A;  3FZM A;  4K43 A;  1NGD A;  1FK9 A;  2FBV A;  4ELU A;  4YOT A;  2KHO A;  3VQ8 A;  4N41 A;  3SQ4 A;  3DLL L;  2R7Y A;  1NJI O;  4BE2 A;  1ZVE A;  2AA4 A;  3O6W A;  4C8L A;  3T1A A;  3KJV A;  4DTS A;  4DFJ A;  2DFH A;  3PIP L;  3G6E N;  3EKS A;  2FSJ A;  2HNY A;  5FLX O;  4IJA A;  3CJB A;  2YX6 A;  2LJM A;  4C8K A;  4FXD A;  1KAX A;  3SMS A;  3FLC O;  2E6L A;  4ISG A;  1NBW A;  4PL7 A;  1NK8 A;  4FYD A;  1T8E A;  1T7P A;  1N8R O;  3QNO A;  4J2D A;  3C65 A;  1CXU A;  2G8V A;  1J5O A;  5CY4 A;  3CJ1 A;  4B9S A;  3ZLJ A;  3LZI A;  3SLC A;  1HNX K;  5AFU H;  3ZT3 A;  5EY4 A;  3OYH A;  4K8Z A;  4JLH A;  3WNH A;  2ASO A;  4JKG A;  1QHT A;  4Y0W A;  4PKG A;  1TKZ A;  3ZX0 A;  3I55 N;  4MQ3 A;  4JRP A;  1TKX A;  3M8Q A;  4JD2 B;  3CXC M;  1CZB A;  4DFM A;  4PL8 A;  2HMP A;  4BGB A;  4EP4 A;  1V4S A;  4JI7 K;  5ADX H;  4F4K A;  4JK8 A;  1E4F T;  4FVM A;  4K0K K;  3BZK A;  3HVT A;  4KRE A;  1VNB A;  2KPY A;  3FR0 A;  3VQ6 A;  3ZSQ A;  3KLE A;  3TI0 A;  3T19 A;  3N4Q A;  2K35 A;  1NE5 A;  2XY7 A;  3QIO A;  5FPN A;  4I9Q A;  3QEI A;  5LJV A;  3SQ2 A;  3CJ9 A;  1DTT A;  4MDA A;  1A5W A;  1OH8 A;  5I3U A;  5EX5 A;  2NY9 X;  5LJW A;  5EOY A;  4FM2 A;  4DV7 K;  2VGN A;  3GBT A;  4W5T A;  2A1R A;  3SAF A;  3OS2 A;  1X9J A;  3EZW A;  2NRH A;  4DU4 A;  1JKH A;  3ZT2 A;  5EXW A;  3IRX A;  4KHP K;  3D2E B;  4WFB L;  2FXU A;  2NRR A;  3SJJ A;  3RRH A;  4CK3 A;  1T6D A;  4GV3 A;  3LAM A;  4YHH K;  1VQ6 N;  3KC6 A;  1FKO A;  3ZSX A;  2E88 A;  1XWL A;  3I0S A;  3VMF B;  5EVZ A;  1S5J A;  3HPO A;  3OYI A;  4ZTJ A;  4DV0 K;  3P38 A;  3R9P A;  2O8D A;  1JCG A;  4BG8 A;  4IEI A;  4UAE F;  4Y1D A;  5KQ8 A;  3PIO L;  1VQP N;  3M8P A;  2GWJ A;  3GOI A;  4PHT X;  3NVK A;  4DV2 K;  4K41 A;  4GV9 A;  1RT1 A;  2P9N B;  4LC9 B;  3LP0 A;  2B4J A;  3WXM B;  2P9P A;  4IBN A;  3O4Q A;  2NRV A;  4CFC A;  4H0Y B;  3ALY A;  4EZ6 A;  2BAN A;  2JLE A;  1W0H A;  3HOT A;  4FWQ A;  4RW6 A;  3KVG A;  1I39 A;  2HHI A;  2HBJ A;  3KOW A;  1NGB A;  2LN8 A;  1NMD A;  3QLH A;  3TR8 A;  