3GL1A

Crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
383
structure length
383
Chain Sequence
AEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGKQLEKSINPDEAVAYGAAVQGAILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ATPase domain of Ssb1 chaperone, member of the HSP70 family from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Heat shock protein SSB1
total genus 124
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature ec 3.6.4.10: Non-chaperonin molecular chaperone ATPase.
pdb deposition date 2009-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3gl1A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3gl1A03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 3gl1A04
1KAZA 1NGCA 3FZHA 2E2QA 5LJWA 5KPTA 3OHRA 3LM2A 2HOEA 4FL9A 2CH5A 4BROA 5AZJB 4ISGA 4FWQA 4FWOA 4A2AA 5LJVA 4PKHA 3S41A 3VEYA 3UB5A 2P9PB 3AARA 2IVPA 5AQQA 5F1XA 1YUWA 3H3OB 1ZBSA 4WYBA 4BGBA 5EXWA 2V52B 2YCHA 3AAPA 3IFRA 3BF1A 3QFPA 4BGAA 1GLFO 3ZEUA 4CZGA 1C0GA 3O8MA 3W3DA 5AZIA 1SZ2A 3ZETB 4CZLA 4FWKA 5KQDA 4H5WA 1GLBG 2CGKA 1GLAG 3WQTA 2D4WA 1QQOA 3UKRB 3H1VX 3UKRA 4A61A 5ELZA 4QS9A 3JS6A 2CGLA 5LY3A 1BU6O 1BDGA 1K8KB 5AQRA 3DJCA 2P9KA 4IZ9A 1QZ6A 2ZGYA 3DAWA 4JNEA 3ULEB 3CQXA 1HKBA 2F9TA 4BREA 3CETA 3M6GA 2IVOA 2Q97A 3CJCA 2PBDA 2E8AA 4FWRA 1RFQA 1HUXA 1QZ5A 1LOTB 1JCFA 3D2EB 2D0PA 1HX1A 3VF4A 4BC3A 3ENHA 3L4IA 4K43A 3VGKA 1NGJA 1EQYA 3CJ1A 1Z6RA 5AQJA 1BOTO 4JN4A 4RTFD 4BRQA 3GG4A 4I6MA 2NLXA 4JHDA 4FWLA 3UKUA 1NGBA 2KHOA 2I7NA 1Z05A 2IIRA 1JCEA 1NM1A 3WXIA 4WQ4A 5BREA 3FR0A 1X3MA 2P9KB 4H5NA 1XQSC 3ZX0A 1DKGD 1DGKN 4BRPA 1YVNA 4CBUA 1ATNA 3L6QA 5E84A 3O4WA 1KXPA 3ZEUB 3EKSA 3VEVA 4BG8A 5AQFA 2QWOA 4KBOA 4O8KA 5AQTA 1Q18A 1NGAA 4FO0A 3AY9A 1GLLO 3WEEA 4BQLA 2BUPA 4CI6A 4WQ5C 3SMPA 4ISFA 5F2RA 2E2OA 1ZXOA 1HKGA 3R6MA 1BA0A 1ATRA 3JXUA 1BWFO 3VEXA 1ATSA 2P9NB 2Q1NA 5EY4A 3CQYA 1GLDG 4CZMA 4PL7A 3ULEA 1TYQB 3WXLA 1SAZA 3QICA 5AQMA 4CD3A 5AQVA 4PL8A 1NBWA 3B8AX 3KVGA 4BVPA 5JLHA 3CERA 4FOEA 3M3ZA 2ITMA 1MWKA 1U2VB 5CE3A 2VCPA 4Z94A 4RCHA 3BEXA 5AQXA 2DPNA 2QM1A 4GY2B 4EHTA 2VWBA 2FSNA 4EHUA 5AFUA 3VF6A 3SLCA 1MDUB 3BP8A 2QWLA 2Q0RA 3IMXA 4H0PA 3UKUB 3ZX2A 4CBXA 3QB0A 5JMVA 1MWMA 3H46O 3G25A 3W0LA 2A40A 2P9LB 4B9QA 1BA1A 5AFUH 1C0FA 1HPMA 3VERA 4CJ7A 5E26A 3GDQA 4RWTA 3VETA 2FSJA 2E2NA 4FWPA 3A0IX 5AQKA 3O08A 1TUUA 2YI1A 4BRKA 1NGDA 3C7NB 3EKUA 3ID8A 4Y0WA 1YXQA 2FLOA 3O1WA 2A5XA 3MMVA 4DB3A 3DXKB 5B8HA 3DXKA 2A3ZA 1WUAA 5KQ8A 2GTDA 3VPZA 1NMDA 4LC9B 5AQUA 4CZIA 3A5NC 3O1BA 3H3NO 3H45C 3EN9A 3WQUA 1E4FT 2CH6A 5AZIB 1NLVA 3MN6A 2V7ZA 2HMPA 4BRHA 5BRHA 5AQYA 3A5LC 4FWMA 1E4GT 2QWNA 2PAVA 3F9MA 3TU5A 1V4SA 4FWSA 1NGFA 2YJFA 4BRCA 4H5VA 1S22A 1R59O 3HBTA 1GLCG 2AP1A 3WXKA 2YHXA 4B1YB 3VOVA 3R8EA 4HTLA 5I9EB 3L0QA 5EOYA 4IXCA 3ATVA 3C7NA 2QWMA 3AAQA 1ZC6A 1G99A 2A42A 3HI0A 3GE1A 1P8ZA 5FPDA 2ASPA 4B1UB 4PKGA 5AQOA 3LDLA 4PKIA 2W40A 5AQWA 1QHAA 3FZFA 3FZMA 2QWPA 4BRMA 1KAXA 2Q0UA 3MN5A 4EFHA 4XH5A 4BQZA 1D4XA 5TKYA 3R9PA 5BPLA 1TYQA 3SMSA 3MK6A 2W41A 4FPAA 4QS7A 3GOIA 3U9ZA 3VENA 3FZLA 3WT0A 1NGHA 2P9UB 2P9UA 3D2FB 1SQKA 4DCHA 2OANA 2QXLA 3SJHA 3O80A 4F9OA 4DHYA 1U2VA 3LM9A 4B1XB 1HLUA 1TUYA 4NO7A 4BRNA 5AQSA 4J8FA 2P9SA 4XEIA 2D0OA 5AQPA 2FF3B 2Q31A 2GWKA 3MN9A 4JD2B 2ZWHA 5AR0A 4FWNA 2ASMA 4A62A 4BG9A 3MCPA 4BRAA 1RGIA 3QFUA 2AA4A 3ENOA 5ADXH 2P9IA 4CZKA 3CJ7A 3CJAA 3CHWA 4BR9A 4YDUA 5KPZA 5F0XA 3FLCO 4K41A 1BUPA 5AQNA 4IJNA 3DXMA 1U6ZA 2ZF5O 4FOIA 4IWVA 2NZTA 2QWRA 3WUHA 5ADXA 3U4LA 4H0VB 1V4TA 3FFKB 4H0XB 4WQ5A 4CZJA 3ATUA 3VEZA 1MA9B 5BN8A 1KAYA 3RSEA 2FXUA 3RSEB 2HF4A 4BRIA 1WOQA 4CZEA 4IJAA 2P9PA 3QBWA 1T44A 3U8XA 2Q36A 4M7XA 3M1FA 3ZX3A 2VYPA 2P9SB 4H03B 3GBTA 5BR9A 3O5BA 2BTFA 3DWLA 4IO8A 3CI5A 4BR5A 4BC5A 4I6MB 4JHDB 1H1VA 3A5OC 1BG3A 2P9IB 5AZJA 3QMLA 3CJ9A 4CBWA 1NGIA 4O5FA 3I8BA 3LDPA 3O6WA 3QBXA 4FPBA 5BRDA 1JCGA 1CZAN 3J8AA 3BF3A 5AQLA 4AM6A 2CGJA 3C0BA 2YJEA 3H1QA 4BRDA 4YDUC 4BRGA 1HJOA 3EL2A 1DEJA 4H0TB 3VGMA 4BR2A 2WUSA 4CZFA 3A8YA 2E88A 4M63C 3IDHA 1OKJA 1RDWX 4BRLA 2E2PA 1YAGA 4JAXA 3WXJA 2P9NA 3P4IA 4AM7A 4GNIA 5AQGA 4K25A 2NRHA 3D7EO 1NGEA 2D1KA 2IVNA 5JICA 3MDQA 4EIAA 4A2BA 2QW9A 3D2FA 3LDNA 4B1VA 3KHYA 4MLEA 4XH1A 2HF3A 1XUPO 4H0YB 4BR0A 5BRFA 2A6AA 2EWSA 3EO3A 3H6EA 3HTVA 1XC3A 4ISEA 1S3XA 2E1ZA 2A41A 4WQ4C 4NB4A 2QWQA 3HM8A 5FPMA 4BC4A 3GL1A 1NWKA 3ZETA 4C23A 3WEEB 1X9JA 3VF2A 4BR7A 4M7YA 2P9LA 2FF6A 2GEMA 1QQNA 1K8KA 4DQ8A 3CJBA 3DXMB 2GUPA 4K42A 1NGGA 1X3NA 4H0OA 1Y64A 5BPNA 1HKCA 2GWJA 2V7YA 3VEOA 4HWIA 3KZBA 4BC2A 4BVOA 3UE5A 5BN9A 3FZKA 3CIPA 4XH4A 2ASOA 3FGUA 3QDKA 3D2EA 2E20A 3EZWA 3HZ6A 3LL3A 4EAHD 4CD1A 2J4RA 3A5MC 4MO5A 4BR4A 1QQMA 2UYTA 5AQHA 5FPNA 1J6ZA 2ZGZA 3VESA 2YHWA 3IUCA 5AQZA 1BO5O 4MO4A 1IG8A 1IJJA 5EVZA 4QS8A 4CZHA 2GELA 1T6CA 3VEWA 4B1ZA 3LDQA 3BUZB 4E1JA 4MLHA 5JLFA 4FSVA 2E1YA 5FPEA 2H3GX 5AQIA 5EX5A 2F9WA 3FE1A 3I33A 3LDOA 4L3QA 3TPQA 2FSKA 4B1WB 1GLEG 3MN7A 4BRFA 2Q2RA 2YHYA 4H5TA 3VGLA 4JD2A 3SK3A 1GLJO 2I7PA 3HSCA 1LCUA 2V51B 4H5RA 3U9DA 5KPRA 1T6DA 5BPMA 1ESVA
chains in the Genus database with same CATH superfamily
2LJ7A 1KAZA 1DTTA 1TK0A 4WE1A 4KI6A 3K5LA 1NGCA 1PE4A 3KLIA 4C8OA 4PQUA 5LJWA 2B5JA 2FC0A 4DR5K 4BROA 4CHPA 4CJUA 4FWQA 3ZT3A 4FWOA 4BY9C 5LL6Z 4PKHA 3S41A 3VEYA 3U3GA 2IVPA 3WNFA 5F1XA 4Z4GA 2NRXA 3AAPA 3IFRA 3M8SA 3BF1A 3CCMN 3B6PA 1GLFO 3ZEUA 4LF5K 1C0GA 5AZIA 2N66A 3ZETB 1GLAG 5CZ2A 2BGGA 3UKRB 3H1VX 3UKRA 5M1FA 3NVKA 1TI5A 4QS9A 4Z4EA 3JS6A 2LI7A 5AQRA 3OYJA 3DJCA 2P9KA 2ZGYA 4EZ6A 3ULEB 4JNEA 1VQ8N 4CQKA 3AGKA 2HBJA 1KV0A 4FWRA 1Q86O 4IO9L 1HUXA 2HMIA 1TL1A 1JCFA 4YOVA 2D0PA 4B9SA 1HX1A 3VF4A 2O8CB 4CFCA 3AO2A 3CJ1A 1RT1A 4RTFD 1NG9A 3NFAA 3GG4A 4I6MA 3UKUA 4CJPA 2ETJA 4QAGA 1VSJA 2I7NA 2IIRA 5CY0A 1NK0A 4E1NA 3HP6A 4XIUA 4DV6K 4FK0A 3QEIA 3ZX0A 4CEOA 1YVNA 2LSNA 4CBUA 1ATNA 4DF4A 3CYMA 2R7YA 3M5RA 1QS4A 4CIGA 4IFVA 1SKRA 1ZVGA 1HNXK 1KXPA 3ZEUB 4OPHA 2QWOA 4KBOA 5CHIA 1NJXA 3B6OA 1IG9A 1GLLO 2BUPA 4KTQA 3SMPA 1RDDA 1ZXOA 3R6MA 3OYHA 3SAGA 3QIOA 1BWFO 3VEXA 1KTQA 2Q1NA 5EY4A 3CQYA 1X9WA 1EO1A 1T03A 5DM6L 2QKKA 2X6NA 4N56A 2O8BB 3QICA 2IOCA 3OYKA 1HNWK 2G8WA 3KC6A 4BVPA 5HP1A 3TARA 2F7TA 3AGRA 3AO1A 2ITMA 3J7ZO 2BRZA 2VCPA 3PIPL 3BEXA 1NOYA 2HNZA 4IG3A 2N69A 4GY2B 3J7YP 4OPJA 4DTNA 3VF6A 4WFNL 3SLCA 1NNEA 3QESA 2QWLA 2Q0RA 4H0PA 4BDYA 2X74A 1KD1O 1GOBA 1MWMA 3H46O 1VSHA 3G25A 3W0LA 3E9LA 3ID6A 4DU4A 3CM6A 1NKCA 3IKMA 3SBTA 1LAWA 4OKEA 1K8AO 4GVMA 3TTCA 4FWPA 4JI7K 2YI1A 4DMNA 4KB1A 5C24A 4IKFA 4OGCA 3CCQN 3C7NB 2GUIA 4Y0WA 4M42A 3MMVA 1RBUA 5B8HA 4Z4IA 4KREA 1WUAA 3THYA 3VA0A 3TABA 1QE1A 3H08A 4FJ7A 4LC9B 5AQUA 3A5NC 3H3NO 4BECA 2G8UA 3EN9A 4KH4A 3TTDA 3WQUA 1VQKN 2LT8A 4UAEF 4OLAA 1X9MA 5BRHA 4U7BA 1IBMK 4J2DA 3SQ2A 1W7AA 4CF2A 2QWNA 4Z4CA 3F9MA 1W9HA 4RW8A 4H5VA 5C0YA 4DU1A 1GLCG 5HRPA 1T3VA 3VOVA 4DSEA 3R8EA 3QINA 4HTLA 5I9EB 4OVLA 3PO4A 2UXDK 4M45A 4CF9A 1G99A 2A42A 3AVBA 1NK6A 1LWFA 3GE1A 5FPDA 3LPUA 2ASPA 3PX0A 3LDLA 2P5GA 1T05A 1ASWA 3G71N 3CCRN 5AQWA 2FBVA 3FZFA 1SKWA 1IKWA 1D8YA 2Q0UA 2OPSA 1I6GA 4EFHA 5LMUK 1XMQK 4XH5A 1NOZA 4BQZA 3TSQA 5BPLA 1S72N 3NH1A 3D0PA 1J54A 3L8BA 3HSTB 3VQBA 5C25A 3VMFB 3GOIA 1RT4A 1TKTA 3WT0A 4HCBA 1NGHA 4FLXA 1VSEA 4HHFA 4LFCK 4OGEA 1XNQK 2UUCK 1TKXA 3CD6N 3K5OA 4DHYA 3EEQA 4GW6A 4B1XB 2X6SA 4C1NI 2RE2A 4BRNA 3AA3A 4GMJB 4BWMA 2FF3B 3LP0A 2GWKA 4ICLA 3RRHA 3NGZA 2LY5A 2YX6A 2XY7A 4BG9A 4B3MK 3LP2A 2YNFA 3RWUA 4GKJK 2AA4A 1S1WA 4JKCA 3CJ7A 5KPZA 4YDUA 1RT3A 3SV4A 3CYGA 1RDCA 3ALYA 3MEDA 5HOOA 4CK3A 4IJNA 3O9RA 4KTZA 2PFUA 3V1QA 4FOIA 4O44A 4FYDA 3DLEA 3G10A 2HHXA 2YILA 4DV1K 3U4LA 4W5OA 4H0XB 4WQ5A 3MAQA 2HHVA 4CZJA 4IDKA 3AO5A 4CF1A 5BN8A 4O0JA 1KAYA 4C1NK 4IJAA 3VQDA 3RR8A 4DFMA 3QBWA 1JXCA 2JWLA 3L56A 2Q36A 3M1FA 3DRSA 3ZX3A 2P9SB 3O5BA 2QKBA 3QIPA 4WFAL 3L2UA 4KH6A 2YHBA 1M90O 4W5NA 3L2QA 4Y1DA 4CGJA 1RT7A 3NHGA 1H1VA 5FROA 4GV3A 4FJKA 1YJ9N 3QMLA 3CJ9A 3O4NA 4O5FA 1XC9A 4UADE 1MU2A 4FPBA 3BF3A 2O8EA 3SAFA 3DLGA 3TAPA 4DV7K 3SV3A 1YTAA 5DMRA 1YJNN 4YDUC 4BRGA 3C65A 1L5UA 4JKEA 4CHOA 4H0TB 3T1AA 1VSIA 2EX3A 2WUSA 3Q7CA 4FVMA 3VTIA 2XO7A 3DRRA 2OPRA 4E7KA 3V9ZA 4DR6K 3S3MA 5AJ3K 1NMNA 2OTLN 1BQNA 4GNIA 3QEWA 3VQ8A 