1BMRA

Alpha-like toxin lqh iii from scorpion leiurus quinquestriatus hebraeus, nmr, 25 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIVEGEKCHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LQH III ALPHA-LIKE TOXIN
publication title NMR structures and activity of a novel alpha-like toxin from the scorpion Leiurus quinquestriatus hebraeus.
pubmed doi rcsb
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1998-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1bmrA00
1GPSA 1OMYA 4AAZA 1T0ZA 2ASCA 4CQKA 2LY5A 1C55A 1L4VA 2MZ0A 1JXCA 2YBRC 1JZAA 4AB0A 1BMRA 2KBKA 1T7AA 1GPTA 2GL1A 1SNBA 2LR3A 3PSMA 3E7RL 2KJAA 2KPYA 1ZUTA 4AEIA 1WT7A 1NH5A 1ZYVA 1DQ7A 1FH3A 2LJ7A 1PE4A 1BCGA 2YEOA 4HE7A 4KYPA 1SN4A 1LQIA 1SEGA 1ZFUA 1LQHA 2E3GA 2B68A 2YC1C 3E7UX 2LKBA 1ZVGA 1TI5A 2ATBA 2N2QA 1WMTA 2LY6A 1DJTA 4HHFA 1B3CA 1WWNA 2KSKA 2E3FA 2KGQA 1P00A 1SN1A 2LT8A 1NPIA 2N66A 1KV0A 5CY0A 1MYNA 2I61A 1CN2A 1ZYWA 1B7DA 1LQQA 1BRZA 1PX9A 1NRBA 1T1TA 1PTXA 2N69A 2NY8X 2KBHA 1T7BA 1VNAA 1AYJA 1ZU3A 1JZBA 2KYQA 1I6GA 1C56A 4V1DC 1NRAA 1N4NA 2B3CA 1MR4A 1I2UA 2SN3A 2BRZA 1AHOA 1ICAA 2E0HA 1ZVEA 2N2RA 1CHZA 1OZZA 2A7TA 2LI7A 1VNBA 2NY9X 1I2VA 1P0AA 1I6FA 4UJ0A 1NE5A 2M8BB 1BK8A 1JKZA 2LJMA 1T7EA 2KBJA 5KK4A
chains in the Genus database with same CATH superfamily
4H5VA 1GPSA 1OMYA 4AAZA 1NGJA 1T0ZA 2ASCA 3QI7A 4CQKA 2LY5A 1C55A 1HJOA 1L4VA 2MZ0A 3QMLA 5F2RA 1JXCA 2YBRC 1ATRA 1JZAA 2KHOA 3D2EB 5EXWA 5AQOA 4AB0A 1BMRA 2KBKA 1T7AA 2VY6A 5AQTA 3GL1A 1NGBA 2BUPA 2QXLA 2QWLA 3C7NA 5AQHA 2GL1A 1GPTA 3KOWA 5FPEA 5AQYA 1SNBA 3FE1A 2LR3A 3PSMA 5AQUA 5AQWA 3I33A 3E7RL 3LDPA 2YIOA 2KJAA 2V7ZA 2KPYA 1K8BA 1ZUTA 4AEIA 3KOYA 1WT7A 1NH5A 3KC6A 1BA0A 1UGLA 1ZYVA 3KP1A 5AQLA 1DQ7A 1FH3A 2LJ7A 3D2FA 1PE4A 1BCGA 2YEOA 3LDOA 3LDQA 4GNIA 4HE7A 4KYPA 1NGEA 1SN4A 1LQIA 1SEGA 1ZFUA 1DKGD 1LQHA 5AQPA 5BPLA 5BPNA 3KVGA 2E3GA 1NGAA 1YUWA 2B68A 2YC1C 3FZFA 2D56A 3E7UX 4UADE 5AQIA 1KAZA 2LKBA 3CQXA 3L6QA 1ZVGA 1TI5A 2ATBA 1HPMA 3ATUA 3HSCA 2N2QA 1WMTA 4KBOA 2QWOA 5AQGA 2LY6A 4HWIA 1DJTA 3R2VA 4HHFA 1B3CA 3FZKA 1WWNA 5FPMA 2KSKA 2QWPA 2E3FA 3LDNA 1KAXA 2KGQA 4H5TA 3CW4A 1P00A 1SN1A 2LT8A 2MBKA 1NPIA 2N66A 1QQNA 1KV0A 3L4IA 3QFPA 3FZMA 5AR0A 5CY0A 4UAEF 1MYNA 2I61A 5FPNA 