2FLO A;  4B3R K;  5H1S Q;  3H1Q A;  2P1J A;  3VOV A;  1C0F A;  3AA4 A;  5AZJ B;  4FLZ A;  2O8F B;  5F1X A;  3SUO A;  4JKE A;  4NLC A;  1FXX A;  4IKF A;  2Q3S A;  4FJN A;  2YHA A;  2XY8 A;  3NGZ A;  1BGX T;  4NCA A;  1C1C A;  3ZT4 A;  3HSC A;  3J7Z O;  1EX4 A;  1BQN A;  1W97 L;  1ZYV A;  4C23 A;  1J53 A;  3O9Q A;  4YNQ A;  3K5L A;  4B9V A;  1HNI A;  4CJE A;  3V9U A;  2CH6 A;  4FJL A;  3LP1 A;  4AF1 A;  4O0J A;  1ZBS A;  4E1J A;  3TAN A;  4ISE A;  3QIN A;  1HNV A;  3VQA A;  3C7N B;  2SN3 A;  3V1O A;  3G4S N;  3RWU A;  4Z4E A;  2LT8 A;  4IDK A;  1ZBL A;  4JEP A;  2OTJ N;  2O4I A;  1JJ2 M;  3V6D A;  2FF3 B;  2JDQ D;  4CZJ A;  5HRP A;  1RBS A;  4CED A;  2O8C A;  4DQQ A;  4EIA A;  1JCF A;  1A5V A;  4PA1 A;  2WOM A;  2D1K A;  1NJW A;  1JLF A;  5KI6 A;  3KLF A;  3UIQ A;  2B68 A;  4C1N K;  2CH5 A;  3VGL A;  1TL3 A;  4KV8 A;  2HHT A;  2ITG A;  3AO1 A;  1KVC A;  2HND A;  2HHU A;  2P9L A;  3ZEU B;  2YKM A;  4FZX C;  4DQP A;  1ZBU A;  2W6L A;  3QBW A;  1QS4 A;  5CZ1 A;  1SS6 A;  2W42 A;  3QIC A;  1K6Y A;  4BRK A;  3LPU A;  4KB1 A;  3LM9 A;  4CJS A;  3TAG A;  1EXQ A;  2GMO A;  4CJF A;  1KLM A;  1YXQ A;  4CZE A;  3ZT1 A;  1XC3 A;  3JXU A;  3WXK A;  3L4I A;  4AB0 A;  2YBR C;  3ENB A;  4AHU A;  1ILY A;  4B3S K;  2DTU A;  4CF1 A;  5HL7 L;  3CCS N;  2W6K A;  3WNF A;  4E0D A;  2YIP A;  1ZYQ A;  1VNA A;  5FPD A;  1YTA A;  2HHS A;  2OZS A;  2N66 A;  3O3G A;  1DLO A;  4FM1 A;  3CFP A;  1QZ6 A;  4CJ3 A;  5JLF A;  1Q82 O;  3LL3 A;  4H4O A;  3F9M A;  4F3O A;  1MU2 A;  1JCE A;  2BUP A;  2HF3 A;  1B7D A;  3U8X A;  3SUP A;  3FE1 A;  3KOX A;  3LDS A;  3AV9 A;  3TSP A;  5CE3 A;  1F21 A;  3F2K A;  3MK6 A;  4CD3 A;  5AQS A;  2PYL A;  3HTV A;  2E8A A;  4CZM A;  2OZM A;  4DMN A;  4UAF E;  1S6P A;  3TSQ A;  3CPE A;  1UWB A;  3I0R A;  3Q7C A;  4CJQ A;  3SF4 D;  4H0T B;  4CHP A;  4GVM A;  3QB0 A;  4BEB A;  2UYT A;  3CQ8 A;  3AGR A;  4CGI A;  1WMT A;  3UKR B;  5LMU K;  4CGG A;  4CZF A;  1ZFU A;  5CYQ A;  3EL2 A;  5DMR A;  1S1X A;  2A42 A;  1K8K B;  4LSN A;  5CY0 A;  3VEX