4BE0A 2KJAA 1BGXT 4AB0A 4CFBA 2D1KA 1HNVA 3OBWA 3LDSA 3E66A 1U47A 1N6QA 3LPTA 4A2BA 4FVUA 3C94A 1Z26A 1NKBA 1N32K 5JENA 2YIPA 3KHWA 2HF3A 5J2NA 1XUPO 4FW2A 5BRFA 3EO3A 4HTUA 2ATQA 5BR8K 3O3HA 3HPHA 5HROA 4BC4A 3GL1A 1REVA 3KK7A 3TAFA 1LW2A 3THWA 4J2EA 1NWKA 3ZETA 1VQ6N 3A2FA 3IAYA 1K8KA 3DOKA 3CJBA 4DQ8A 5KTQA 4W5RA 4M3XA 3DXMB 4K42A 5KGWA 2YNGA 5BPNA 1HKCA 1NJYA 3HVTA 4ID5A 4BC2A 4HWIA 4AHUA 3UE5A 3PUFA 4OJRA 4DFPA 4ELUA 2O8DB 3P83D 1CXUA 4FLTA 1JLEA 3K9KA 1QVGM 3HZ6A 2HBLA 1SL2A 4MO5A 2ZD1A 4BDPA 4DQQA 4H8KA 1QQMA 4CF8A 3VTHA 3HXMA 1J6ZA 2ZGZA 3VESA 4PUOA 1ZFUA 2LY6A 3KP1A 4MO4A 1IJJA 5GAEP 2Z1HA 1EX4A 3HM9A 4DV4K 4DS4A 4DTSA 3BUZB 4E1JA 3OYMA 1NK4A 4FSVA 3OW2M 4MQ3A 1KLMA 3AVNA 2RF2A 1CHZA 1UA0A 3CCJN 2FSKA 1O1WA 4B1WB 4CF0A 2YHYA 2VGMA 1ZBUA 4FJIA 3QI7A 3HOSA 4KHPK 4I9LA 3HSCA 1TL3A 3QNOA 1WB9A 1L3VA 2HHWA 4K0KK 3CCEN 2IS3A 1ESVA 1QSLA 1HYSA 1VAZA 3CW4A 3PV8A 4DSFA 1TAQA 5KPTA 3LWMA 3SYZA 2Z1IA 3T69A 2HOEA 4FL9A 2VG5A 3KKSA 3DYAA 3DM2A 4A2AA 3DLLL 2HVHA 4CK2A 2XY5A 2N2RA 2P9PB 5AQQA 4ILJA 3GKUA 4WYBA 1VQ9N 1SKSA 1D9DA 2BDPA 4CZGA 3QERA 3O8MA 4DFJA 4CJEA 4Q0BA 2OCEA 4CZLA 1B7DA 3WQTA 1I3AA 1QQOA 2E4LA 4A61A 5ELZA 4LF6K 2E6MA 1B9FA 3HPGA 1C0UA 4YOWA 2YC1C 3O9SA 1P90A 5J2PA 2NY8X 4KRFA 3CETA 1ZYVA 2PYJA 2Q97A 5GIOA 2PBDA 1QTMA 1JXEA 3I0SA 1VQLN 4JI4K 2D0CA 1LV5A 3K5MA 4F4KA 1A5WA 3VGKA 5AQJA 1BOTO 4JN4A 4BRQA 4EP4A 3P5JA 4FZZA 4M3UA 4JHDA 1ZVEA 1J5OA 4GKKK 5DK5A 1EKEA 1SL1A 4CEEA 4ELTA 1NM1A 3J80O 4JKFA 3SF4D 2M8BB 4ZHRA 5TKWA 1SN1A 4BEBA 4DKWA 3Q7BA 3ZLJA 3DOLA 4CJVA 3VQQA 1X3MA 1JKZA 1XQSC 1DGKN 4BRPA 3S3OA 3THXA 3OYFA 5E84A 3O4WA 2A1SA 4JKAA 4BE1A 3T3FA 2Y1IA 3EKSA 3PLAA 2E3FA 1BK8A 1HNZK 1ZYWA 5AQTA 1DTQA 3JSMA 4NXNK 3OA9A 1BRZA 3AY9A 3WEEA 2D0BA 4JI0K 3THYB 1SUQA 2E2OA 3ZSXA 3L3VA 5HRNA 1BA0A 4FJLA 3JXUA 3N4QA 3CCVN 3BY5A 1GLDG 4CZMA 1ILYA 3HYFA 1ICAA 4NXMK 2G2KA 1TYQB 4DQPA 1SAZA 1X1PA 4UJ0A 4I2PA 4DF8A 5AQVA 4KTWA 1NBWA 3B8AX 5JLHA 3CERA 4N5SA 4JYAK 5GADP 3ITHA 1U2VB 4LD0A 5KRTA 4Z94A 1NU0A 3THVA 4KB0A 3AVHA 2DPNA 4DLGA 1WSGA 2FSNA 3VQAA 5AFUA 1MDUB 3UKUB 4N76A 4N47A 4CGGA 4G9ZA 2A40A 4FLVA 1M1KO 4RWTA 2HB5A 4GVEA 5AQKA 1TUUA 2NRZA 1T7PA 4BRKA 4JLHA 3ZSYA 1X9SA 4KAZA 3EKUA 2VG6A 3DMJA 1DLOA 4UAFE 4AF1A 1TGOA 4KHWA 3ZSOA 5SWMA 1C56A 4B8AB 3ZSQA 3DXKB 1HPZA 3LP1A 1U49A 3OYAA 3ZSZA 2GTDA 3VPZA 3KD5E 1T0ZA 3H45C 2ZQBA 4HHTA 2CH6A 5AZIB 3MN6A 2XY8A 3A5LC 2O4GA 1E4GT 1YJWN 4F2RA 2KPYA 3PO5A 4FWSA 1NGFA 3RTVA 2B4JA 5H1SQ 4GV9A 3KOXA 3HBTA 3E9OA 3WXKA 2MN5A 4B1YB 4X64K 1BCGA 2K35A 3C6TA 5EOYA 4IXCA 1RNHA 3AAQA 3BZKA 1ZBFA 1NH5A 3AVJA 1TKDA 1IO2A 2G8VA 5HBMA 1UOCA 2W40A 2WFBA 2FBXA 3TI0A 3E1YA 1KAXA 3NH2A 2GMOA 5C2DA 1OH6A 4F3OA 2NRRA 2ZJQL 3PIOL 5TKYA 3HJFA 3NCIA 3P38A 2BE2A 3AA2A 3LAMA 1JL1A 3I56N 1UWBA 3MK6A 2W41A 1HMVA 3VENA 3FZLA 2P9UB 1SQKA 4DCHA 2OANA 4E19A 3SPZA 4JK9A 2QXLA 4I2QA 5DM7L 2OPQA 4CK1A 3JYTA 1U2VA 1HLUA 1TUYA 2O8EB 4DQSA 2GX9A 1TK5A 4Z4FA 1VQNN 2Z1GA 2JGUA 1B3CA 1C1BA 1SNBA 2D0OA 4DTPA 2Q31A 3NF7A 3MXMA 4FJ9A 1JZAA 4V1DC 2ASMA 3OYIA 1WAJA 4JKHA 4A62A 3MCPA 4BRAA 3QFUA 4DQIA 2P9IA 4CZKA 3CJAA 4CJRA 3FLCO 4OX9K 4K41A 5AQNA 4JI1K 1U6ZA 4IWVA 2NZTA 3NH0A 2BH1A 1EXQA 2Z1JA 4JI2K 4KO0A 1NPIA 4KYPA 1S5JA 2B68A 1F21A 3ATUA 2NRTA 3RSEA 4BRIA 2HF4A 4CZEA 4V19S 1Q82O 2OPPA 3RMDA 2NRWA 1POIA 3E7UX 1T44A 4M7XA 1S1VA 2VYPA 3SI6A 3CI5A 3V1RA 4LH5A 4BR5A 4BC5A 1PTXA 2LN8A 4JHDB 4O4GA 2ZJPL 3KK2A 1XHXA 1YT3A 3A5OC 4CFDA 5AZJA 3J81O 1A5VA 3CCUN 2WOMA 1T7BA 5BRDA 3O6WA 4UY8O 1KFSA 3BK3C 1RTIA 3MX5A 3EZ5A 2RKIA 4FXDA 2YJEA 1I6FA 1S6PA 3L2WA 3EL2A 1R0AA 1DEJA 2VY6A 4CJLA 3MCAB 1JLAA 4CJ3A 4M3WA 4M63C 3KTQA 3IDHA 3PSIA 3ZSWA 3DI6A 4BRLA 5CYMA 4JI6K 1W2BM 4JAXA 4DR1K 4PWDA 4AH9A 4JI5K 1QVFM 3ZCMA 5J2QA 1OMYA 2RN2A 4CESA 1WT7A 2HHIA 4KFBA 4MDAA 1UAXA 1BL3A 5C12A 4AHVA 2YIOA 4IFEA 3LWLA 3LDNA 3D2FA 3F9KA 4B1VA 1Y97A 5JS2A 3HVRA 1SEGA 4H0YB 1JXBA 4BR0A 3NBPA 2A6AA 3HP9A 2ZJRL 3M8RA 3HTVA 3KK1A 4DR7K 4KHSA 3I8DA 1P0AA 2E1ZA 4X66K 3LZIA 2A41A 1RT6A 4NB4A 2QWQA 2HHQA 1RBSA 1YF5L 3WXMB 2E0HA 1BI4A 3K2PA 2VG7A 3WEEB 5GAGP 1X9JA 2F4VK 2P5OA 4B3RK 4GV6A 2P9LA 1HRHA 5IWAK 1I39A 3RVCA 2GUPA 3G6EN 1NGGA 5MLCQ 2GWJA 4DG1A 1D9FA 2O4IA 5JS1A 4DTOA 2NUBA 4B3TK 3QEXA 4BVOA 3CFPA 5BN9A 2DFHA 4XH4A 3KIOA 3D2EA 2E20A 3DRPA 1BCMA 3LL3A 4YOYA 4FM1A 3DLRA 1KC8O 4FJXA 1YI2N 2DFFA 1WSFA 1C0MA 3SUQA 5FPNA 3NF6A 2E6LA 2E3GA 4LF8K 3VQPA 1N36K 3THWB 5EVZA 4QS8A 2I61A 3O9TA 3LDQA 1S1TA 3ZSVA 4CFAA 3AVGA 2H3GX 3MWPA 5EX5A 1VQMN 3K59A 2YNHA 4IG0A 1IBKK 2NRVA 3KLHA 2G8IA 2KKZA 3MN7A 4BRFA 3ISNC 3CC4N 4JD2A 4CEAA 1GLJO 1KCFA 2I7PA 3BZCA 3P31A 1VQ4N 3V9XA 1LCUA 3K9JA 3HO1A 4FJHA 1NE5A 2VGNA 5KPRA 2HW3A 1RDAA 3V1OA 5BPMA 4A59A 3QO9A 3TSPA 5CYQA 3OYLA 3MXIA 5KGXA 3FZHA 3O4QA 3MXJA 3SNNA 2CH5A 4CEZA 4XJXA 3CXCM 5AZJB 3WNEA 4OPAA 3IRXA 2DTUA 1JJ2M 3D6RA 1I94K 1YIJN 5LJVA 3O9UA 3VQ4A 1HYZA 3AARA 4JK7A 1VQ5N 4IOCL 3H3OB 4C8KA 2KGQA 3F73A 1KRPA 2V52B 2YCHA 1N4NA 4FJGA 1KVAA 4Z4HA 1WN7A 3QFPA 1VNAA 4BGAA 1OH8A 1T1TA 1N33K 1WNSA 3W3DA 2HSTA 3OYDA 3HOTA 1SZ2A 2XRIA 1K73O 5KQDA 4H5WA 1GLBG 2CGKA 4JV5K 2D4WA 4CHZA 3OS1A 4LFBK 1S9GA 2OZMA 2CGLA 5LY3A 1BU6O 4RG8A 4FLZA 4IZ9A 2SN3A 4JK8A 1RT2A 3DAWA 4ELVA 4EZ9A 4K8XA 3ULDA 1HKBA 3WNGA 1FW6A 2VWKA 3M6GA 3CJCA 3OJUA 1NK8A 2RPIA 1RFQA 1Q9XA 1QZ5A 1OH5A 4DU3A 3OYEA 4E7LA 4YORA 3ZT2A 4AAZA 3I55N 4BC3A 3ENHA 4HUEA 4K43A 1NGJA 3S5TA 1LQHA 2RHKA 3TR8A 2D5RA 2NLXA 4FWLA 3KP0A 1AYJA 4WFBL 4O0IA 3O9QA 2O8BA 4WQ4A 5BREA 4Q5VA 3FR0A 1S1XA 2KTQA 5C2FA 3TANA 4H5NA 4NYNA 4C8MA 3VQ6A 4W5TA 3OTOK 3SBGA 4E72A 4DV2K 2QTDA 4BG8A 3VEVA 4CGFA 5AQFA 4O8KA 1Q18A 3QNNA 4BQLA 4WQ5C 1W0HA 4EP5A 3V9WA 4AQYK 1ATRA 4X65K 1ATSA 4CJTA 2P9NB 2ATBA 1VRUA 3ULEA 2JLEA 5HL7L 4CD3A 1JLFA 1OZZA 4PL8A 3DLHA 3KVGA 1KFDA 4FOEA 1MWKA 1VSLA 1FKPA 1RTHA 4CHNA 4QCLA 4WCEL 5CE3A 3AA5X 4RCHA 5AQXA 4RW4A 2VWBA 4EHUA 4O5BA 5JVHL 4CJKA 2IAJA 3BP8A 4CBXA 3IMXA 5EU7A 1Q7YO 2XY6A 1VQPN 3SUPA 3SQ4A 2P9LB 3VA3A 1BA1A 1C0FA 1HPMA 1HJRA 3NAEA 4G1QA 4ILGB 3F2KA 4A5BA 2E2NA 2YHAA 4CEFA 3HK2A 3AA4A 4CW7B 1XMOK 1K6YA 5SZTA 1XRSB 3T1YK 3ID8A 4IEEA 1IV0A 1TV6A 3CFOA 1YXQA 3O1WA 1QSSA 1ITGA 2NNWA 3JAMO 3SQ0A 2KW4A 3K58A 2A3ZA 4ZTJA 1IH7A 5KQ8A 3SPYA 4JS5A 4B3SK 1E4FT 4BWJA 1NLVA 4OLBA 4BRHA 5AQYA 4FWMA 3K57A 1PX9A 4AHRA 4J2BA 5CZ1A 1V4SA 4H4OA 4CIEA 2YJFA 4BRCA 1S22A 4R79A 1R59O 3AVLA 3CM5A 1YTUA 1UA1A 4DUYK 2YHXA 2Q3SA 1S1UA 3C7NA 1T7EA 3ZYYX 3HI0A 3HT3A 1P8ZA 1VK0A 1SL0A 4B1UB 4KPYA 4PKGA 5AQOA 2F8SA 4JKGB 3AVFA 4PKIA 5FLXO 1QHAA 4M3TA 1Q81O 3L2RA 3TSUA 3FZMA 3AVKA 5HRSA 3EE8A 3MN5A 3CCSN 1VRTA 4OPKA 5KRSA 2F96A 4LF7K 1T7AA 3BDPA 5KK4A 4FM0A 4B9TA 4FPAA 3U9ZA 4NCGA 2P9UA 3D2FB 2FBTA 3IG1A 1ASVA 4F9OA 3LM9A 2IGIA 2LKBA 3LP3A 3LALA 1LAVA 3KK3A 4RW7A 2LR3A 4JRPA 2KYQA 4NO7A 2HHTA 3V81A 3CPWM 5AQSA 4J8FA 1JKHA 2P9SA 1NJWA 2Y1JA 4DV3K 4JD2B 1CZ9A 2ZWHA 5AR0A 2YKMA 4FWNA 3CCLN 3OS2A 2O8FA 3G0ZA 4BDZA 1RGIA 1J9AA 5ADXH 2W42A 5F0XA 1LQQA 2KBKA 4DSIA 3L3UA 2UUAK 4DSJA 3DXMA 2ZF5O 3TAEA 2QWRA 1JLCA 3WUHA 2AJQA 2OA8A 1V4TA 3FFKB 3THXB 1CLQA 4JS4A 3PX6A 3VEZA 2C1GA 3VQEA 4IEIA 1WOQA 1TAUA 1NRAA 3NGIA 4I9QA 1WSEA 3QEVA 2W6LA 2X78A 1ZBLA 2WONA 1IBLK 1JLBA 4YOUA 1YVUA 1JZBA 1EWRA 4N41A 1WLJA 5BR9A 2BTFA 1WSHA 2KQ2A 3DWLA 4IDHA 2KBHA 3F5TA 4M3ZA 1LWEA 1QSYA 4CJ5A 4I6MB 4DV0K 2WC9A 4TSXA 4W5QA 1NK7A 4AEIA 2P9IB 3AV9A 4FLUA 1NGIA 3L4QA 1L3TA 2HNYA 3CFRA 4IFYA 3LDPA 3QBXA 3ZSRA 1JCGA 3J8AA 3TTFA 4OO1J 1FXXA 4AHCA 1L3SA 2CGJA 5J1EA 4BRDA 1NJZA 3HPOA 3AO4A 4AHTA 1EETA 4BR2A 1GPSA 1JLQA 3A8YA 2W00A 2E88A 5C15A 1RBRA 5D3GA 1OKJA 1RDWX 3KWIA 1OVQA 1YAGA 3V4IA 4QOZB 5CR4A 4F3TA 1IKYA 3M8QA 2MBKA 1HYVA 3EE9A 4AM7A 3MWTA 3ZT1A 3CQ8A 5AQGA 2NRHA 2KFNA 3MDQA 1N34K 1J5EK 2QW9A 2ZM6K 3KHYA 4HE7A 4AILC 4XH1A 1Z25A 4NLCA 2E2FA 1KVBA 1VSKA 5LMNK 3NVMA 3LZJA 1XC3A 3CF5L 3C6HA 4R5PA 5FPMA 1Q9YA 1JL2A 3KWGA 4CJSA 3VQ7A 3EY1A 3PY8A 4FW1A 4CIFA 4DWIA 2FF6A 2GEMA 1K9MO 1BQMA 4C8LA 3SQ1A 2HBKA 4H0OA 1Y64A 4FJMA 2V7YA 1SS6A 2QEXN 3LAKA 3M8PA 4NCAA 1AHOA 3FZKA 2P1JA 3CIPA 3MECA 4KKOA 4E0DA 3FGUA 3QDKA 3R2VA 3EZWA 3KKRA 4H4MA 3SUNA 1L3UA 4BR4A 2WBNA 2VWJA 2QK9A 2QA4N 2UYTA 4LSLA 4B08A 3OS0A 3E01A 3OVNA 2YBRC 1FKOA 1EP4A 