1CN2A 3GDQA 5AQSA 3C7NB 2JDQD 2G2KA 1ZYWA 1B7DA 1LQQA 2QW9A 3KOZA 1BRZA 1QQMA 3LDLA 4H5RA 1NGDA 1NGCA 1HX1A 1PX9A 1NRBA 1T1TA 1PTXA 2N69A 2NY8X 3A8YA 4FL9A 1NGHA 3D2EA 2KBHA 1T7BA 1VNAA 2QWMA 5AQKA 5EVZA 1POIA 1AYJA 1ZU3A 1JZBA 2E88A 3GKUA 2KYQA 3QFUA 1I6GA 1C56A 4V1DC 3D2FB 1NRAA 1QQOA 2QWQA 3L56A 5AQXA 1XRSB 5EY4A 1N4NA 1BA1A 2B3CA 1MR4A 3KOXA 4IO8A 2SN3A 1NGGA 1NGFA 2K35A 3JXUA 4H5WA 5AQRA 1I2UA 4H5NA 2BRZA 5AQJA 1AHOA 4FSVA 5AQFA 1ICAA 3ATVA 2E0HA 4UAFE 1NGIA 1ZVEA 5F0XA 3BK3C 3KHWA 2N2RA 1CHZA 1OZZA 5AQMA 2A7TA 2LI7A 3AY9A 2QWRA 1VNBA 5BN9A 2LN8A 2YILA 5BN8A 2YIPA 2NY9X 3FZLA 1I2VA 1BUPA 3IUCA 5AQZA 5F1XA 2QWNA 5EX5A 3SF4D 1ATSA 1KAYA 2MN5A 1P0AA 1I6FA 2E2FA 1S3XA 4UJ0A 1NE5A 2M8BB 2GMOA 5AQQA 3FZHA 5FPDA 3KP0A 5AQVA 1BK8A 1JKZA 5BPMA 3M3ZA 2E8AA 2LJMA 1T7EA 2KBJA 5KK4A 5AQNA
chains in the Genus database with same CATH topology
1GPSA 1OMYA 4AAZA 1T0ZA 2ASCA 4CQKA 2LY5A 1C55A 1L4VA 2MZ0A 1JXCA 2YBRC 1JZAA 4AB0A 1BMRA 2KBKA 1T7AA 1GPTA 2GL1A 1SNBA 2LR3A 3PSMA 3E7RL 2KJAA 2KPYA 1ZUTA 4AEIA 1WT7A 1NH5A 1ZYVA 1DQ7A 1FH3A 2LJ7A 1PE4A 1BCGA 2YEOA 4HE7A 4KYPA 1SN4A 1LQIA 1SEGA 1ZFUA 1LQHA 2E3GA 2B68A 2YC1C 3E7UX 2LKBA 1ZVGA 1TI5A 2ATBA 2N2QA 1WMTA 2LY6A 1DJTA 4HHFA 1B3CA 1WWNA 2KSKA 2E3FA 2KGQA 1P00A 1SN1A 2LT8A 1NPIA 2N66A 1KV0A 5CY0A 1MYNA 2I61A 1CN2A 1ZYWA 1B7DA 1LQQA 1BRZA 1PX9A 1NRBA 1T1TA 1PTXA 2N69A 2NY8X 2KBHA 1T7BA 1VNAA 1AYJA 1ZU3A 1JZBA 2KYQA 1I6GA 1C56A 4V1DC 1NRAA 1N4NA 2B3CA 1MR4A 1I2UA 2SN3A 2BRZA 1AHOA 1ICAA 2E0HA 1ZVEA 2N2RA 1CHZA 1OZZA 2A7TA 2LI7A 1VNBA 2NY9X 1I2VA 1P0AA 1I6FA 4UJ0A 1NE5A 2M8BB 1BK8A 1JKZA 2LJMA 1T7EA 2KBJA 5KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPS A;  1OMY A;  4AAZ A;  1T0Z A;  2ASC A;  4CQK A;  2LY5 A;  1C55 A;  1L4V A;  2MZ0 A;  1JXC A;  2YBR C;  1JZA A;  4AB0 A;  1BMR A;  2KBK A;  1T7A A;  1GPT A;  2GL1 A;  1SNB A;  2LR3 A;  3PSM A;  3E7R L;  2KJA A;  2KPY A;  1ZUT A;  4AEI A;  1WT7 A;  1NH5 A;  1ZYV A;  1DQ7 A;  1FH3 A;  2LJ7 A;  1PE4 A;  1BCG A;  2YEO A;  4HE7 A;  4KYP A;  1SN4 A;  1LQI A;  1SEG A;  1ZFU A;  1LQH A;  2E3G A;  2B68 A;  2YC1 C;  3E7U X;  2LKB A;  1ZVG A;  1TI5 A;  2ATB A;  2N2Q A;  1WMT A;  2LY6 A;  1DJT A;  4HHF A;  1B3C A;  1WWN A;  2KSK A;  2E3F A;  