A;  4JD2 A;  2VQE K;  1NMN A;  4BG9 A;  3R6M A;  4FO0 A;  4M3Z A;  3KK3 A;  2KFZ A;  4B9M A;  3QBX A;  4CHY A;  1RDA A;  3E9P A;  4B8C A;  5AZI B;  4NYN A;  2GWK A;  4O44 A;  2CGK A;  4H5V A;  4RW8 A;  3O08 A;  1HJR A;  3DRR A;  1BCG A;  4H5N A;  3T1H K;  1I2U A;  3LDO A;  5C2F A;  3KK7 A;  2N69 A;  2Q36 A;  4HE7 A;  1B3C A;  3F73 A;  3ZSO A;  5E41 A;  1TGO A;  4WQ5 C;  3KOY A;  4CQK A;  4YFU A;  4DUZ K;  4E7J A;  3RMD A;  1L4V A;  2D0B A;  2F9T A;  5I42 A;  1B9D A;  3U3G A;  4DR7 K;  1ATN A;  3R8E A;  4CK1 A;  3D2E A;  4DFP A;  4FL9 A;  4CF8 A;  1JXE A;  1L3U A;  2P9U B;  3KWG A;  4NYF A;  4F3T A;  2OAN A;  4Z0U A;  2A7T A;  4AQY K;  5FRN A;  1YI2 N;  2FBY A;  1KVB A;  1T3V A;  3V9S A;  3S9H A;  1KLN A;  3SQ0 A;  3VQC A;  4DTP A; 
#chains in the Genus database with same CATH homology
 2ZGY A;  2W41 A;  3O9T A;  3SAH A;  3MCP A;  3KWI A;  3JS6 A;  5FPM A;  3BUZ B;  1ATS A;  4H5T A;  3G25 A;  4H0V B;  3AY9 A;  2V52 B;  4AM6 A;  4A61 A;  2NRW A;  4IWV A;  4XH5 A;  4JKG B;  1HKB A;  1QQO A;  3BEX A;  4BR4 A;  3CCJ N;  2FSK A;  5TKW A;  3EO3 A;  2YIO A;  3L0Q A;  4BC5 A;  5JVH L;  3KZB A;  4H0X B;  4WCE L;  3LDL A;  4GNI A;  3D7E O;  3SJH A;  4BRF A;  5AQK A;  3HOS A;  1YAG A;  2NLX A;  4JKD A;  3ULE A;  1VQM N;  2V7Z A;  4WQ5 A;  3ZET A;  3EE9 A;  5AQH A;  3H45 C;  3VEN A;  1VQ9 N;  2P9I B;  2F7T A;  1BOT O;  2H3G X;  1HPM A;  5M1N A;  4BE7 B;  3OBW A;  4BRN A;  1BDG A;  1RDW X;  2VGM A;  3H3N O;  4IOA L;  2QTD A;  2QWL A;  1RGI A;  5F0X A;  2Q97 A;  3H46 O;  3O1W A;  2QWM A;  2YHX A;  4FPA A;  1K8K A;  1TUU A;  3B8A X;  3EKU A;  3VTI A;  1WOQ A;  4JKF A;  2VCP A;  3W0L A;  3LDQ A;  4B1W B;  2W00 A;  3VGM A;  5ADX H;  3WT0 A;  3DXM A;  3VGK A;  2HF4 A;  3VPZ A;  4ILH A;  4IJN A;  3ATV A;  1NGA A;  4BRG A;  3H3O B;  2QWN A;  4FWN A;  2V7Y A;  2KLA A;  1YHQ N;  1YIJ N;  4WQ4 A;  3ZX3 A;  5M1Q A;  3UKU B;  2E1Z A;  2QWR A;  3MX5 A;  5FPE A;  1QHA A;  1XUP O;  3CCV N;  2C1I A;  4A57 A;  1T44 A;  2QXL A;  2QA4 N;  4IOC L;  3PLA A;  4CZK