4IOXA 1I2UA 2YHWA 4I7FA 3IUCA 5JVGL 1N8RO 4J2AA 4DTJA 1UGLA 2OYQA 4UQGA 5AQZA 2O8FB 1BO5O 1HNIA 1IG8A 1K8BA 2GELA 4B1ZA 3VEWA 3BGRA 5JLFA 3NF9A 4MLHA 2HHUA 1B92A 5FPEA 5AQIA 3MEGA 2F9WA 3FE1A 1ZBIA 3OY9A 3TPQA 3NMUA 2DY4A 5T7BA 1GLEG 2YNIA 2Q2RA 1XHZA 3C95A 4H5TA 2GBZA 5KI6A 1J53A 4PHTX 5C10A 2V51B 3WNHA 4H5RA 3QETA 4F8RA 4CJQA 3SUOA 5IT9O 5FDLA 4A57A 3AVAA 5GAHP 4FLWA 4B9VA 1C6VA 2UUBK 2HHHK 4KHUA 2E2QA 4CECA 3OHRA 3LM2A 4FK4A 1LWCA 3HRGA 1OVYA 4B9MA 4X62K 3ENBA 4ISGA 3AVCA 4JRQA 2P51A 4LSNA 4CGIA 1W97L 3UIQA 2O8DA 3K5NA 1DQ7A 1MR4A 3UB5A 1ZUTA 2VQFK 2G8KA 1YUWA 1ZBSA 4BE2A 1CN2A 4BGBA 5EXWA 1U45A 1RTDA 3NF8A 5M1KA 4U67L 4NCBA 2KSKA 2KBJA 4PA1A 3VQCA 4DUZK 2DFEA 4ILHA 4FWKA 2PYLA 3T1HK 3PSMA 3P39A 1WWNA 2HVIA 1BDGA 1K8KB 1WSIA 4C8NA 4B3OA 1FJGK 1RILA 4FJ8A 1RDBA 1QZ6A 4E7HA 2KLAA 3CMEN 3CQXA 2F9TA 4DTRA 4BREA 2IVOA 1XNRK 3G4SN 3VQ9A 2E8AA 1MYNA 3V9SA 1LOTB 1DT9A 1JLGA 4B9NA 1B9DA 3D2EB 1BIUA 4L8RB 1L4VA 4KV8A 3QEPA 3L4IA 4YFUA 1VQON 1EQYA 1RTJA 1Z6RA 3NGYA 4HVJA 4DLEA 2ITGA 1RBVA 3CC2N 3CMAN 2FBYA 1RDUA 1NGBA 4JKDA 3U6FA 2KHOA 1U4BA 3V6DA 1Z05A 1JCEA 3WXIA 4CGHA 2A7TA 4HCCA 3V9UA 3O3FA 4KHYA 4IBNA 5HRRA 2P9KB 4B9UA 4RW9A 3NDKA 4JI8K 1DKGD 4M3RA 2GL1A 4DSLA 3L6QA 1VSFA 4CJ4A 3C6UA 1P00A 2G8HA 1D5AA 2JDQD 4RW6A 3L2VA 4FO0A 1NGAA 2GV9A 5CY4A 4CHYA 4CI6A 1BISA 4ISFA 1EWQA 1U04A 5F2RA 1HKGA 4FM2A 4JKBA 4IOAL 2B6AA 3C6AA 3OBYA 1FK9A 4DR2K 2UXCK 4CCHA 1VHXA 4PL7A 1SV5A 1NJIO 3WXLA 4O8UA 5AQMA 2UU9K 1OH7A 4DR3K 3S9HA 4LFAK 4YOTA 3E7RL 3M3ZA 2KZMA 3CG7A 4CGDA 3T7ZA 1VSMA 3RMAA 4LY7A 2O8CA 3KOWA 2QM1A 4EHTA 1ZBHA 4NYFA 5I3UA 2HHSA 1NRBA 1BHLA 3AVMA 3OYNA 4FZXC 1BI4B 3ZX2A 5JMVA 3QB0A 4CEBA 1RCHA 1TVRA 4B9QA 5AFUH 1I2VA 3D45A 3VERA 4CJ7A 1CZBA 5E26A 3GDQA 3IS9A 3VETA 1KSPA 2FSJA 3A0IX 3O08A 2NY9X 1C0TA 4CE9A 3SJJA 1NGDA 3TAMA 2PY5A 1XWLA 2HBMA 2G8FA 4A5AA 1Q8IA 2FLOA 4FLYA 2A5XA 1RT5A 2MZ0A 4YNQA 4DB3A 2IC3A 3DXKA 4E3SA 2IDOA 1NMDA 3K0SA 1VQ7N 4CZIA 3O1BA 3KLGA 1BMRA 4HUFA 5FRMA 1LW0A 2D0AA 4KHNA 2UXBK 1CXQA 2V7ZA 2HMPA 3VN5A 2YEOA 3S3NA 4KHQA 4CHQA 2PAVA 4DTXA 3TU5A 4FJNA 1HQEA 1C1CA 1QHTA 3OYBA 2N2QA 3P1GA 2AP1A 3RMCA 3OJSA 5FRNA 1WMTA 3L0QA 1NK5A 5M1QA 3ATVA 4DTUA 2QWMA 2OZSA 1ZC6A 4BE7B 3HL8A 3ZT4A 1HQUA 1QQCA 3R3LA 1A5XA 2PZSA 1GPTA 3VQ5A 3QLHA 2QWPA 4BRMA 2I5JA 4HUGA 5I42A 1D4XA 3R9PA 1TYQA 4E7IA 3SMSA 2QI2A 4QS7A 5E41A 4E1MA 3RMBA 4CVNE 4BACA 3KJVA 1XI1A 5HLFA 3SJHA 3O80A 1YHQN 4FCYA 4CJWA 1T8EA 5M1OA 4XEIA 2KFZA 5AQPA 2KZZA 3MN9A 4FK2A 3KLFA 3KOYA 4DR4K 1KQSM 3ENOA 4DFKA 4M3YA 5GINA 3CHWA 3FFIA 4BR9A 2WTUA 1BUPA 3N4PA 1VNBA 3AVIA 1WAFA 3OYCA 3MEEA 4MFBA 4F2SA 5ADXA 4WF9L 2YKNA 4CJFA 4H0VB 5C42A 4DQRA 2F8TA 4KI4A 1HR0K 4AHSA 1MA9B 4LH4A 4JI3K 2FXUA 3RSEB 4ZTFA 5M1PA 2P9PA 1TKZA 3U8XA 2A1RA 4H03B 3GBTA 4IO8A 1BCOA 2EHGA 4ID1A 3OYGA 4MDBA 2HNDA 1ASUA 3KOZA 1BG3A 4CBWA 4LF4K 4DS5A 5M1NA 3KLEA 3I8BA 1E3MA 1VSDA 3SAHA 1CZAN 1KVCA 5AQLA 1G15A 3I0RA 4AM6A 4E89A 1WBDA 1LQIA 3C0BA 2B3CA 3H1QA 1C1AA 3CC7N 2XHBA 1GOAA 1HJOA 4NLBA 4B8CA 3TAGA 3VGMA 3SZ2A 1WBBA 2D56A 3SCXA 3RRGA 4CZFA 3MX2A 4DSKA 2E2PA 4CEQA 1U48A 3LANA 4JEPA 3WXJA 2P9NA 3DLBA 3P4IA 1S6QA 1KLNA 3EYZA 2VQEK 3RR7A 2BANA 4K25A 4O55A 4OKJA 3D7EO 1N5YA 1NGEA 2IVNA 1ZYQA 1FH3A 3J7AP 3U3YA 5JICA 4KH5A 4EIAA 1IKVA 4MLEA 5J2MA 4YOXA 4FJJA 2LJMA 5A2QO 2EWSA 4DTMA 3H6EA 4ISEA 1S3XA 2OTJN 1SN4A 3TAQA 4WQ4C 3ZT0A 3HM8A 5K14A 3ASMA 4C23A 3R1XA 3VF2A 4BR7A 4M7YA 3CPEA 1S9EA 4PY5A 1QQNA 2ASCA 1O13A 1X3NA 1WSJA 4OKKA 3DLKA 4LF9K 4FJ5A 1GOCA 4M41A 3VEOA 3KZBA 1RBTA 1BIZA 1IKXA 2ASOA 3PSFA 4EAHD 1NK9A 3E9PA 4CD1A 2J4RA 3A5MC 4CEDA 3O3GA 2ZE2A 3T19A 1DJTA 4YHHK 5AQHA 3NE6A 1ZU3A 4E7JA 1C55A 4Z0UA 4B9LA 3KD1E 2W6KA 1NKEA 3TWHA 2JWKA 3AO3A 4CZHA 1T6CA 4K8ZA 2E1YA 2QXFA 4Y1CA 3PX4A 3I33A 3LDOA 4L3QA 4YY3K 4DV5K 2YV0X 3VGLA 2E5LK 2C1IA 3SK3A 1YITN 4FZYA 5GIPA 3U9DA 1TK8A 1T6DA 4JKGA 4CERA
chains in the Genus database with same CATH topology
1KAZA 3TSPA 1VAZA 3CW4A 5GAHP 1NGCA 3FZHA 2E2QA 5LJWA 5KPTA 3OHRA 3LM2A 3T69A 2HOEA 4FL9A 3HRGA 1OVYA 2CH5A 4XJXA 4BROA 3CXCM 3ENBA 4ISGA 5AZJB 4FWQA 4OPAA 4FWOA 4A2AA 3DLLL 1JJ2M 3D6RA 4BY9C 1W97L 1YIJN 5LJVA 3O9UA 4PKHA 3S41A 3VEYA 3UB5A 2P9PB 3AARA 4JK7A 1VQ5N 2IVPA 4IOCL 5AQQA 5F1XA 1YUWA 3H3OB 4ILJA 1ZBSA 4WYBA 4BGBA 5EXWA 2NRXA 2V52B 2YCHA 1VQ9N 3AAPA 3IFRA 3BF1A 5M1KA 3QFPA 3CCMN 4U67L 4BGAA 1GLFO 3ZEUA 4CZGA 1C0GA 3O8MA 3W3DA 2HSTA 5AZIA 3HOTA 1SZ2A 4ILHA 3ZETB 4CZLA 1K73O 4FWKA 5KQDA 4H5WA 1GLBG 2CGKA 1GLAG 3WQTA 3P39A 2D4WA 1QQOA 3UKRB 3H1VX 3UKRA 5M1FA 3NVKA 4A61A 5ELZA 4QS9A 3JS6A 2CGLA 5LY3A 1BU6O 1BDGA 1K8KB 5AQRA 3DJCA 2P9KA 4IZ9A 1QZ6A 2ZGYA 4JK8A 2KLAA 3DAWA 4JNEA 3ULEB 4YOWA 3CQXA 3CMEN 3O9SA 1HKBA 1P90A 2F9TA 4BREA 1VQ8N 3CETA 3M6GA 2IVOA 2Q97A 3AGKA 3CJCA 5GIOA 2HBJA 2PBDA 3G4SN 2E8AA 4FWRA 1Q86O 1RFQA 1HUXA 4IO9L 1QZ5A 1LOTB 1JCFA 1DT9A 1VQLN 3D2EB 4YOVA 2D0PA 4YORA 1HX1A 3VF4A 3I55N 4BC3A 3ENHA 3L4IA 4K43A 3VGKA 1NGJA 1VQON 1EQYA 3CJ1A 1Z6RA 5AQJA 1BOTO 4JN4A 2RHKA 4RTFD 4BRQA 3GG4A 3CC2N 4I6MA 2NLXA 4JHDA 4FWLA 3UKUA 3CMAN 1RDUA 4WFBL 1NGBA 3O9QA 4JKDA 2KHOA 2I7NA 1Z05A 2IIRA 1JCEA 1NM1A 3WXIA 4WQ4A 4JKFA 3SF4D 5BREA 5TKWA 3FR0A 4BEBA 4DKWA 3Q7BA 5C2FA 2P9KB 1X3MA 4H5NA 1XQSC 3ZX0A 1DKGD 1DGKN 4BRPA 1YVNA 4CBUA 1ATNA 3SBGA 3L6QA 5E84A 3M5RA 3O4WA 4JKAA 2QTDA 1KXPA 3ZEUB 3EKSA 3VEVA 4OPHA 2JDQD 5AQFA 4BG8A 3PLAA 2QWOA 4KBOA 4O8KA 5AQTA 5CHIA 1Q18A 1NGAA 4FO0A 3OA9A 3AY9A 1GLLO 3WEEA 4BQLA 2BUPA 4CI6A 4WQ5C 3SMPA 4ISFA 5F2RA 2E2OA 1ZXOA 1HKGA 3R6MA 4JKBA 1BA0A 1ATRA 3SAGA 3JXUA 3N4QA 4IOAL 1BWFO 3C6AA 3VEXA 1ATSA 3OBYA 3CCVN 2P9NB 2Q1NA 5EY4A 3CQYA 1GLDG 4CZMA 1EO1A 4PL7A 1ILYA 3ULEA 5DM6L 1NJIO 1TYQB 5HL7L 3WXLA 1SAZA 3QICA 4O8UA 5AQMA 4CD3A 5AQVA 4PL8A 3KC6A 1NBWA 3B8AX 3KVGA 4BVPA 5JLHA 3CERA 4FOEA 2F7TA 3AGRA 3M3ZA 4YOTA 2ITMA 1MWKA 5GADP 3J7ZO 1U2VB 4WCEL 5CE3A 3T7ZA 2VCPA 4Z94A 4RCHA 3PIPL 3BEXA 5AQXA 2DPNA 2QM1A 4GY2B 4EHTA 2VWBA 2FSNA 4EHUA 5AFUA 5JVHL 3VF6A 4WFNL 3SLCA 1MDUB 3BP8A 2QWLA 2Q0RA 3IMXA 4H0PA 3UKUB 3ZX2A 4CBXA 3QB0A 5JMVA 1Q7YO 1KD1O 1MWMA 3H46O 3G25A 3W0LA 1VQPN 2A40A 3E9LA 4G9ZA 2P9LB 3ID6A 1BA1A 5AFUH 4B9QA 1C0FA 1HPMA 3VERA 4CJ7A 1M1KO 3IKMA 5E26A 3SBTA 3GDQA 1K8AO 4ILGB 4RWTA 3VETA 2FSJA 3F2KA 3TTCA 4A5BA 2E2NA 4FWPA 4GVEA 3A0IX 5AQKA 3O08A 1TUUA 2YI1A 2NRZA 4BRKA 1NGDA 3CCQN 3C7NB 2HBMA 3EKUA 3ID8A 4IEEA 4A5AA 4Y0WA 4AF1A 1YXQA 4UAFE 2FLOA 3O1WA 2A5XA 2NNWA 3MMVA 4DB3A 3DXKB 5B8HA 3DXKA 2A3ZA 1WUAA 5KQ8A 2GTDA 3VPZA 1NMDA 4LC9B 1VQ7N 5AQUA 4CZIA 3A5NC 3O1BA 3H3NO 3H45C 4BECA 3EN9A 4KH4A 3TTDA 3WQUA 1VQKN 4UAEF 1E4FT 2CH6A 5AZIB 1NLVA 3MN6A 2V7ZA 2HMPA 4BRHA 5BRHA 5AQYA 3A5LC 4FWMA 4U7BA 1E4GT 1YJWN 2QWNA 2PAVA 3F9MA 3TU5A 1V4SA 4FWSA 1NGFA 2YJFA 4BRCA 5H1SQ 4H5VA 1S22A 4R79A 4GV9A 1R59O 3HBTA 5C0YA 3E9OA 1GLCG 2AP1A 3WXKA 2MN5A 2YHXA 4B1YB 1T3VA 3VOVA 3R8EA 2K35A 4HTLA 5I9EB 3L0QA 5EOYA 4IXCA 5M1QA 3ATVA 3C7NA 2QWMA 3AAQA 1ZC6A 4BE7B 1G99A 2A42A 3ZYYX 3HI0A 3GE1A 1P8ZA 3R3LA 5FPDA 2ASPA 4B1UB 4PKGA 5AQOA 3LDLA 4JKGB 3G71N 4PKIA 3CCRN 2W40A 5AQWA 1QHAA 3FZFA 2WFBA 1Q81O 3TSUA 3FZMA 2QWPA 3E1YA 1KAXA 3EE8A 2GMOA 4BRMA 5C2DA 2Q0UA 2NRRA 2ZJQL 3MN5A 4EFHA 3PIOL 4XH5A 4BQZA 3CCSN 1D4XA 5TKYA 3TSQA 3P38A 3R9PA 5BPLA 1TYQA 1S72N 3SMSA 4YOYA 2QI2A 3I56N 3MK6A 2W41A 4FPAA 4QS7A 3GOIA 3U9ZA 3VMFB 3VENA 3FZLA 3WT0A 1NGHA 2P9UB 2P9UA 3D2FB 1SQKA 4DCHA 2OANA 4JK9A 2QXLA 3SJHA 3CD6N 3O80A 1YHQN 4F9OA 4DHYA 5DM7L 1U2VA 3LM9A 4B1XB 1HLUA 1TUYA 5M1OA 4C1NI 2GX9A 2RE2A 4NO7A 4BRNA 3CPWM 5AQSA 1VQNN 4J8FA 2P9SA 4XEIA 2D0OA 5AQPA 2FF3B 2Q31A 2GWKA 3MN9A 4JD2B 2ZWHA 5AR0A 4FWNA 3CCLN 2ASMA 2YX6A 4JKHA 4A62A 4BG9A 3MCPA 4BRAA 1RGIA 3QFUA 2AA4A 3ENOA 5ADXH 1KQSM 2P9IA 4JKCA 3CJ7A 3CJAA 3CHWA 4BR9A 4YDUA 4CZKA 5KPZA 5F0XA 5GINA 3FLCO 4K41A 5HOOA 1BUPA 5AQNA 3N4PA 3O9RA 4IJNA 2PFUA 3DXMA 1U6ZA 2ZF5O 4FOIA 4IWVA 2NZTA 2QWRA 3WUHA 5ADXA 2BH1A 2YILA 4WF9L 3U4LA 4H0VB 1V4TA 3FFKB 4H0XB 4WQ5A 4CZJA 2C1GA 3ATUA 2NRTA 1MA9B 3VEZA 5BN8A 1KAYA 4IEIA 3RSEA 2FXUA 3RSEB 2HF4A 4BRIA 1WOQA 4C1NK 4CZEA 5M1PA 4IJAA 1Q82O 2P9PA 3QBWA 2NRWA 2JWLA 1POIA 3L56A 1T44A 4YOUA 2Q36A 4M7XA 3M1FA 3U8XA 3ZX3A 2VYPA 2P9SB 4H03B 3GBTA 5BR9A 3O5BA 2BTFA 3DWLA 