2KGQ A;  1P00 A;  1SN1 A;  2LT8 A;  1NPI A;  2N66 A;  1KV0 A;  5CY0 A;  1MYN A;  2I61 A;  1CN2 A;  1ZYW A;  1B7D A;  1LQQ A;  1BRZ A;  1PX9 A;  1NRB A;  1T1T A;  1PTX A;  2N69 A;  2NY8 X;  2KBH A;  1T7B A;  1VNA A;  1AYJ A;  1ZU3 A;  1JZB A;  2KYQ A;  1I6G A;  1C56 A;  4V1D C;  1NRA A;  1N4N A;  2B3C A;  1MR4 A;  1I2U A;  2SN3 A;  2BRZ A;  1AHO A;  1ICA A;  2E0H A;  1ZVE A;  2N2R A;  1CHZ A;  1OZZ A;  2A7T A;  2LI7 A;  1VNB A;  2NY9 X;  1I2V A;  1P0A A;  1I6F A;  4UJ0 A;  1NE5 A;  2M8B B;  1BK8 A;  1JKZ A;  2LJM A;  1T7E A;  2KBJ A;  5KK4 A; 
#chains in the Genus database with same CATH topology
 4H5V A;  1GPS A;  1OMY A;  4AAZ A;  1NGJ A;  1T0Z A;  2ASC A;  3QI7 A;  4CQK A;  2LY5 A;  1C55 A;  1HJO A;  1L4V A;  2MZ0 A;  3QML A;  5F2R A;  1JXC A;  2YBR C;  1ATR A;  1JZA A;  2KHO A;  3D2E B;  5EXW A;  5AQO A;  4AB0 A;  1BMR A;  2KBK A;  1T7A A;  2VY6 A;  5AQT A;  3GL1 A;  1NGB A;  2BUP A;  2QXL A;  2QWL A;  3C7N A;  5AQH A;  2GL1 A;  1GPT A;  3KOW A;  5FPE A;  5AQY A;  1SNB A;  3FE1 A;  2LR3 A;  3PSM A;  5AQU A;  5AQW A;  3I33 A;  3E7R L;  3LDP A;  2YIO A;  2KJA A;  2V7Z A;  2KPY A;  1K8B A;  1ZUT A;  4AEI A;  3KOY A;  1WT7 A;  1NH5 A;  3KC6 A;  1BA0 A;  1UGL A;  1ZYV A;  3KP1 A;  5AQL A;  1DQ7 A;  1FH3 A;  2LJ7 A;  3D2F A;  1PE4 A;  1BCG A;  2YEO A;  3LDO A;  3LDQ A;  4GNI A;  4HE7 A;  4KYP A;  1NGE A;  1SN4 A;  1LQI A;  1SEG A;  1ZFU A;  1DKG D;  1LQH A;  5AQP A;  5BPL A;  5BPN A;  3KVG A;  2E3G A;  1NGA A;  1YUW A;  2B68 A;  2YC1 C;  3FZF A;  2D56 A;  3E7U X;  4UAD E;  5AQI A;  1KAZ A;  2LKB A;  3CQX A;  3L6Q A;  1ZVG A;  1TI5 A;  2ATB A;  1HPM A;  3ATU A;  3HSC A;  2N2Q A;  1WMT A;  4KBO A;  2QWO A;  5AQG A;  2LY6 A;  4HWI A;  1DJT A;  3R2V A;  4HHF A;  1B3C A;  3FZK A;  1WWN A;  5FPM A;  2KSK A;  2QWP A;  2E3F A;  3LDN A;  1KAX A;  2KGQ A;  4H5T A;  3CW4 A;  1P00 A;  1SN1 A;  2LT8 A;  2MBK A;  1NPI A;  2N66 A;  1QQN A;  1KV0 A;  3L4I A;  3QFP A;  3FZM A;  5AR0 A;  5CY0 A;  4UAE F;  1MYN A;  2I61 A;  5FPN A;  1CN2 A;  3GDQ A;  5AQS A;  3C7N B;  2JDQ D;  2G2K A;  1ZYW A;  1B7D A;  1LQQ A;  2QW9 A;  3KOZ A;  1BRZ A;  1QQM A;  3LDL A;  4H5R A;  1NGD A;  1NGC A;  1HX1 A;  1PX9 A;  1NRB A;  1T1T A;  1PTX A;  2N69 A;  2NY8 X;  3A8Y