A;  3I56 N;  2A5X A;  5AQO A;  2YJF A;  3BF1 A;  4IFE A;  4H0O A;  1NWK A;  5BPN A;  5AQM A;  1ZC6 A;  2E2O A;  3FZM A;  2PAV A;  3HZ6 A;  4K43 A;  4O8K A;  4QS7 A;  2ITM A;  3CCM N;  1X3N A;  1NGD A;  2VWB A;  3IMX A;  5E84 A;  1GLL O;  3CCR N;  3ID6 A;  2AP1 A;  1K73 O;  1RFQ A;  2WC9 A;  3RVC A;  3MWP A;  2KHO A;  3E9L A;  4YOT A;  1MWK A;  5I9E B;  4GVE A;  4DKW A;  3DLL L;  2D0P A;  1NJI O;  2YCH A;  3FZH A;  4B1U B;  3MN7 A;  1QVF M;  2QM1 A;  3VEY A;  2AA4 A;  4FSV A;  4FOE A;  5AQY A;  1O13 A;  3CJA A;  3O6W A;  3SBG A;  3TTC A;  3RSE B;  3CET A;  3CMA N;  4GY2 B;  3PIP L;  4H5W A;  3G6E N;  3EKS A;  1NGG A;  3QML A;  2FSJ A;  4A5B A;  3D2F A;  2MN5 A;  1H1V A;  3FFK B;  4IJA A;  3CJB A;  3WXI A;  2FSN A;  2YX6 A;  3K9K A;  1YUW A;  2P9S A;  1KAX A;  3L56 A;  3SMS A;  1POI A;  1Z05 A;  2WBN A;  3FLC O;  3SK3 A;  4ISG A;  1LOT B;  1NBW A;  4M7X A;  4PL7 A;  3CCU N;  1YJ9 N;  4B9Q A;  4BQZ A;  4YOY A;  1M90 O;  2F9W A;  3M5R A;  2P9P B;  4XEI A;  1BA0 A;  1N8R O;  2CGL A;  2VY6 A;  3ZEU A;  3C65 A;  2A41 A;  4JKH A;  4CBX A;  3MX2 A;  4KH6 A;  3CJ7 A;  4HTL A;  3CW4 A;  5M1K A;  4BRP A;  3CPW M;  3CJ1 A;  3WXJ A;  3FGU A;  3O4W A;  4B1Y B;  4K25 A;  3SLC A;  1U6Z A;  4BRH A;  5ELZ A;  2I7P A;  5AFU H;  5EY4 A;  3EN9 A;  3I8B A;  1VQN N;  4YOV A;  5AQW A;  2QWQ A;  2ASO A;  3MDQ A;  3BF3 A;  2IVO A;  4JKG A;  5GAE P;  3CER A;  3UE5 A;  4Z94 A;  3VTH A;  2WFB A;  3CCQ N;  2YJE A;  4Y0W A;  4AM7 A;  2QEX N;  4YDU A;  4PKG A;  1E4G T;  1SQK A;  5TKY A;  4WFB L;  3ZX0 A;  3I55 N;  5LY3 A;  3CI5 A;  1U2V B;  2Q0U A;  3OW2 M;  4FWL A;  4JD2 B;  4WFA L;  3CXC M;  4PL8 A;  2HMP A;  4WQ4 C;  4BGB A;  3M6G A;  5AQJ A;  5AQX A;  1LCU A;  1NM1 A;  1V4S A;  2QI2 A;  2YHW A;  1HX1 A;  3HRG A;  3ID8 A;  2P9I A;  4JK8 A;  3VEZ A;  1E4F T;  4B1V A;  4BRE A;  1HLU A;  2ZWH A;  4BC2 A;  3FR0 A;  4I6M A;  3CQX A;  4CZL A;  4DCH A;  3CC4 N;  3FZL A;  3N4Q A;  2K35 A;  5AQQ A;  5B8H A;  4BR7 A;  5FPN A;  4OO1 J;  4IZ9 A;  2A40 A;  5LJV A;  5GIN A;  