4IDHA 4IO8A 3CI5A 4BR5A 3F5TA 4KH6A 4WFAL 4BC5A 1M90O 2LN8A 4I6MB 4JHDB 4MDBA 1H1VA 2ZJPL 2WC9A 4GV3A 3A5OC 1BG3A 2P9IB 5AZJA 1YJ9N 3QMLA 3CJ9A 4CBWA 1NGIA 3L4QA 3CCUN 4O5FA 4UADE 5M1NA 3I8BA 3LDPA 3O6WA 3QBXA 4FPBA 5BRDA 4UY8O 3SAHA 1JCGA 1CZAN 3J8AA 3TTFA 3BK3C 3BF3A 4OO1J 3MX5A 5AQLA 3SAFA 4AM6A 2CGJA 3C0BA 2YJEA 3H1QA 4BRDA 3CC7N 1YJNN 4YDUC 4BRGA 1HJOA 3C65A 3EL2A 4NLBA 1DEJA 4JKEA 2VY6A 4H0TB 3VGMA 3MCAB 4BR2A 2D56A 2WUSA 3VTIA 3Q7CA 4CZFA 3A8YA 2W00A 2E88A 3MX2A 4M63C 5C15A 3IDHA 1OKJA 1RDWX 4BRLA 3KWIA 2E2PA 1YAGA 1W2BM 4JAXA 4JEPA 3WXJA 1QVFM 2P9NA 5CR4A 3P4IA 2MBKA 2OTLN 3EE9A 4AM7A 3MWTA 4MDAA 4GNIA 5C12A 2YIOA 5AQGA 4K25A 4IFEA 2NRHA 3D7EO 1NGEA 2D1KA 2IVNA 3OBWA 3E66A 5JICA 3MDQA 4KH5A 4A2BA 2QW9A 3D2FA 3LDNA 4B1VA 4EIAA 3KHYA 4MLEA 4FVUA 2YIPA 4YOXA 3KHWA 4XH1A 2HF3A 1XUPO 4H0YB 4NLCA 2E2FA 4BR0A 4A59A 5BRFA 2A6AA 2EWSA 3EO3A 3NVMA 2ZJRL 3H6EA 3HTVA 1XC3A 4ISEA 1S3XA 2OTJN 3CF5L 2E1ZA 2A41A 3C6HA 4NB4A 2QWQA 4WQ4C 3HM8A 5FPMA 1YF5L 3GL1A 3WXMB 3KK7A 4BC4A 3KWGA 1NWKA 3ZETA 4C23A 3WEEB 5GAGP 1X9JA 3R1XA 3VF2A 4GV6A 1VQ6N 4BR7A 4M7YA 2P9LA 2FF6A 2GEMA 3CPEA 1QQNA 1K8KA 4DQ8A 3CJBA 1K9MO 3DXMB 3RVCA 2GUPA 4K42A 1O13A 3G6EN 1NGGA 1X3NA 2HBKA 4H0OA 1Y64A 5MLCQ 5BPNA 1HKCA 2GWJA 2V7YA 1SS6A 2QEXN 3VEOA 4HWIA 3KZBA 4BC2A 4BVOA 3UE5A 5BN9A 3FZKA 3CIPA 4XH4A 2ASOA 3FGUA 3QDKA 3K9KA 3D2EA 3R2VA 2E20A 3EZWA 3HZ6A 3LL3A 2HBLA 3E9PA 4CD1A 2J4RA 4EAHD 3A5MC 4MO5A 4BR4A 1KC8O 2WBNA 1YI2N 2QA4N 1QQMA 2UYTA 3VTHA 5AQHA 5FPNA 4IOXA 1J6ZA 2ZGZA 3VESA 2YHWA 3IUCA 5JVGL 1N8RO 5AQZA 1BO5O 4MO4A 1IG8A 1IJJA 2JWKA 5EVZA 4QS8A 5GAEP 4CZHA 2GELA 1T6CA 3VEWA 4B1ZA 3O9TA 3LDQA 3BUZB 4E1JA 4MLHA 5JLFA 4FSVA 2E1YA 5FPEA 2H3GX 3MWPA 3OW2M 5AQIA 5EX5A 2F9WA 1VQMN 3FE1A 3I33A 3LDOA 4L3QA 3TPQA 3NMUA 3CCJN 2NRVA 2FSKA 4B1WB 1GLEG 2KKZA 3MN7A 4BRFA 2Q2RA 2YHYA 3CC4N 2VGMA 4H5TA 3VGLA 4JD2A 3QI7A 2C1IA 3HOSA 3SK3A 1GLJO 1YITN 2I7PA 3P31A 3HSCA 4PHTX 1VQ4N 5C10A 1LCUA 3K9JA 2V51B 5GIPA 4H5RA 2VGNA 3U9DA 5KPRA 1T6DA 3CCEN 1QVGM 4JKGA 5BPMA 4A57A 1ESVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAZ A;  1NGC A;  3FZH A;  2E2Q A;  5LJW A;  5KPT A;  3OHR A;  3LM2 A;  2HOE A;  4FL9 A;  2CH5 A;  4BRO A;  5AZJ B;  4ISG A;  4FWQ A;  4FWO A;  4A2A A;  5LJV A;  4PKH A;  3S41 A;  3VEY A;  3UB5 A;  2P9P B;  3AAR A;  2IVP A;  5AQQ A;  5F1X A;  1YUW A;  3H3O B;  1ZBS A;  4WYB A;  4BGB A;  5EXW A;  2V52 B;  2YCH A;  3AAP A;  3IFR A;  3BF1 A;  3QFP A;  4BGA A;  1GLF O;  3ZEU A;  4CZG A;  1C0G A;  3O8M A;  3W3D A;  5AZI A;  1SZ2 A;  3ZET B;  4CZL A;  4FWK A;  5KQD A;  4H5W A;  1GLB G;  2CGK A;  1GLA G;  3WQT A;  2D4W A;  1QQO A;  3UKR B;  3H1V X;  3UKR A;  4A61 A;  5ELZ A;  4QS9 A;  3JS6 A;  2CGL A;  5LY3 A;  1BU6 O;  1BDG A;  1K8K B;  5AQR A;  3DJC A;  2P9K A;  4IZ9 A;  1QZ6 A;  2ZGY A;  3DAW A;  4JNE A;  3ULE B;  3CQX A;  1HKB A;  2F9T A;  4BRE A;  3CET A;  3M6G A;  2IVO A;  2Q97 A;  3CJC A;  2PBD A;  2E8A A;  4FWR A;  1RFQ A;  1HUX A;  1QZ5 A;  1LOT B;  1JCF A;  3D2E B;  2D0P A;  1HX1 A;  3VF4 A;  4BC3 A;  3ENH A;  3L4I A;  4K43 A;  3VGK A;  1NGJ A;  1EQY A;  3CJ1 A;  1Z6R A;  5AQJ A;  1BOT O;  4JN4 A;  4RTF D;  4BRQ A;  3GG4 A;  4I6M A;  2NLX A;  4JHD A;  4FWL A;  3UKU A;  1NGB A;  2KHO A;  2I7N A;  1Z05 A;  2IIR A;  1JCE A;  1NM1 A;  3WXI A;  4WQ4 A;  5BRE A;  3FR0 A;  1X3M A;  2P9K B;  4H5N A;  1XQS C;  3ZX0 A;  1DKG D;  1DGK N;  4BRP A;  1YVN A;  4CBU A;  1ATN A;  3L6Q A;  5E84 A;  3O4W A;  1KXP A;  3ZEU B;  3EKS A;  3VEV A;  4BG8 A;  5AQF A;  2QWO A;  4KBO A;  4O8K A;  5AQT A;  1Q18 A;  1NGA A;  4FO0 A;  3AY9 A;  1GLL O;  3WEE A;  4BQL A;  2BUP A;  4CI6 A;  4WQ5 C;  3SMP A;  4ISF A;  5F2R A;  2E2O A;  1ZXO A;  1HKG A;  3R6M A;  1BA0 A;  1ATR A;  3JXU A;  1BWF O;  3VEX A;  1ATS A;  2P9N B;  2Q1N A;  5EY4 A;  3CQY A;  1GLD G;  4CZM A;  4PL7 A;  3ULE A;  1TYQ B;  3WXL A;  1SAZ A;  3QIC A;  5AQM A;  4CD3 A;  5AQV A;  4PL8 A;  1NBW A;  3B8A X;  3KVG A;  4BVP A;  5JLH A;  3CER A;  4FOE A;  3M3Z A;  2ITM A;  1MWK A;  1U2V B;  5CE3 A;  2VCP A;  4Z94 A;  4RCH A;  3BEX A;  5AQX A;  2DPN A;  2QM1 A;  4GY2 B;  4EHT A;  2VWB A;  2FSN A;  4EHU A;  5AFU A;  3VF6 A;  3SLC A;  1MDU B;  3BP8 A;  2QWL A;  2Q0R A;  3IMX A;  4H0P A;  3UKU B;  3ZX2 A;  4CBX A;  3QB0 A;  5JMV A;  1MWM A;  3H46 O;  3G25 A;  3W0L A;  2A40 A;  2P9L B;  4B9Q A;  1BA1 A;  5AFU H;  1C0F A;  1HPM A;  3VER A;  4CJ7 A;  5E26 A;  3GDQ A;  4RWT A;  3VET A;  2FSJ A;  2E2N A;  4FWP A;  3A0I X;  5AQK A;  3O08 A;  1TUU A;  2YI1 A;  4BRK A;  1NGD A;  3C7N B;  3EKU A;  3ID8 A;  4Y0W A;  1YXQ A;  2FLO A;  3O1W A;  2A5X A;  3MMV A;  4DB3 A;  3DXK B;  5B8H A;  3DXK A;  2A3Z A;  1WUA A;  5KQ8 A;  2GTD A;  3VPZ A;  1NMD A;  4LC9 B;  5AQU A;  4CZI A;  3A5N C;  3O1B A;  3H3N O;  3H45 C;  3EN9 A;  3WQU A;  1E4F T;  2CH6 A;  5AZI B;  1NLV A;  3MN6 A;  2V7Z A;  2HMP A;  4BRH A;  5BRH A;  5AQY A;  3A5L C;  4FWM A;  1E4G T;  2QWN A;  2PAV A;  3F9M A;  3TU5 A;  1V4S A;  4FWS A;  1NGF A;  2YJF A;  4BRC A;  4H5V A;  1S22 A;  1R59 O;  3HBT A;  1GLC G;  2AP1 A;  3WXK A;  2YHX A;  4B1Y B;  3VOV A;  3R8E A;  4HTL A;  5I9E B;  3L0Q A;  5EOY A;  4IXC A;  3ATV A;  3C7N A;  2QWM A;  3AAQ A;  1ZC6 A;  1G99 A;  2A42 A;  3HI0 A;  3GE1 A;  1P8Z A;  5FPD A;  2ASP A;  4B1U B;  4PKG A;  5AQO A;  3LDL A;  4PKI A;  2W40 A;  5AQW A;  1QHA A;  3FZF A;  3FZM A;  2QWP A;  4BRM A;  1KAX A;  2Q0U A;  3MN5 A;  4EFH A;  4XH5 A;  4BQZ A;  1D4X A;  5TKY A;  3R9P A;  5BPL A;  1TYQ A;  3SMS A;  3MK6 A;  2W41 A;  4FPA A;  4QS7 A;  3GOI A;  3U9Z A;  3VEN A;  3FZL A;  3WT0 A;  1NGH A;  2P9U B;  2P9U A;  3D2F B;  1SQK A;  4DCH A;  2OAN A;  2QXL A;  3SJH A;  3O80 A;  4F9O A;  4DHY A;  1U2V A;  3LM9 A;  4B1X B;  1HLU A;  1TUY A;  4NO7 A;  4BRN A;  5AQS A;  4J8F A;  2P9S A;  4XEI A;  2D0O A;  5AQP A;  2FF3 B;  2Q31 A;  2GWK A;  3MN9 A;  4JD2 B;  2ZWH A;  5AR0 A;  4FWN A;  2ASM A;  4A62 A;  4BG9 A;  3MCP A;  4BRA A;  1RGI A;  3QFU A;  2AA4 A;  3ENO A;  5ADX H;  2P9I A;  4CZK A;  3CJ7 A;  3CJA A;  3CHW A;  4BR9 A;  4YDU A;  5KPZ A;  5F0X A;  3FLC O;  4K41 A;  1BUP A;  5AQN A;  4IJN A;  3DXM A;  1U6Z A;  2ZF5 O;  4FOI A;  4IWV A;  2NZT A;  2QWR A;  3WUH A;  5ADX A;  3U4L A;  4H0V B;  1V4T A;  3FFK B;  4H0X B;  4WQ5 A;  4CZJ A;  3ATU A;  3VEZ A;  1MA9 B;  5BN8 A;  1KAY A;  3RSE A;  2FXU A;  3RSE B;  2HF4 A;  4BRI A;  1WOQ A;  4CZE A;  4IJA A;  2P9P A;  3QBW A;  1T44 A;  3U8X A;  2Q36 A;  4M7X A;  3M1F A;  3ZX3 A;  2VYP A;  2P9S B;  4H03 B;  3GBT A;  5BR9 A;  3O5B A;  2BTF A;  3DWL A;  4IO8 A;  3CI5 A;  4BR5 A;  4BC5 A;  4I6M B;  4JHD B;  1H1V A;  3A5O C;  1BG3 A;  2P9I B;  5AZJ A;  3QML A;  3CJ9 A;  4CBW A;  1NGI A;  4O5F A;  3I8B A;  3LDP A;  3O6W A;  3QBX A;  4FPB A;  5BRD A;  1JCG A;  1CZA N;  3J8A A;  3BF3 A;  5AQL A;  4AM6 A;  2CGJ A;  3C0B A;  2YJE A;  3H1Q A;  4BRD A;  4YDU C;  4BRG A;  1HJO A;  3EL2 A;  1DEJ A;  4H0T B;  3VGM A;  4BR2 A;  2WUS A;  4CZF A;  3A8Y A;  2E88 A;  4M63 C;  3IDH A;  1OKJ A;  1RDW X;  4BRL A;  2E2P A;  1YAG A;  4JAX A;  3WXJ A;  2P9N A;  3P4I A;  4AM7 A;  4GNI A;  5AQG A;  4K25 A;  2NRH A;  3D7E O;  1NGE A;  2D1K A;  2IVN A;  5JIC A;  3MDQ A;  4EIA A;  4A2B A;  2QW9 A;  3D2F A;  3LDN A;  4B1V A;  3KHY A;  4MLE A;  4XH1 A;  2HF3 A;  1XUP O;  4H0Y B;  4BR0 A;  5BRF A;  2A6A A;  2EWS A;  3EO3 A;  3H6E A;  3HTV A;  1XC3 A;  4ISE A;  1S3X A;  2E1Z A;  2A41 A;  4WQ4 C;  4NB4 A;  2QWQ A;  3HM8 A;  5FPM A;  4BC4 A;  3GL1 A;  1NWK A;  3ZET A;  4C23 A;  3WEE B;  1X9J A;  3VF2 A;  4BR7 A;  4M7Y A;  2P9L A;  2FF6 A;  2GEM A;  1QQN A;  1K8K A;  4DQ8 A;  3CJB A;  3DXM B;  2GUP A;  4K42 A;  1NGG A;  1X3N A;  4H0O A;  1Y64 A;  5BPN A;  1HKC A;  2GWJ A;  2V7Y A;  3VEO A;  4HWI A;  3KZB A;  4BC2 A;  4BVO A;  3UE5 A;  5BN9 A;  3FZK A;  3CIP A;  4XH4 A;  2ASO A;  3FGU A;  3QDK A;  3D2E A;  2E20 A;  3EZW A;  3HZ6 A;  3LL3 A;  4EAH D;  4CD1 A;  2J4R A;  3A5M C;  4MO5 A;  4BR4 A;  1QQM A;  2UYT A;  5AQH A;  5FPN A;  1J6Z A;  2ZGZ A;  3VES A;  2YHW A;  3IUC A;  5AQZ A;  1BO5 O;  4MO4 A;  1IG8 A;  1IJJ A;  5EVZ A;  4QS8 A;  4CZH A;  2GEL A;  1T6C A;  3VEW A;  4B1Z A;  3LDQ A;  3BUZ B;  4E1J A;  4MLH A;  5JLF A;  4FSV A;  2E1Y A;  5FPE A;  2H3G X;  5AQI A;  5EX5 A;  2F9W A;  3FE1 A;  3I33 A;  3LDO A;  4L3Q A;  3TPQ A;  2FSK A;  4B1W B;  1GLE G;  3MN7 A;  4BRF A;  2Q2R A;  2YHY A;  4H5T A;  3VGL A;  4JD2 A;  3SK3 A;  1GLJ O;  2I7P A;  3HSC A;  1LCU A;  2V51 B;  4H5R A;  3U9D A;  5KPR A;  1T6D A;  5BPM A;  1ESV A; 