A;  4FL9 A;  1NGH A;  3D2E A;  2KBH A;  1T7B A;  1VNA A;  2QWM A;  5AQK A;  5EVZ A;  1POI A;  1AYJ A;  1ZU3 A;  1JZB A;  2E88 A;  3GKU A;  2KYQ A;  3QFU A;  1I6G A;  1C56 A;  4V1D C;  3D2F B;  1NRA A;  1QQO A;  2QWQ A;  3L56 A;  5AQX A;  1XRS B;  5EY4 A;  1N4N A;  1BA1 A;  2B3C A;  1MR4 A;  3KOX A;  4IO8 A;  2SN3 A;  1NGG A;  1NGF A;  2K35 A;  3JXU A;  4H5W A;  5AQR A;  1I2U A;  4H5N A;  2BRZ A;  5AQJ A;  1AHO A;  4FSV A;  5AQF A;  1ICA A;  3ATV A;  2E0H A;  4UAF E;  1NGI A;  1ZVE A;  5F0X A;  3BK3 C;  3KHW A;  2N2R A;  1CHZ A;  1OZZ A;  5AQM A;  2A7T A;  2LI7 A;  3AY9 A;  2QWR A;  1VNB A;  5BN9 A;  2LN8 A;  2YIL A;  5BN8 A;  2YIP A;  2NY9 X;  3FZL A;  1I2V A;  1BUP A;  3IUC A;  5AQZ A;  5F1X A;  2QWN A;  5EX5 A;  3SF4 D;  1ATS A;  1KAY A;  2MN5 A;  1P0A A;  1I6F A;  2E2F A;  1S3X A;  4UJ0 A;  1NE5 A;  2M8B B;  2GMO A;  5AQQ A;  3FZH A;  5FPD A;  3KP0 A;  5AQV A;  1BK8 A;  1JKZ A;  5BPM A;  3M3Z A;  2E8A A;  2LJM A;  1T7E A;  2KBJ A;  5KK4 A;  5AQN A; 
#chains in the Genus database with same CATH homology
 1GPS A;  1OMY A;  4AAZ A;  1T0Z A;  2ASC A;  4CQK A;  2LY5 A;  1C55 A;  1L4V A;  2MZ0 A;  1JXC A;  2YBR C;  1JZA A;  4AB0 A;  1BMR A;  2KBK A;  1T7A A;  1GPT A;  2GL1 A;  1SNB A;  2LR3 A;  3PSM A;  3E7R L;  2KJA A;  2KPY A;  1ZUT A;  4AEI A;  1WT7 A;  1NH5 A;  1ZYV A;  1DQ7 A;  1FH3 A;  2LJ7 A;  1PE4 A;  1BCG A;  2YEO A;  4HE7 A;  4KYP A;  1SN4 A;  1LQI A;  1SEG A;  1ZFU A;  1LQH A;  2E3G A;  2B68 A;  2YC1 C;  3E7U X;  2LKB A;  1ZVG A;  1TI5 A;  2ATB A;  2N2Q A;  1WMT A;  2LY6 A;  1DJT A;  4HHF A;  1B3C A;  1WWN A;  2KSK A;  2E3F A;  2KGQ A;  1P00 A;  1SN1 A;  2LT8 A;  1NPI A;  2N66 A;  1KV0 A;  5CY0 A;  1MYN A;  2I61 A;  1CN2 A;  1ZYW A;  1B7D A;  1LQQ A;  1BRZ A;  1PX9 A;  1NRB A;  1T1T A;  1PTX A;  2N69 A;  2NY8 X;  2KBH A;  1T7B A;  1VNA A;  1AYJ A;  1ZU3 A;  1JZB A;  2KYQ A;  1I6G A;  1C56 A;  4V1D C;  1NRA A;  1N4N A;  2B3C A;  1MR4 A;  1I2U A;  2SN3 A;  2BRZ A;  1AHO A;  1ICA A;  2E0H A;  1ZVE A;  2N2R A;  1CHZ A;  1OZZ A;  2A7T A;  2LI7 A;  1VNB A;  2NY9 X;  1I2V A;  1P0A A;  1I6F A;  4UJ0 A;  1NE5 A;  2M8B B;  1BK8 A;  1JKZ A;  2LJM A;  1T7E A;  2KBJ A;  5KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...