3OBY A;  1OVY A;  3CJ9 A;  1WUA A;  4MDA A;  2P9K A;  4EFH A;  3DXK A;  5EX5 A;  2Q0R A;  5LJW A;  3DAW A;  1ESV A;  1SAZ A;  3O5B A;  4IXC A;  5EOY A;  3U9D A;  4RCH A;  2VGN A;  2DPN A;  3LDN A;  3GBT A;  4B1Z A;  2YI1 A;  5M1F A;  3SAF A;  1X9J A;  3EZW A;  2NRH A;  4L3Q A;  5AQF A;  3WXL A;  1BO5 O;  2MBK A;  5EXW A;  3D2E B;  3Q7B A;  4BRI A;  2FXU A;  5AQL A;  1SZ2 A;  1T6C A;  2NRR A;  4MO4 A;  4QS9 A;  3UKR A;  3HBT A;  2GTD A;  4R79 A;  1TYQ A;  1QZ5 A;  1T6D A;  2BH1 A;  3GDQ A;  3MN9 A;  4GV3 A;  1YIT N;  4WFN L;  3VF6 A;  2Q1N A;  5AQT A;  5BPL A;  3AAQ A;  4A2A A;  1VQ6 N;  3KC6 A;  4EAH D;  3O8M A;  2E88 A;  4JN4 A;  3HM8 A;  5C15 A;  4GV6 A;  2GX9 A;  2YHY A;  4MLE A;  2QW9 A;  4A5A A;  3VMF B;  1VQ7 N;  5EVZ A;  2HBK A;  2GEL A;  1K8A O;  2VYP A;  3CHW A;  3CQY A;  4MLH A;  1K9M O;  1Q86 O;  2P9L B;  1XQS C;  3P38 A;  5AZI A;  3R9P A;  5JIC A;  1JCG A;  4BG8 A;  3R1X A;  4UAE F;  4IEI A;  3TTD A;  5KQ8 A;  3PIO L;  1VQP N;  2GWJ A;  4BRM A;  5GAG P;  3GOI A;  4BC3 A;  4PHT X;  3QFU A;  3NVK A;  4YOR A;  4K41 A;  4GV9 A;  3SMP A;  2P9N B;  4LC9 B;  2J4R A;  4ILJ A;  2ZJR L;  2QWO A;  3DWL A;  5C2D A;  4YDU C;  3CCL N;  5AQU A;  5GAH P;  3WXM B;  3L4Q A;  2P9P A;  4YOU A;  5AQP A;  4FWS A;  1BA1 A;  1DT9 A;  4PKH A;  4YOX A;  2NRV A;  4H0Y B;  3LDP A;  3ULE B;  3QFP A;  2RHK A;  3HOT A;  4FWQ A;  3KVG A;  4DQ8 A;  4XH4 A;  4XJX A;  4O5F A;  3DJC A;  3K9J A;  3R3L A;  4A2B A;  2HBJ A;  1NGB A;  2LN8 A;  1NMD A;  1J6Z A;  3MN5 A;  2FLO A;  2HST A;  2P9U A;  5H1S Q;  4ILG B;  4K42 A;  3H1Q A;  1Q7Y O;  3VOV A;  2ZJP L;  4OPA A;  3I33 A;  1C0F A;  5AZJ B;  4BR2 A;  3FZF A;  4IOX A;  4JKA A;  3A0I X;  5F1X A;  4OPH A;  3F5T A;  4G9Z A;  4JKE A;  3D6R A;  3M3Z A;  4NLC A;  4BRL A;  3CC2 N;  2IVP A;  2W40 A;  5M1O A;  5BN8 A;  3LM2 A;  1P90 A;  4FWR A;  5JVG L;  4BRQ A;  5BRE A;  1MWM A;  3J7Z O;  3HSC A;  4BR9 A;  3A8Y A;  1VQ8 N;  3IUC A;  3MMV A;  2HBL A;  4BGA A;  1W97 L;  4FOI A;  3TSU A;  4C23 A;  4UAD E;  3L6Q A;  3O9Q