#chains in the Genus database with same CATH topology
 2LJ7 A;  1KAZ A;  1DTT A;  1TK0 A;  4WE1 A;  4KI6 A;  3K5L A;  1NGC A;  1PE4 A;  3KLI A;  4C8O A;  4PQU A;  5LJW A;  2B5J A;  2FC0 A;  4DR5 K;  4BRO A;  4CHP A;  4CJU A;  4FWQ A;  3ZT3 A;  4FWO A;  4BY9 C;  5LL6 Z;  4PKH A;  3S41 A;  3VEY A;  3U3G A;  2IVP A;  3WNF A;  5F1X A;  4Z4G A;  2NRX A;  3AAP A;  3IFR A;  3M8S A;  3BF1 A;  3CCM N;  3B6P A;  1GLF O;  3ZEU A;  4LF5 K;  1C0G A;  5AZI A;  2N66 A;  3ZET B;  1GLA G;  5CZ2 A;  2BGG A;  3UKR B;  3H1V X;  3UKR A;  5M1F A;  3NVK A;  1TI5 A;  4QS9 A;  4Z4E A;  3JS6 A;  2LI7 A;  5AQR A;  3OYJ A;  3DJC A;  2P9K A;  2ZGY A;  4EZ6 A;  3ULE B;  4JNE A;  1VQ8 N;  4CQK A;  3AGK A;  2HBJ A;  1KV0 A;  4FWR A;  1Q86 O;  4IO9 L;  1HUX A;  2HMI A;  1TL1 A;  1JCF A;  4YOV A;  2D0P A;  4B9S A;  1HX1 A;  3VF4 A;  2O8C B;  4CFC A;  3AO2 A;  3CJ1 A;  1RT1 A;  4RTF D;  1NG9 A;  3NFA A;  3GG4 A;  4I6M A;  3UKU A;  4CJP A;  2ETJ A;  4QAG A;  1VSJ A;  2I7N A;  2IIR A;  5CY0 A;  1NK0 A;  4E1N A;  3HP6 A;  4XIU A;  4DV6 K;  4FK0 A;  3QEI A;  3ZX0 A;  4CEO A;  1YVN A;  2LSN A;  4CBU A;  1ATN A;  4DF4 A;  3CYM A;  2R7Y A;  3M5R A;  1QS4 A;  4CIG A;  4IFV A;  1SKR A;  1ZVG A;  1HNX K;  1KXP A;  3ZEU B;  4OPH A;  2QWO A;  4KBO A;  5CHI A;  1NJX A;  3B6O A;  1IG9 A;  1GLL O;  2BUP A;  4KTQ A;  3SMP A;  1RDD A;  1ZXO A;  3R6M A;  3OYH A;  3SAG A;  3QIO A;  1BWF O;  3VEX A;  1KTQ A;  2Q1N A;  5EY4 A;  3CQY A;  1X9W A;  1EO1 A;  1T03 A;  5DM6 L;  2QKK A;  2X6N A;  4N56 A;  2O8B B;  3QIC A;  2IOC A;  3OYK A;  1HNW K;  2G8W A;  3KC6 A;  4BVP A;  5HP1 A;  3TAR A;  2F7T A;  3AGR A;  3AO1 A;  2ITM A;  3J7Z O;  2BRZ A;  2VCP A;  3PIP L;  3BEX A;  1NOY A;  2HNZ A;  4IG3 A;  2N69 A;  4GY2 B;  3J7Y P;  4OPJ A;  4DTN A;  3VF6 A;  4WFN L;  3SLC A;  1NNE A;  3QES A;  2QWL A;  2Q0R A;  4H0P A;  4BDY A;  2X74 A;  1KD1 O;  1GOB A;  1MWM A;  3H46 O;  1VSH A;  3G25 A;  3W0L A;  3E9L A;  3ID6 A;  4DU4 A;  3CM6 A;  1NKC A;  3IKM A;  3SBT A;  1LAW A;  4OKE A;  1K8A O;  4GVM A;  3TTC A;  4FWP A;  4JI7 K;  2YI1 A;  4DMN A;  4KB1 A;  5C24 A;  4IKF A;  4OGC A;  3CCQ N;  3C7N B;  2GUI A;  4Y0W A;  4M42 A;  3MMV A;  1RBU A;  5B8H A;  4Z4I A;  4KRE A;  1WUA A;  3THY A;  3VA0 A;  3TAB A;  1QE1 A;  3H08 A;  4FJ7 A;  4LC9 B;  5AQU A;  3A5N C;  3H3N O;  4BEC A;  2G8U A;  3EN9 A;  4KH4 A;  3TTD A;  3WQU A;  1VQK N;  2LT8 A;  4UAE F;  4OLA A;  1X9M A;  5BRH A;  4U7B A;  1IBM K;  4J2D A;  3SQ2 A;  1W7A A;  4CF2 A;  2QWN A;  4Z4C A;  3F9M A;  1W9H A;  4RW8 A;  4H5V A;  5C0Y A;  4DU1 A;  1GLC G;  5HRP A;  1T3V A;  3VOV A;  4DSE A;  3R8E A;  3QIN A;  4HTL A;  5I9E B;  4OVL A;  3PO4 A;  2UXD K;  4M45 A;  4CF9 A;  1G99 A;  2A42 A;  3AVB A;  1NK6 A;  1LWF A;  3GE1 A;  5FPD A;  3LPU A;  2ASP A;  3PX0 A;  3LDL A;  2P5G A;  1T05 A;  1ASW A;  3G71 N;  3CCR N;  5AQW A;  2FBV A;  3FZF A;  1SKW A;  1IKW A;  1D8Y A;  2Q0U A;  2OPS A;  1I6G A;  4EFH A;  5LMU K;  1XMQ K;  4XH5 A;  1NOZ A;  4BQZ A;  3TSQ A;  5BPL A;  1S72 N;  3NH1 A;  3D0P A;  1J54 A;  3L8B A;  3HST B;  3VQB A;  5C25 A;  3VMF B;  3GOI A;  1RT4 A;  1TKT A;  3WT0 A;  4HCB A;  1NGH A;  4FLX A;  1VSE A;  4HHF A;  4LFC K;  4OGE A;  1XNQ K;  2UUC K;  1TKX A;  3CD6 N;  3K5O A;  4DHY A;  3EEQ A;  4GW6 A;  4B1X B;  2X6S A;  4C1N I;  2RE2 A;  4BRN A;  3AA3 A;  4GMJ B;  4BWM A;  2FF3 B;  3LP0 A;  2GWK A;  4ICL A;  3RRH A;  3NGZ A;  2LY5 A;  2YX6 A;  2XY7 A;  4BG9 A;  4B3M K;  3LP2 A;  2YNF A;  3RWU A;  4GKJ K;  2AA4 A;  1S1W A;  4JKC A;  3CJ7 A;  5KPZ A;  4YDU A;  1RT3 A;  3SV4 A;  3CYG A;  1RDC A;  3ALY A;  3MED A;  5HOO A;  4CK3 A;  4IJN A;  3O9R A;  4KTZ A;  2PFU A;  3V1Q A;  4FOI A;  4O44 A;  4FYD A;  3DLE A;  3G10 A;  2HHX A;  2YIL A;  4DV1 K;  3U4L A;  4W5O A;  4H0X B;  4WQ5 A;  3MAQ A;  2HHV A;  4CZJ A;  4IDK A;  3AO5 A;  4CF1 A;  5BN8 A;  4O0J A;  1KAY A;  4C1N K;  4IJA A;  3VQD A;  3RR8 A;  4DFM A;  3QBW A;  1JXC A;  2JWL A;  3L56 A;  2Q36 A;  3M1F A;  3DRS A;  3ZX3 A;  2P9S B;  3O5B A;  2QKB A;  3QIP A;  4WFA L;  3L2U A;  4KH6 A;  2YHB A;  1M90 O;  4W5N A;  3L2Q A;  4Y1D A;  4CGJ A;  1RT7 A;  3NHG A;  1H1V A;  5FRO A;  4GV3 A;  4FJK A;  1YJ9 N;  3QML A;  3CJ9 A;  3O4N A;  4O5F A;  1XC9 A;  4UAD E;  1MU2 A;  4FPB A;  3BF3 A;  2O8E A;  3SAF A;  3DLG A;  3TAP A;  4DV7 K;  3SV3 A;  1YTA A;  5DMR A;  1YJN N;  4YDU C;  4BRG A;  3C65 A;  1L5U A;  4JKE A;  4CHO A;  4H0T B;  3T1A A;  1VSI A;  2EX3 A;  2WUS A;  3Q7C A;  4FVM A;  3VTI A;  2XO7 A;  3DRR A;  2OPR A;  4E7K A;  3V9Z A;  4DR6 K;  3S3M A;  5AJ3 K;  1NMN A;  2OTL N;  1BQN A;  4GNI A;  3QEW A;  3VQ8 A;  4BE0 A;  2KJA A;  1BGX T;  4AB0 A;  4CFB A;  2D1K A;  1HNV A;  3OBW A;  3LDS A;  3E66 A;  1U47 A;  1N6Q A;  3LPT A;  4A2B A;  4FVU A;  3C94 A;  1Z26 A;  1NKB A;  1N32 K;  5JEN A;  2YIP A;  3KHW A;  2HF3 A;  5J2N A;  1XUP O;  4FW2 A;  5BRF A;  3EO3 A;  4HTU A;  2ATQ A;  5BR8 K;  3O3H A;  3HPH A;  5HRO A;  4BC4 A;  3GL1 A;  1REV A;  3KK7 A;  3TAF A;  1LW2 A;  3THW A;  4J2E A;  1NWK A;  3ZET A;  1VQ6 N;  3A2F A;  3IAY A;  1K8K A;  3DOK A;  3CJB A;  4DQ8 A;  5KTQ A;  4W5R A;  4M3X A;  3DXM B;  4K42 A;  5KGW A;  2YNG A;  5BPN A;  1HKC A;  1NJY A;  3HVT A;  4ID5 A;  4BC2 A;  4HWI A;  4AHU A;  3UE5 A;  3PUF A;  4OJR A;  4DFP A;  4ELU A;  2O8D B;  3P83 D;  1CXU A;  4FLT A;  1JLE A;  3K9K A;  1QVG M;  3HZ6 A;  2HBL A;  1SL2 A;  4MO5 A;  2ZD1 A;  4BDP A;  4DQQ A;  4H8K A;  1QQM A;  4CF8 A;  3VTH A;  3HXM A;  1J6Z A;  2ZGZ A;  3VES A;  4PUO A;  1ZFU A;  2LY6 A;  3KP1 A;  4MO4 A;  1IJJ A;  5GAE P;  2Z1H A;  1EX4 A;  3HM9 A;  4DV4 K;  4DS4 A;  4DTS A;  3BUZ B;  4E1J A;  3OYM A;  1NK4 A;  4FSV A;  3OW2 M;  4MQ3 A;  1KLM A;  3AVN A;  2RF2 A;  1CHZ A;  1UA0 A;  3CCJ N;  2FSK A;  1O1W A;  4B1W B;  4CF0 A;  2YHY A;  2VGM A;  1ZBU A;  4FJI A;  3QI7 A;  3HOS A;  4KHP K;  4I9L A;  3HSC A;  1TL3 A;  3QNO A;  1WB9 A;  1L3V A;  2HHW A;  4K0K K;  3CCE N;  2IS3 A;  1ESV A;  1QSL A;  1HYS A;  1VAZ A;  3CW4 A;  3PV8 A;  4DSF A;  1TAQ A;  5KPT A;  3LWM A;  3SYZ A;  2Z1I A;  3T69 A;  2HOE A;  4FL9 A;  2VG5 A;  3KKS A;  3DYA A;  3DM2 A;  4A2A A;  3DLL L;  2HVH A;  4CK2 A;  2XY5 A;  2N2R A;  2P9P B;  5AQQ A;  4ILJ A;  3GKU A;  4WYB A;  1VQ9 N;  1SKS A;  1D9D A;  2BDP A;  4CZG A;  3QER A;  3O8M A;  4DFJ A;  4CJE A;  4Q0B A;  2OCE A;  4CZL A;  1B7D A;  3WQT A;  1I3A A;  1QQO A;  2E4L A;  4A61 A;  5ELZ A;  4LF6 K;  2E6M A;  1B9F A;  3HPG A;  1C0U A;  4YOW A;  2YC1 C;  3O9S A;  1P90 A;  5J2P A;  2NY8 X;  4KRF A;  3CET A;  1ZYV A;  2PYJ A;  2Q97 A;  5GIO A;  2PBD A;  1QTM A;  1JXE A;  3I0S A;  1VQL N;  4JI4 K;  2D0C A;  1LV5 A;  3K5M A;  4F4K A;  1A5W A;  3VGK A;  5AQJ A;  1BOT O;  4JN4 A;  4BRQ A;  4EP4 A;  3P5J A;  4FZZ A;  4M3U A;  4JHD A;  1ZVE A;  1J5O A;  4GKK K;  5DK5 A;  1EKE A;  1SL1 A;  4CEE A;  4ELT A;  1NM1 A;  3J80 O;  4JKF A;  3SF4 D;  2M8B B;  4ZHR A;  5TKW A;  1SN1 A;  4BEB A;  4DKW A;  3Q7B A;  3ZLJ A;  3DOL A;  4CJV A;  3VQQ A;  1X3M A;  1JKZ A;  1XQS C;  1DGK N;  4BRP A;  3S3O A;  3THX A;  3OYF A;  5E84 A;  3O4W A;  2A1S A;  4JKA A;  4BE1 A;  3T3F A;  2Y1I A;  3EKS A;  3PLA A;  2E3F A;  1BK8 A;  1HNZ K;  1ZYW A;  5AQT A;  1DTQ A;  3JSM A;  4NXN K;  3OA9 A;  1BRZ A;  3AY9 A;  3WEE A;  2D0B A;  4JI0 K;  3THY B;  1SUQ A;  2E2O A;  3ZSX A;  3L3V A;  5HRN A;  1BA0 A;  4FJL A;  3JXU A;  3N4Q A;  3CCV N;  3BY5 A;  1GLD G;  4CZM A;  1ILY A;  3HYF A;  1ICA A;  4NXM K;  2G2K A;  1TYQ B;  4DQP A;  1SAZ A;  1X1P A;  4UJ0 A;  4I2P A;  4DF8 A;  5AQV A;  4KTW A;  1NBW A;  3B8A X;  5JLH A;  3CER A;  4N5S A;  4JYA K;  5GAD P;  3ITH A;  1U2V B;  4LD0 A;  5KRT A;  4Z94 A;  1NU0 A;  3THV A;  4KB0 A;  3AVH A;  2DPN A;  4DLG A;  1WSG A;  2FSN A;  3VQA A;  5AFU A;  1MDU B;  3UKU B;  4N76 A;  4N47 A;  4CGG A;  4G9Z A;  2A40 A;  4FLV A;  1M1K O;  4RWT A;  2HB5 A;  4GVE A;  5AQK A;  1TUU A;  2NRZ A;  1T7P A;  4BRK A;  4JLH A;  3ZSY A;  1X9S A;  4KAZ A;  3EKU A;  2VG6 A;  3DMJ A;  1DLO A;  4UAF E;  4AF1 A;  1TGO A;  4KHW A;  3ZSO A;  5SWM A;  1C56 A;  4B8A B;  3ZSQ A;  3DXK B;  1HPZ A;  3LP1 A;  1U49 A;  3OYA A;  3ZSZ A;  2GTD A;  3VPZ A;  3KD5 E;  1T0Z A;  3H45 C;  2ZQB A;  4HHT A;  2CH6 A;  5AZI B;  3MN6 A;  2XY8 A;  3A5L C;  2O4G A;  1E4G T;  1YJW N;  4F2R A;  2KPY A;  3PO5 A;  4FWS A;  1NGF A;  3RTV A;  2B4J A;  5H1S Q;  4GV9 A;  3KOX A;  3HBT A;  3E9O A;  3WXK A;  2MN5 A;  4B1Y B;  4X64 K;  1BCG A;  2K35 A;  3C6T A;  5EOY A;  4IXC A;  1RNH A;  3AAQ A;  3BZK A;  1ZBF A;  1NH5 A;  3AVJ A;  1TKD A;  1IO2 A;  2G8V A;  5HBM A;  1UOC A;  2W40 A;  2WFB A;  2FBX A;  3TI0 A;  3E1Y A;  1KAX A;  3NH2 A;  2GMO A;  5C2D A;  1OH6 A;  4F3O A;  2NRR A;  2ZJQ L;  3PIO L;  5TKY A;  3HJF A;  3NCI A;  3P38 A;  2BE2 A;  3AA2 A;  3LAM A;  1JL1 A;  3I56 N;  1UWB A;  3MK6 A;  2W41 A;  1HMV A;  3VEN A;  3FZL A;  2P9U B;  1SQK A;  4DCH A;  2OAN A;  4E19 A;  3SPZ A;  4JK9 A;  2QXL A;  4I2Q A;  5DM7 L;  2OPQ A;  4CK1 A;  3JYT A;  1U2V A;  1HLU A;  1TUY A;  2O8E B;  4DQS A;  2GX9 A;  1TK5 A;  4Z4F A;  1VQN N;  2Z1G A;  2JGU A;  1B3C A;  1C1B A;  1SNB A;  2D0O A;  4DTP A;  2Q31 A;  3NF7 A;  3MXM A;  4FJ9 A;  1JZA A;  4V1D C;  2ASM A;  3OYI A;  1WAJ A;  4JKH A;  4A62 A;  3MCP A;  4BRA A;  3QFU A;  4DQI A;  2P9I A;  4CZK A;  3CJA A;  4CJR A;  3FLC O;  4OX9 K;  4K41 A;  5AQN A;  4JI1 K;  1U6Z A;  4IWV A;  2NZT A;  3NH0 A;  2BH1 A;  1EXQ A;  2Z1J A;  4JI2 K;  4KO0 A;  1NPI A;  4KYP A;  1S5J A;  2B68 A;  1F21 A;  3ATU A;  2NRT A;  3RSE A;  4BRI A;  2HF4 A;  4CZE A;  4V19 S;  1Q82 O;  2OPP A;  3RMD A;  2NRW A;  1POI A;  3E7U X;  1T44 A;  4M7X A;  1S1V A;  2VYP A;  3SI6 A;  3CI5 A;  3V1R A;  4LH5 A;  4BR5 A;  4BC5 A;  1PTX A;  2LN8 A;  4JHD B;  4O4G A;  2ZJP L;  3KK2 A;  1XHX A;  1YT3 A;  3A5O C;  4CFD A;  5AZJ A;  3J81 O;  1A5V A;  3CCU N;  2WOM A;  1T7B A;  5BRD A;  3O6W A;  4UY8 O;  1KFS A;  3BK3 C;  1RTI A;  3MX5 A;  3EZ5 A;  2RKI A;  4FXD A;  2YJE A;  1I6F A;  1S6P A;  3L2W A;  3EL2 A;  1R0A A;  1DEJ A;  2VY6 A;  4CJL A;  3MCA B;  1JLA A;  4CJ3 A;  4M3W A;  4M63 C;  3KTQ A;  3IDH A;  3PSI A;  3ZSW A;  3DI6 A;  4BRL A;  5CYM A;  4JI6 K;  1W2B M;  4JAX A;  4DR1 K;  4PWD A;  4AH9 A;  4JI5 K;  1QVF M;  3ZCM A;  5J2Q A;  1OMY A;  2RN2 A;  4CES A;  1WT7 A;  2HHI A;  4KFB A;  4MDA A;  1UAX A;  1BL3 A;  5C12 A;  4AHV A;  2YIO A;  4IFE A;  3LWL A;  3LDN A;  3D2F A;  3F9K A;  4B1V A;  1Y97 A;  5JS2 A;  3HVR A;  1SEG A;  4H0Y B;  1JXB A;  4BR0 A;  3NBP A;  2A6A A;  3HP9 A;  2ZJR L;  3M8R A;  3HTV A;  3KK1 A;  4DR7 K;  4KHS A;  3I8D A;  1P0A A;  2E1Z A;  4X66 K;  3LZI A;  2A41 A;  1RT6 A;  4NB4 A;  2QWQ A;  2HHQ A;  1RBS A;  1YF5 L;  3WXM B;  2E0H A;  1BI4 A;  3K2P A;  2VG7 A;  3WEE B;  5GAG P;  1X9J A;  2F4V K;  2P5O A;  4B3R K;  4GV6 A;  2P9L A;  1HRH A;  5IWA K;  1I39 A;  3RVC A;  2GUP A;  3G6E N;  1NGG A;  5MLC Q;  2GWJ A;  4DG1 A;  1D9F A;  2O4I A;  5JS1 A;  4DTO A;  2NUB A;  4B3T K;  3QEX A;  4BVO A;  3CFP A;  5BN9 A;  2DFH A;  4XH4 A;  3KIO A;  3D2E A;  2E20 A;  3DRP A;  1BCM A;  3LL3 A;  4YOY A;  4FM1 A;  3DLR A;  1KC8 O;  4FJX A;  1YI2 N;  2DFF A;  1WSF A;  1C0M A;  3SUQ A;  5FPN A;  3NF6 A;  2E6L A;  2E3G A;  4LF8 K;  3VQP A;  1N36 K;  3THW B;  5EVZ A;  4QS8 A;  2I61 A;  3O9T A;  3LDQ A;  1S1T A;  3ZSV A;  4CFA A;  3AVG A;  2H3G X;  3MWP A;  5EX5 A;  1VQM N;  3K59 A;  2YNH A;  4IG0 A;  1IBK K;  2NRV A;  3KLH A;  2G8I A;  2KKZ A;  3MN7 A;  4BRF A;  3ISN C;  3CC4 N;  4JD2 A;  4CEA A;  1GLJ O;  1KCF A;  2I7P A;  3BZC A;  3P31 A;  1VQ4 N;  3V9X A;  1LCU A;  3K9J A;  3HO1 A;  4FJH A;  1NE5 A;  2VGN A;  5KPR A;  2HW3 A;  1RDA A;  3V1O A;  5BPM A;  4A59 A;  3QO9 A;  3TSP A;  5CYQ A;  3OYL A;  3MXI A;  5KGX A;  3FZH A;  3O4Q A;  3MXJ A;  3SNN A;  2CH5 A;  4CEZ A;  4XJX A;  3CXC M;  5AZJ B;  3WNE A;  4OPA A;  3IRX A;  2DTU A;  1JJ2 M;  3D6R A;  1I94 K;  1YIJ N;  5LJV A;  3O9U A;  3VQ4 A;  1HYZ A;  3AAR A;  4JK7 A;  1VQ5 N;  4IOC L;  3H3O B;  4C8K A;  2KGQ A;  3F73 A;  1KRP A;  2V52 B;  2YCH A;  1N4N A;  4FJG A;  1KVA A;  4Z4H A;  1WN7 A;  3QFP A;  1VNA A;  4BGA A;  1OH8 A;  1T1T A;  1N33 K;  1WNS A;  3W3D A;  2HST A;  3OYD A;  3HOT A;  1SZ2 A;  2XRI A;  1K73 O;  5KQD A;  4H5W A;  1GLB G;  2CGK A;  4JV5 K;  2D4W A;  4CHZ A;  3OS1 A;  4LFB K;  1S9G A;  2OZM A;  2CGL A;  5LY3 A;  1BU6 O;  4RG8 A;  4FLZ A;  4IZ9 A;  2SN3 A;  4JK8 A;  1RT2 A;  3DAW A;  4ELV A;  4EZ9 A;  4K8X A;  3ULD A;  1HKB A;  3WNG A;  1FW6 A;  2VWK A;  3M6G A;  3CJC A;  3OJU A;  1NK8 A;  2RPI A;  1RFQ A;  1Q9X A;  1QZ5 A;  1OH5 A;  4DU3 A;  3OYE A;  4E7L A;  4YOR A;  3ZT2 A;  4AAZ A;  3I55 N;  4BC3 A;  3ENH A;  4HUE A;  4K43 A;  1NGJ A;  3S5T A;  1LQH A;  2RHK A;  3TR8 A;  2D5R A;  2NLX A;  4FWL A;  3KP0 A;  1AYJ A;  4WFB L;  4O0I A;  3O9Q A;  2O8B A;  4WQ4 A;  5BRE A;  4Q5V A;  3FR0 A;  1S1X A;  2KTQ A;  5C2F A;  3TAN A;  4H5N A;  4NYN A;  4C8M A;  3VQ6 A;  4W5T A;  3OTO K;  3SBG A;  4E72 A;  4DV2 K;  2QTD A;  4BG8 A;  3VEV A;  4CGF A;  5AQF A;  4O8K A;  1Q18 A;  3QNN A;  4BQL A;  4WQ5 C;  1W0H A;  4EP5 A;  3V9W A;  4AQY K;  1ATR A;  4X65 K;  1ATS A;  4CJT A;  2P9N B;  2ATB A;  1VRU A;  3ULE A;  2JLE A;  5HL7 L;  4CD3 A;  1JLF A;  1OZZ A;  4PL8 A;  3DLH A;  3KVG A;  1KFD A;  4FOE A;  1MWK A;  1VSL A;  1FKP A;  1RTH A;  4CHN A;  4QCL A;  4WCE L;  5CE3 A;  3AA5 X;  4RCH A;  5AQX A;  4RW4 A;  2VWB A;  4EHU A;  4O5B A;  5JVH L;  4CJK A;  2IAJ A;  3BP8 A;  4CBX A;  3IMX A;  5EU7 A;  1Q7Y O;  2XY6 A;  1VQP N;  3SUP A;  3SQ4 A;  2P9L B;  3VA3 A;  1BA1 A;  1C0F A;  1HPM A;  1HJR A;  3NAE A;  4G1Q A;  4ILG B;  3F2K A;  4A5B A;  2E2N A;  2YHA A;  4CEF A;  3HK2 A;  3AA4 A;  4CW7 B;  1XMO K;  1K6Y A;  5SZT A;  1XRS B;  3T1Y K;  3ID8 A;  4IEE A;  1IV0 A;  1TV6 A;  3CFO A;  1YXQ A;  3O1W A;  1QSS A;  1ITG A;  2NNW A;  3JAM O;  3SQ0 A;  2KW4 A;  3K58 A;  2A3Z A;  4ZTJ A;  1IH7 A;  5KQ8 A;  3SPY A;  4JS5 A;  4B3S K;  1E4F T;  4BWJ A;  1NLV A;  4OLB A;  4BRH A;  5AQY A;  4FWM A;  3K57 A;  1PX9 A;  4AHR A;  4J2B A;  5CZ1 A;  1V4S A;  4H4O A;  4CIE A;  2YJF A;  4BRC A;  1S22 A;  4R79 A;  1R59 O;  3AVL A;  3CM5 A;  1YTU A;  1UA1 A;  4DUY K;  2YHX A;  2Q3S A;  1S1U A;  3C7N A;  1T7E A;  3ZYY X;  3HI0 A;  3HT3 A;  1P8Z A;  1VK0 A;  1SL0 A;  4B1U B;  4KPY A;  4PKG A;  5AQO A;  2F8S A;  4JKG B;  3AVF A;  4PKI A;  5FLX O;  1QHA A;  4M3T A;  1Q81 O;  3L2R A;  3TSU A;  3FZM A;  3AVK A;  5HRS A;  3EE8 A;  3MN5 A;  3CCS N;  1VRT A;  4OPK A;  5KRS A;  2F96 A;  4LF7 K;  1T7A A;  3BDP A;  5KK4 A;  4FM0 A;  4B9T A;  4FPA A;  3U9Z A;  4NCG A;  2P9U A;  3D2F B;  2FBT A;  3IG1 A;  1ASV A;  4F9O A;  3LM9 A;  2IGI A;  2LKB A;  3LP3 A;  3LAL A;  1LAV A;  3KK3 A;  4RW7 A;  2LR3 A;  4JRP A;  2KYQ A;  4NO7 A;  2HHT A;  3V81 A;  3CPW M;  5AQS A;  4J8F A;  1JKH A;  2P9S A;  1NJW A;  2Y1J A;  4DV3 K;  4JD2 B;  1CZ9 A;  2ZWH A;  5AR0 A;  2YKM A;  4FWN A;  3CCL N;  3OS2 A;  2O8F A;  3G0Z A;  4BDZ A;  1RGI A;  1J9A A;  5ADX H;  2W42 A;  5F0X A;  1LQQ A;  2KBK A;  4DSI A;  3L3U A;  2UUA K;  4DSJ A;  3DXM A;  2ZF5 O;  3TAE A;  2QWR A;  1JLC A;  3WUH A;  2AJQ A;  2OA8 A;  1V4T A;  3FFK B;  3THX B;  1CLQ A;  4JS4 A;  3PX6 A;  3VEZ A;  2C1G A;  3VQE A;  4IEI A;  1WOQ A;  1TAU A;  1NRA A;  3NGI A;  4I9Q A;  1WSE A;  3QEV A;  2W6L A;  2X78 A;  1ZBL A;  2WON A;  1IBL K;  1JLB A;  4YOU A;  1YVU A;  1JZB A;  1EWR A;  4N41 A;  1WLJ A;  5BR9 A;  2BTF A;  1WSH A;  2KQ2 A;  3DWL A;  4IDH A;  2KBH A;  3F5T A;  4M3Z A;  1LWE A;  1QSY A;  4CJ5 A;  4I6M B;  4DV0 K;  2WC9 A;  4TSX A;  4W5Q A;  1NK7 A;  4AEI A;  2P9I B;  3AV9 A;  4FLU A;  1NGI A;  3L4Q A;  1L3T A;  2HNY A;  3CFR A;  4IFY A;  3LDP A;  3QBX A;  3ZSR A;  1JCG A;  3J8A A;  3TTF A;  4OO1 J;  1FXX A;  4AHC A;  1L3S A;  2CGJ A;  5J1E A;  4BRD A;  1NJZ A;  3HPO A;  3AO4 A;  4AHT A;  1EET A;  4BR2 A;  1GPS A;  1JLQ A;  3A8Y A;  2W00 A;  2E88 A;  