A;  5KPZ A;  3G71 N;  4FVU A;  5KPT A;  3H1V X;  2A3Z A;  2E2P A;  2JWL A;  3ATU A;  4JHD B;  2CH6 A;  4AF1 A;  2RE2 A;  1ZBS A;  3SBT A;  4JKB A;  2D56 A;  4C1N I;  4E1J A;  4MDB A;  4BQL A;  1Q81 O;  2E2Q A;  4ISE A;  5DM7 L;  3CC7 N;  5GAD P;  5F2R A;  3C7N B;  4NLB A;  5AQV A;  3VF4 A;  1ATR A;  2NRT A;  3G4S N;  2HOE A;  2D0O A;  1R59 O;  3GE1 A;  1VAZ A;  3CD6 N;  3WQT A;  4M63 C;  3A5O C;  2Q2R A;  2OTJ N;  3N4P A;  4JEP A;  1JJ2 M;  4CZG A;  1MA9 B;  2FF3 B;  3ENO A;  5JMV A;  3U4L A;  2JDQ D;  4CZJ A;  4CD1 A;  1GLB G;  1VQO N;  3O9S A;  1Q18 A;  2BTF A;  4U67 L;  4BY9 C;  4EHU A;  3QI7 A;  4EIA A;  1JCF A;  3NVM A;  1BUP A;  4IO9 L;  1CZA N;  1QQM A;  2D1K A;  4F9O A;  1IJJ A;  2CGJ A;  1KAZ A;  1M1K O;  4BC4 A;  1VQL N;  3UB5 A;  2C1G A;  1NGC A;  3P4I A;  4C1N K;  5DM6 L;  2CH5 A;  3VGL A;  3GL1 A;  2P9L A;  3UKU A;  3M1F A;  3ZEU B;  3CJC A;  5CR4 A;  5AQR A;  1NGH A;  3QBW A;  3QDK A;  1SS6 A;  4WF9 L;  5MLC Q;  3P39 A;  3VEV A;  3T69 A;  3QIC A;  2YIL A;  3A5N C;  4BRK A;  3MWT A;  3KHW A;  5AQI A;  3LM9 A;  2ZF5 O;  3U9Z A;  3WEE B;  4CI6 A;  2P9N A;  2GMO A;  4KBO A;  1ZXO A;  1YXQ A;  3C6A A;  2E20 A;  4MO5 A;  1XC3 A;  3JXU A;  3WXK A;  4CZE A;  3L4I A;  3E66 A;  4JNE A;  1EO1 A;  3S41 A;  1D4X A;  4DHY A;  4RTF D;  3A5M C;  1QQN A;  3ENB A;  3KHY A;  4IDH A;  3CIP A;  4RWT A;  1ILY A;  5HL7 L;  4KH5 A;  3CCS N;  4DB3 A;  1OKJ A;  5HOO A;  3O1B A;  2A6A A;  5AFU A;  2YIP A;  3A5L C;  5C10 A;  5FPD A;  4FWP A;  2GUP A;  2ZGZ A;  5KQD A;  1VQK N;  5BRH A;  2KKZ A;  3CF5 L;  3C6H A;  5C0Y A;  1QZ6 A;  5JLF A;  3VET A;  5BPM A;  1GLF O;  3LL3 A;  1Q82 O;  4CZI A;  4JAX A;  4XH1 A;  3RSE A;  5AZJ A;  4YOW A;  3NMU A;  3IFR A;  1KAY A;  4BR0 A;  3AAR A;  3F9M A;  1YJN N;  1YVN A;  4I6M B;  4A59 A;  5AQZ A;  2BUP A;  1JCE A;  2E1Y A;  2HF3 A;  4WYB A;  5BR9 A;  1HUX A;  5AR0 A;  1G99 A;  1C0G A;  3U8X A;  4UY8 O;  1GLA G;  5ADX A;  3FE1 A;  3VEO A;  2IIR A;  3E1Y A;  2EWS A;  1YF5 L;  3TSP A;  4BVO A;  3OHR A;  5CE3 A;  