5C15 A;  1RBR A;  5D3G A;  1OKJ A;  1RDW X;  3KWI A;  1OVQ A;  1YAG A;  3V4I A;  4QOZ B;  5CR4 A;  4F3T A;  1IKY A;  3M8Q A;  2MBK A;  1HYV A;  3EE9 A;  4AM7 A;  3MWT A;  3ZT1 A;  3CQ8 A;  5AQG A;  2NRH A;  2KFN A;  3MDQ A;  1N34 K;  1J5E K;  2QW9 A;  2ZM6 K;  3KHY A;  4HE7 A;  4AIL C;  4XH1 A;  1Z25 A;  4NLC A;  2E2F A;  1KVB A;  1VSK A;  5LMN K;  3NVM A;  3LZJ A;  1XC3 A;  3CF5 L;  3C6H A;  4R5P A;  5FPM A;  1Q9Y A;  1JL2 A;  3KWG A;  4CJS A;  3VQ7 A;  3EY1 A;  3PY8 A;  4FW1 A;  4CIF A;  4DWI A;  2FF6 A;  2GEM A;  1K9M O;  1BQM A;  4C8L A;  3SQ1 A;  2HBK A;  4H0O A;  1Y64 A;  4FJM A;  2V7Y A;  1SS6 A;  2QEX N;  3LAK A;  3M8P A;  4NCA A;  1AHO A;  3FZK A;  2P1J A;  3CIP A;  3MEC A;  4KKO A;  4E0D A;  3FGU A;  3QDK A;  3R2V A;  3EZW A;  3KKR A;  4H4M A;  3SUN A;  1L3U A;  4BR4 A;  2WBN A;  2VWJ A;  2QK9 A;  2QA4 N;  2UYT A;  4LSL A;  4B08 A;  3OS0 A;  3E01 A;  3OVN A;  2YBR C;  1FKO A;  1EP4 A;  4IOX A;  1I2U A;  2YHW A;  4I7F A;  3IUC A;  5JVG L;  1N8R O;  4J2A A;  4DTJ A;  1UGL A;  2OYQ A;  4UQG A;  5AQZ A;  2O8F B;  1BO5 O;  1HNI A;  1IG8 A;  1K8B A;  2GEL A;  4B1Z A;  3VEW A;  3BGR A;  5JLF A;  3NF9 A;  4MLH A;  2HHU A;  1B92 A;  5FPE A;  5AQI A;  3MEG A;  2F9W A;  3FE1 A;  1ZBI A;  3OY9 A;  3TPQ A;  3NMU A;  2DY4 A;  5T7B A;  1GLE G;  2YNI A;  2Q2R A;  1XHZ A;  3C95 A;  4H5T A;  2GBZ A;  5KI6 A;  1J53 A;  4PHT X;  5C10 A;  2V51 B;  3WNH A;  4H5R A;  3QET A;  4F8R A;  4CJQ A;  3SUO A;  5IT9 O;  5FDL A;  4A57 A;  3AVA A;  5GAH P;  4FLW A;  4B9V A;  1C6V A;  2UUB K;  2HHH K;  4KHU A;  2E2Q A;  4CEC A;  3OHR A;  3LM2 A;  4FK4 A;  1LWC A;  3HRG A;  1OVY A;  4B9M A;  4X62 K;  3ENB A;  4ISG A;  3AVC A;  4JRQ A;  2P51 A;  4LSN A;  4CGI A;  1W97 L;  3UIQ A;  2O8D A;  3K5N A;  1DQ7 A;  1MR4 A;  3UB5 A;  1ZUT A;  2VQF K;  2G8K A;  1YUW A;  1ZBS A;  4BE2 A;  1CN2 A;  4BGB A;  5EXW A;  1U45 A;  1RTD A;  3NF8 A;  5M1K A;  4U67 L;  4NCB A;  2KSK A;  2KBJ A;  4PA1 A;  3VQC A;  4DUZ K;  2DFE A;  4ILH A;  4FWK A;  2PYL A;  3T1H K;  3PSM A;  3P39 A;  1WWN A;  2HVI A;  1BDG A;  1K8K B;  1WSI A;  4C8N A;  4B3O A;  1FJG K;  1RIL A;  4FJ8 A;  1RDB A;  1QZ6 A;  4E7H A;  2KLA A;  3CME N;  3CQX A;  2F9T A;  4DTR A;  4BRE A;  2IVO A;  1XNR K;  3G4S N;  3VQ9 A;  2E8A A;  1MYN A;  3V9S A;  1LOT B;  1DT9 A;  1JLG A;  4B9N A;  1B9D A;  3D2E B;  1BIU A;  4L8R B;  1L4V A;  4KV8 A;  3QEP A;  3L4I A;  4YFU A;  1VQO N;  1EQY A;  1RTJ A;  1Z6R A;  3NGY A;  4HVJ A;  4DLE A;  2ITG A;  1RBV A;  3CC2 N;  3CMA N;  2FBY A;  1RDU A;  1NGB A;  4JKD A;  3U6F A;  2KHO A;  1U4B A;  3V6D A;  1Z05 A;  1JCE A;  3WXI A;  4CGH A;  2A7T A;  4HCC A;  3V9U A;  3O3F A;  4KHY A;  4IBN A;  5HRR A;  2P9K B;  4B9U A;  4RW9 A;  3NDK A;  4JI8 K;  1DKG D;  4M3R A;  2GL1 A;  4DSL A;  3L6Q A;  1VSF A;  4CJ4 A;  3C6U A;  1P00 A;  2G8H A;  1D5A A;  2JDQ D;  4RW6 A;  3L2V A;  4FO0 A;  1NGA A;  2GV9 A;  5CY4 A;  4CHY A;  4CI6 A;  1BIS A;  4ISF A;  1EWQ A;  1U04 A;  5F2R A;  1HKG A;  4FM2 A;  4JKB A;  4IOA L;  2B6A A;  3C6A A;  3OBY A;  1FK9 A;  4DR2 K;  2UXC K;  4CCH A;  1VHX A;  4PL7 A;  1SV5 A;  1NJI O;  3WXL A;  4O8U A;  5AQM A;  2UU9 K;  1OH7 A;  4DR3 K;  3S9H A;  4LFA K;  4YOT A;  3E7R L;  3M3Z A;  2KZM A;  3CG7 A;  4CGD A;  3T7Z A;  1VSM A;  3RMA A;  4LY7 A;  2O8C A;  3KOW A;  2QM1 A;  4EHT A;  1ZBH A;  4NYF A;  5I3U A;  2HHS A;  1NRB A;  1BHL A;  3AVM A;  3OYN A;  4FZX C;  1BI4 B;  3ZX2 A;  5JMV A;  3QB0 A;  4CEB A;  1RCH A;  1TVR A;  4B9Q A;  5AFU H;  1I2V A;  3D45 A;  3VER A;  4CJ7 A;  1CZB A;  5E26 A;  3GDQ A;  3IS9 A;  3VET A;  1KSP A;  2FSJ A;  3A0I X;  3O08 A;  2NY9 X;  1C0T A;  4CE9 A;  3SJJ A;  1NGD A;  3TAM A;  2PY5 A;  1XWL A;  2HBM A;  2G8F A;  4A5A A;  1Q8I A;  2FLO A;  4FLY A;  2A5X A;  1RT5 A;  2MZ0 A;  4YNQ A;  4DB3 A;  2IC3 A;  3DXK A;  4E3S A;  2IDO A;  1NMD A;  3K0S A;  1VQ7 N;  4CZI A;  3O1B A;  3KLG A;  1BMR A;  4HUF A;  5FRM A;  1LW0 A;  2D0A A;  4KHN A;  2UXB K;  1CXQ A;  2V7Z A;  2HMP A;  3VN5 A;  2YEO A;  3S3N A;  4KHQ A;  4CHQ A;  2PAV A;  4DTX A;  3TU5 A;  4FJN A;  1HQE A;  1C1C A;  1QHT A;  3OYB A;  2N2Q A;  3P1G A;  2AP1 A;  3RMC A;  3OJS A;  5FRN A;  1WMT A;  3L0Q A;  1NK5 A;  5M1Q A;  3ATV A;  4DTU A;  2QWM A;  2OZS A;  1ZC6 A;  4BE7 B;  3HL8 A;  3ZT4 A;  1HQU A;  1QQC A;  3R3L A;  1A5X A;  2PZS A;  1GPT A;  3VQ5 A;  3QLH A;  2QWP A;  4BRM A;  2I5J A;  4HUG A;  5I42 A;  1D4X A;  3R9P A;  1TYQ A;  4E7I A;  3SMS A;  2QI2 A;  4QS7 A;  5E41 A;  4E1M A;  3RMB A;  4CVN E;  4BAC A;  3KJV A;  1XI1 A;  5HLF A;  3SJH A;  3O80 A;  1YHQ N;  4FCY A;  4CJW A;  1T8E A;  5M1O A;  4XEI A;  2KFZ A;  5AQP A;  2KZZ A;  3MN9 A;  4FK2 A;  3KLF A;  3KOY A;  4DR4 K;  1KQS M;  3ENO A;  4DFK A;  4M3Y A;  5GIN A;  3CHW A;  3FFI A;  4BR9 A;  2WTU A;  1BUP A;  3N4P A;  1VNB A;  3AVI A;  1WAF A;  3OYC A;  3MEE A;  4MFB A;  4F2S A;  5ADX A;  4WF9 L;  2YKN A;  4CJF A;  4H0V B;  5C42 A;  4DQR A;  2F8T A;  4KI4 A;  1HR0 K;  4AHS A;  1MA9 B;  4LH4 A;  4JI3 K;  2FXU A;  3RSE B;  4ZTF A;  5M1P A;  2P9P A;  1TKZ A;  3U8X A;  2A1R A;  4H03 B;  3GBT A;  4IO8 A;  1BCO A;  2EHG A;  4ID1 A;  3OYG A;  4MDB A;  2HND A;  1ASU A;  3KOZ A;  1BG3 A;  4CBW A;  4LF4 K;  4DS5 A;  5M1N A;  3KLE A;  3I8B A;  1E3M A;  1VSD A;  3SAH A;  1CZA N;  1KVC A;  5AQL A;  1G15 A;  3I0R A;  4AM6 A;  4E89 A;  1WBD A;  1LQI A;  3C0B A;  2B3C A;  3H1Q A;  1C1A A;  3CC7 N;  2XHB A;  1GOA A;  1HJO A;  4NLB A;  4B8C A;  3TAG A;  3VGM A;  3SZ2 A;  1WBB A;  2D56 A;  3SCX A;  3RRG A;  4CZF A;  3MX2 A;  4DSK A;  2E2P A;  4CEQ A;  1U48 A;  3LAN A;  4JEP A;  3WXJ A;  2P9N A;  3DLB A;  3P4I A;  1S6Q A;  1KLN A;  3EYZ A;  2VQE K;  3RR7 A;  2BAN A;  4K25 A;  4O55 A;  4OKJ A;  3D7E O;  1N5Y A;  1NGE A;  2IVN A;  1ZYQ A;  1FH3 A;  3J7A P;  3U3Y A;  5JIC A;  4KH5 A;  4EIA A;  1IKV A;  4MLE A;  5J2M A;  4YOX A;  4FJJ A;  2LJM A;  5A2Q O;  2EWS A;  4DTM A;  3H6E A;  4ISE A;  1S3X A;  2OTJ N;  1SN4 A;  3TAQ A;  4WQ4 C;  3ZT0 A;  3HM8 A;  5K14 A;  3ASM A;  4C23 A;  3R1X A;  3VF2 A;  4BR7 A;  4M7Y A;  3CPE A;  1S9E A;  4PY5 A;  1QQN A;  2ASC A;  1O13 A;  1X3N A;  1WSJ A;  4OKK A;  3DLK A;  4LF9 K;  4FJ5 A;  1GOC A;  4M41 A;  3VEO A;  3KZB A;  1RBT A;  1BIZ A;  1IKX A;  2ASO A;  3PSF A;  4EAH D;  1NK9 A;  3E9P A;  4CD1 A;  2J4R A;  3A5M C;  4CED A;  3O3G A;  2ZE2 A;  3T19 A;  1DJT A;  4YHH K;  5AQH A;  3NE6 A;  1ZU3 A;  4E7J A;  1C55 A;  4Z0U A;  4B9L A;  3KD1 E;  2W6K A;  1NKE A;  3TWH A;  2JWK A;  3AO3 A;  4CZH A;  1T6C A;  4K8Z A;  2E1Y A;  2QXF A;  4Y1C A;  3PX4 A;  3I33 A;  3LDO A;  4L3Q A;  4YY3 K;  4DV5 K;  2YV0 X;  3VGL A;  2E5L K;  2C1I A;  3SK3 A;  1YIT N;  4FZY A;  5GIP A;  3U9D A;  1TK8 A;  1T6D A;  4JKG A;  4CER A; 
#chains in the Genus database with same CATH homology
 1KAZ A;  3TSP A;  1VAZ A;  3CW4 A;  5GAH P;  1NGC A;  3FZH A;  2E2Q A;  5LJW A;  5KPT A;  3OHR A;  3LM2 A;  3T69 A;  2HOE A;  4FL9 A;  3HRG A;  1OVY A;  2CH5 A;  4XJX A;  4BRO A;  3CXC M;  3ENB A;  4ISG A;  5AZJ B;  4FWQ A;  4OPA A;  4FWO A;  4A2A A;  3DLL L;  1JJ2 M;  3D6R A;  4BY9 C;  1W97 L;  1YIJ N;  5LJV A;  3O9U A;  4PKH A;  3S41 A;  3VEY A;  3UB5 A;  2P9P B;  3AAR A;  4JK7 A;  1VQ5 N;  2IVP A;  4IOC L;  5AQQ A;  5F1X A;  1YUW A;  3H3O B;  4ILJ A;  1ZBS A;  4WYB A;  4BGB A;  5EXW A;  2NRX A;  2V52 B;  2YCH A;  1VQ9 N;  3AAP A;  3IFR A;  3BF1 A;  5M1K A;  3QFP A;  3CCM N;  4U67 L;  4BGA A;  1GLF O;  3ZEU A;  4CZG A;  1C0G A;  3O8M A;  3W3D A;  2HST A;  5AZI A;  3HOT A;  1SZ2 A;  4ILH A;  3ZET B;  4CZL A;  1K73 O;  4FWK A;  5KQD A;  4H5W A;  1GLB G;  2CGK A;  1GLA G;  3WQT A;  3P39 A;  2D4W A;  1QQO A;  3UKR B;  3H1V X;  3UKR A;  5M1F A;  3NVK A;  4A61 A;  5ELZ A;  4QS9 A;  3JS6 A;  2CGL A;  5LY3 A;  1BU6 O;  1BDG A;  1K8K B;  5AQR A;  3DJC A;  2P9K A;  4IZ9 A;  1QZ6 A;  2ZGY A;  4JK8 A;  2KLA A;  3DAW A;  4JNE A;  3ULE B;  4YOW A;  3CQX A;  3CME N;  3O9S A;  1HKB A;  1P90 A;  2F9T A;  4BRE A;  1VQ8 N;  3CET A;  3M6G A;  2IVO A;  2Q97 A;  3AGK A;  3CJC A;  5GIO A;  2HBJ A;  2PBD A;  3G4S N;  2E8A A;  4FWR A;  1Q86 O;  1RFQ A;  1HUX A;  4IO9 L;  1QZ5 A;  1LOT B;  1JCF A;  1DT9 A;  1VQL N;  3D2E B;  4YOV A;  2D0P A;  4YOR A;  1HX1 A;  3VF4 A;  3I55 N;  4BC3 A;  3ENH A;  3L4I A;  4K43 A;  3VGK A;  1NGJ A;  1VQO N;  1EQY A;  3CJ1 A;  1Z6R A;  5AQJ A;  1BOT O;  4JN4 A;  2RHK A;  4RTF D;  4BRQ A;  3GG4 A;  3CC2 N;  4I6M A;  2NLX A;  4JHD A;  4FWL A;  3UKU A;  3CMA N;  1RDU A;  4WFB L;  1NGB A;  3O9Q A;  4JKD A;  2KHO A;  2I7N A;  1Z05 A;  2IIR A;  1JCE A;  1NM1 A;  3WXI A;  4WQ4 A;  4JKF A;  3SF4 D;  5BRE A;  5TKW A;  3FR0 A;  4BEB A;  4DKW A;  3Q7B A;  5C2F A;  2P9K B;  1X3M A;  4H5N A;  1XQS C;  3ZX0 A;  1DKG D;  1DGK N;  4BRP A;  1YVN A;  4CBU A;  1ATN A;  3SBG A;  3L6Q A;  5E84 A;  3M5R A;  3O4W A;  4JKA A;  2QTD A;  1KXP A;  3ZEU B;  3EKS A;  3VEV A;  4OPH A;  2JDQ D;  5AQF A;  4BG8 A;  3PLA A;  2QWO A;  4KBO A;  4O8K A;  5AQT A;  5CHI A;  1Q18 A;  1NGA A;  4FO0 A;  3OA9 A;  3AY9 A;  1GLL O;  3WEE A;  4BQL A;  2BUP A;  4CI6 A;  4WQ5 C;  3SMP A;  4ISF A;  5F2R A;  2E2O A;  1ZXO A;  1HKG A;  3R6M A;  4JKB A;  1BA0 A;  1ATR A;  3SAG A;  3JXU A;  3N4Q A;  4IOA L;  1BWF O;  3C6A A;  3VEX A;  1ATS A;  3OBY A;  3CCV N;  2P9N B;  2Q1N A;  5EY4 A;  3CQY A;  1GLD G;  4CZM A;  1EO1 A;  4PL7 A;  1ILY A;  3ULE A;  5DM6 L;  1NJI O;  1TYQ B;  5HL7 L;  3WXL A;  1SAZ A;  3QIC A;  4O8U A;  5AQM A;  4CD3 A;  5AQV A;  4PL8 A;  3KC6 A;  1NBW A;  3B8A X;  3KVG A;  4BVP A;  5JLH A;  3CER A;  4FOE A;  2F7T A;  3AGR A;  3M3Z A;  4YOT A;  2ITM A;  1MWK A;  5GAD P;  3J7Z O;  1U2V B;  4WCE L;  5CE3 A;  3T7Z A;  2VCP A;  4Z94 A;  4RCH A;  3PIP L;  3BEX A;  5AQX A;  2DPN A;  2QM1 A;  4GY2 B;  4EHT A;  2VWB A;  2FSN A;  4EHU A;  5AFU A;  5JVH L;  3VF6 A;  4WFN L;  3SLC A;  1MDU B;  3BP8 A;  2QWL A;  2Q0R A;  3IMX A;  4H0P A;  3UKU B;  3ZX2 A;  4CBX A;  3QB0 A;  5JMV A;  1Q7Y O;  1KD1 O;  1MWM A;  3H46 O;  3G25 A;  3W0L A;  1VQP N;  2A40 A;  3E9L A;  4G9Z A;  2P9L B;  3ID6 A;  1BA1 A;  5AFU H;  4B9Q A;  1C0F A;  1HPM A;  3VER A;  4CJ7 A;  1M1K O;  3IKM A;  5E26 A;  3SBT A;  3GDQ A;  1K8A O;  4ILG B;  4RWT A;  3VET A;  2FSJ A;  3F2K A;  3TTC A;  4A5B A;  2E2N A;  4FWP A;  4GVE A;  3A0I X;  5AQK A;  3O08 A;  1TUU A;  2YI1 A;  2NRZ A;  4BRK A;  1NGD A;  3CCQ N;  3C7N B;  2HBM A;  3EKU A;  3ID8 A;  4IEE A;  4A5A A;  4Y0W A;  4AF1 A;  1YXQ A;  4UAF E;  2FLO A;  3O1W A;  2A5X A;  2NNW A;  3MMV A;  4DB3 A;  3DXK B;  5B8H A;  3DXK A;  2A3Z A;  1WUA A;  5KQ8 A;  2GTD A;  3VPZ A;  1NMD A;  4LC9 B;  1VQ7 N;  5AQU A;  4CZI A;  3A5N C;  3O1B A;  3H3N O;  3H45 C;  4BEC A;  3EN9 A;  4KH4 A;  3TTD A;  3WQU A;  1VQK N;  4UAE F;  1E4F T;  2CH6 A;  5AZI B;  1NLV A;  3MN6 A;  2V7Z A;  2HMP A;  4BRH A;  5BRH A;  5AQY A;  3A5L C;  4FWM A;  4U7B A;  1E4G T;  1YJW N;  2QWN A;  2PAV A;  3F9M A;  3TU5 A;  1V4S A;  4FWS A;  1NGF A;  2YJF A;  4BRC A;  5H1S Q;  4H5V A;  1S22 A;  4R79 A;  4GV9 A;  1R59 O;  3HBT A;  5C0Y A;  3E9O A;  1GLC G;  2AP1 A;  3WXK A;  2MN5 A;  2YHX A;  4B1Y B;  1T3V A;  3VOV A;  3R8E A;  2K35 A;  4HTL A;  5I9E B;  3L0Q A;  5EOY A;  4IXC A;  5M1Q A;  3ATV A;  3C7N A;  2QWM A;  3AAQ A;  1ZC6 A;  4BE7 B;  1G99 A;  2A42 A;  3ZYY X;  3HI0 A;  3GE1 A;  1P8Z A;  3R3L A;  5FPD A;  2ASP A;  4B1U B;  4PKG A;  5AQO A;  3LDL A;  4JKG B;  3G71 N;  4PKI A;  3CCR N;  2W40 A;  5AQW A;  1QHA A;  3FZF A;  2WFB A;  1Q81 O;  3TSU A;  3FZM A;  2QWP A;  3E1Y A;  1KAX A;  3EE8 A;  2GMO A;  4BRM A;  5C2D A;  2Q0U A;  2NRR A;  2ZJQ L;  3MN5 A;  4EFH A;  3PIO L;  4XH5 A;  4BQZ A;  3CCS N;  1D4X A;  5TKY A;  3TSQ A;  3P38 A;  3R9P A;  5BPL A;  1TYQ A;  1S72 N;  3SMS A;  4YOY A;  2QI2 A;  3I56 N;  3MK6 A;  2W41 A;  4FPA A;  4QS7 A;  3GOI A;  3U9Z A;  3VMF B;  3VEN A;  3FZL A;  3WT0 A;  1NGH A;  2P9U B;  2P9U A;  3D2F B;  1SQK A;  4DCH A;  2OAN A;  4JK9 A;  2QXL A;  3SJH A;  3CD6 N;  3O80 A;  1YHQ N;  4F9O A;  4DHY A;  5DM7 L;  1U2V A;  3LM9 A;  4B1X B;  1HLU A;  1TUY A;  5M1O A;  4C1N I;  2GX9 A;  2RE2 A;  4NO7 A;  4BRN A;  3CPW M;  5AQS A;  1VQN N;  4J8F A;  2P9S A;  4XEI A;  2D0O A;  5AQP A;  2FF3 B;  2Q31 A;  2GWK A;  3MN9 A;  4JD2 B;  2ZWH A;  5AR0 A;  4FWN A;  3CCL N;  2ASM A;  2YX6 A;  4JKH A;  4A62 A;  4BG9 A;  3MCP A;  4BRA A;  1RGI A;  3QFU A;  2AA4 A;  3ENO A;  5ADX H;  1KQS M;  2P9I A;  4JKC A;  3CJ7 A;  3CJA A;  3CHW A;  4BR9 A;  4YDU A;  4CZK A;  5KPZ A;  5F0X A;  5GIN A;  3FLC O;  4K41 A;  5HOO A;  1BUP A;  5AQN A;  3N4P A;  3O9R A;  4IJN A;  2PFU A;  3DXM A;  1U6Z A;  2ZF5 O;  4FOI A;  4IWV A;  2NZT A;  2QWR A;  3WUH A;  5ADX A;  2BH1 A;  2YIL A;  4WF9 L;  3U4L A;  4H0V B;  1V4T A;  3FFK B;  4H0X B;  4WQ5 A;  4CZJ A;  2C1G A;  3ATU A;  2NRT A;  1MA9 B;  3VEZ A;  5BN8 A;  1KAY A;  4IEI A;  3RSE A;  2FXU A;  3RSE B;  2HF4 A;  4BRI A;  1WOQ A;  4C1N K;  4CZE A;  5M1P A;  4IJA A;  1Q82 O;  2P9P A;  3QBW A;  2NRW A;  2JWL A;  1POI A;  3L56 A;  1T44 A;  4YOU A;  2Q36 A;  4M7X A;  3M1F A;  3U8X A;  3ZX3 A;  2VYP A;  2P9S B;  4H03 B;  3GBT A;  5BR9 A;  3O5B A;  2BTF A;  3DWL A;  4IDH A;  4IO8 A;  3CI5 A;  4BR5 A;  3F5T A;  4KH6 A;  4WFA L;  4BC5 A;  1M90 O;  2LN8 A;  4I6M B;  4JHD B;  4MDB A;  1H1V A;  2ZJP L;  2WC9 A;  4GV3 A;  3A5O C;  1BG3 A;  2P9I B;  5AZJ A;  1YJ9 N;  3QML A;  3CJ9 A;  4CBW A;  1NGI A;  3L4Q A;  3CCU N;  4O5F A;  4UAD E;  5M1N A;  3I8B A;  3LDP A;  3O6W A;  3QBX A;  4FPB A;  5BRD A;  4UY8 O;  3SAH A;  1JCG A;  1CZA N;  3J8A A;  3TTF A;  3BK3 C;  3BF3 A;  4OO1 J;  3MX5 A;  5AQL A;  3SAF A;  4AM6 A;  2CGJ A;  3C0B A;  2YJE A;  3H1Q A;  4BRD A;  3CC7 N;  1YJN N;  4YDU C;  4BRG A;  1HJO A;  3C65 A;  3EL2 A;  4NLB A;  1DEJ A;  4JKE A;  2VY6 A;  4H0T B;  3VGM A;  3MCA B;  4BR2 A;  2D56 A;  2WUS A;  3VTI A;  3Q7C A;  4CZF A;  3A8Y A;  2W00 A;  2E88 A;  3MX2 A;  4M63 C;  5C15 A;  3IDH A;  1OKJ A;  1RDW X;  4BRL A;  3KWI A;  2E2P A;  1YAG A;  1W2B M;  4JAX A;  4JEP A;  3WXJ A;  1QVF M;  2P9N A;  5CR4 A;  3P4I A;  2MBK A;  2OTL N;  3EE9 A;  4AM7 A;  3MWT A;  4MDA A;  4GNI A;  5C12 A;  2YIO A;  5AQG A;  4K25 A;  4IFE A;  2NRH A;  3D7E O;  1NGE A;  2D1K A;  2IVN A;  3OBW A;  3E66 A;  5JIC A;  3MDQ A;  4KH5 A;  4A2B A;  2QW9 A;  3D2F A;  3LDN A;  4B1V A;  4EIA A;  3KHY A;  4MLE A;  4FVU A;  2YIP A;  4YOX A;  3KHW A;  4XH1 A;  2HF3 A;  1XUP O;  4H0Y B;  4NLC A;  2E2F A;  4BR0 A;  4A59 A;  5BRF A;  2A6A A;  2EWS A;  3EO3 A;  3NVM A;  2ZJR L;  3H6E A;  3HTV A;  1XC3 A;  4ISE A;  1S3X A;  2OTJ N;  3CF5 L;  2E1Z A;  2A41 A;  3C6H A;  4NB4 A;  2QWQ A;  4WQ4 C;  3HM8 A;  5FPM A;  1YF5 L;  3GL1 A;  3WXM B;  3KK7 A;  4BC4 A;  3KWG A;  1NWK A;  3ZET A;  4C23 A;  3WEE B;  5GAG P;  1X9J A;  3R1X A;  3VF2 A;  4GV6 A;  1VQ6 N;  4BR7 A;  4M7Y A;  2P9L A;  2FF6 A;  2GEM A;  3CPE A;  1QQN A;  1K8K A;  4DQ8 A;  3CJB A;  1K9M O;  3DXM B;  3RVC A;  2GUP A;  4K42 A;  1O13 A;  3G6E N;  1NGG A;  1X3N A;  2HBK A;  4H0O A;  1Y64 A;  5MLC Q;  5BPN A;  1HKC A;  2GWJ A;  2V7Y A;  1SS6 A;  2QEX N;  3VEO A;  4HWI A;  3KZB A;  4BC2 A;  4BVO A;  3UE5 A;  5BN9 A;  3FZK A;  3CIP A;  4XH4 A;  2ASO A;  3FGU A;  3QDK A;  3K9K A;  3D2E A;  3R2V A;  2E20 A;  3EZW A;  3HZ6 A;  3LL3 A;  2HBL A;  3E9P A;  4CD1 A;  2J4R A;  4EAH D;  3A5M C;  4MO5 A;  4BR4 A;  1KC8 O;  2WBN A;  1YI2 N;  2QA4 N;  1QQM A;  2UYT A;  3VTH A;  5AQH A;  5FPN A;  4IOX A;  1J6Z A;  2ZGZ A;  3VES A;  2YHW A;  3IUC A;  5JVG L;  1N8R O;  5AQZ A;  1BO5 O;  4MO4 A;  1IG8 A;  1IJJ A;  2JWK A;  5EVZ A;  4QS8 A;  5GAE P;  4CZH A;  2GEL A;  1T6C A;  3VEW A;  4B1Z A;  3O9T A;  3LDQ A;  3BUZ B;  4E1J A;  4MLH A;  5JLF A;  4FSV A;  2E1Y A;  5FPE A;  2H3G X;  3MWP A;  3OW2 M;  5AQI A;  5EX5 A;  2F9W A;  1VQM N;  3FE1 A;  3I33 A;  3LDO A;  4L3Q A;  3TPQ A;  3NMU A;  3CCJ N;  2NRV A;  2FSK A;  4B1W B;  1GLE G;  2KKZ A;  3MN7 A;  4BRF A;  2Q2R A;  2YHY A;  3CC4 N;  2VGM A;  4H5T A;  3VGL A;  4JD2 A;  3QI7 A;  2C1I A;  3HOS A;  3SK3 A;  1GLJ O;  1YIT N;  2I7P A;  3P31 A;  3HSC A;  4PHT X;  1VQ4 N;  5C10 A;  1LCU A;  3K9J A;  2V51 B;  5GIP A;  4H5R A;  2VGN A;  3U9D A;  5KPR A;  1T6D A;  3CCE N;  1QVG M;  4JKG A;  5BPM A;  4A57 A;  1ESV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...