5E26 A;  3F2K A;  3MK6 A;  4CD3 A;  5AQS A;  2D4W A;  3HTV A;  2E8A A;  4CZM A;  3TTF A;  2P9K B;  1S3X A;  3ZYY X;  2E2F A;  4UAF E;  3DXK B;  3TSQ A;  3CPE A;  3E9O A;  3ZET B;  3ZX2 A;  5CHI A;  1BU6 O;  1IG8 A;  2E2N A;  3Q7C A;  1MDU B;  4JHD A;  4BEC A;  4H03 B;  3SF4 D;  3O9R A;  4H0T B;  2QWP A;  4ISF A;  3VES A;  1NGI A;  3AGK A;  2GEM A;  1RDU A;  3QB0 A;  3SAG A;  4BEB A;  1GLD G;  1KC8 O;  3BK3 C;  1X3M A;  1Z6R A;  2HBM A;  2UYT A;  3AGR A;  3UKR B;  1VQ5 N;  3J8A A;  3C7N A;  4CZF A;  1VQ4 N;  4BRA A;  3CME N;  3ENH A;  1TYQ B;  2NRX A;  2PBD A;  3EL2 A;  3HI0 A;  2A42 A;  1K8K B;  1U2V A;  5JLH A;  3VEX A;  4FPB A;  4IEE A;  4BRD A;  4JD2 A;  1S72 N;  2V51 B;  3MN6 A;  4PKI A;  4B1X B;  3DXM B;  1EQY A;  4BG9 A;  1NGF A;  1KD1 O;  4JK7 A;  3R6M A;  1NGE A;  4FO0 A;  4CBU A;  5GIO A;  3VF2 A;  3R2V A;  1DKG D;  1HJO A;  2ASM A;  3QBX A;  3IKM A;  3E9P A;  4O8U A;  5AZI B;  3BP8 A;  2GWK A;  3CCE N;  4EHT A;  3AAP A;  2CGK A;  4H5V A;  3IDH A;  5M1P A;  4BR5 A;  3MCA B;  1BWF O;  2OTL N;  4FWM A;  1HKG A;  3O08 A;  4QS8 A;  4CZH A;  4M7Y A;  3FZK A;  2FF6 A;  4H5N A;  2NNW A;  2I7N A;  3WQU A;  3P31 A;  3LDO A;  5C2F A;  3EE8 A;  3KK7 A;  2Q36 A;  4BRO A;  4H0P A;  5BRD A;  4KH4 A;  1W2B M;  3O9U A;  3OA9 A;  4WQ5 C;  4U7B A;  2ASP A;  1S22 A;  3T7Z A;  3C0B A;  4BRC A;  4NO7 A;  4JKC A;  4NB4 A;  1DGK N;  2F9T A;  3O80 A;  4CBW A;  4JK9 A;  3TPQ A;  3WEE A;  1ATN A;  3R8E A;  3D2E A;  4FL9 A;  2Q31 A;  2JWK A;  1GLC G;  1NLV A;  2NRZ A;  2P9U B;  3VER A;  1KQS M;  1V4T A;  5AQG A;  1HKC A;  4BVP A;  4A62 A;  1BG3 A;  1YJW N;  3KWG A;  1DEJ A;  5AQN A;  2OAN A;  2NZT A;  3D2F B;  2WUS A;  4CJ7 A;  1GLE G;  2ZJQ L;  1NGJ A;  2P9S B;  1Y64 A;  1YI2 N;  4H5R A;  1P8Z A;  3H6E A;  4J8F A;  3GG4 A;  5BRF A;  3W3D A;  4HWI A;  4FWK A;  1T3V A;  1KXP A;  2PFU A;  1GLJ O;  5KPR A;  4IO8 A;  3TU5 A;  5GIP A;  4FWO A;  2IVN A;  1TUY A;  1QVG M;  3WUH A;  3VEW A;  5C12 A;  5BN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...