1PE4A

Solution structure of toxin cn12 from centruroides noxius alfa scorpion toxin acting on sodium channels. nmr structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
67
structure length
67
Chain Sequence
RDGYPLASNGCKFGCSGLGENNPTCNHVCEKKAGSDYGYCYAWTCYCEHVAEGTVLWGDSGTGPCRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin Cn11
publication title NMR solution structure of Cn12, a novel peptide from the Mexican scorpion Centruroides noxius with a typical beta-toxin sequence but with alpha-like physiological activity.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1pe4A00
1T7AA 5KK4A 1MYNA 2MZ0A 1ZYWA 1NH5A 2B3CA 1AYJA 1SNBA 2KBKA 1PE4A 4HE7A 1MR4A 1P0AA 1LQQA 2YC1C 2KPYA 2LR3A 1OMYA 2E3FA 2NY8X 2YBRC 5CY0A 4CQKA 4AAZA 1BMRA 1T7BA 2LI7A 2I61A 1PTXA 1SN1A 3E7RL 1LQHA 1NPIA 1ZVEA 2KJAA 2N66A 2M8BB 1WT7A 1LQIA 3E7UX 1SN4A 4KYPA 2GL1A 2KYQA 1ZYVA 1B7DA 1ZFUA 2A7TA 2N69A 1ICAA 1PX9A 1GPSA 1NRBA 2SN3A 1TI5A 2N2QA 1FH3A 1BCGA 1T1TA 2LY5A 2NY9X 1JKZA 1B3CA 4UJ0A 4AB0A 1DQ7A 1GPTA 1JZBA 2KBJA 1I6FA 4V1DC 1WWNA 3PSMA 1I2UA 2E3GA 2ASCA 1I6GA 1I2VA 1SEGA 2E0HA 2ATBA 1WMTA 1JZAA 4AEIA 2BRZA 1BRZA 1NRAA 2KBHA 2B68A 1OZZA 2N2RA 1L4VA 1C55A 1ZU3A 2LY6A 1P00A 1T0ZA 1C56A 1T7EA 2YEOA 2LT8A 1VNBA 1DJTA 1BK8A 1N4NA 4HHFA 2KGQA 2LJ7A 1CN2A 1CHZA 1ZUTA 2LKBA 2KSKA 1KV0A 1NE5A 1JXCA 1AHOA 1ZVGA 2LJMA 1VNAA
chains in the Genus database with same CATH superfamily
2D56A 1T7AA 5KK4A 1MYNA 2MZ0A 1ZYWA 1NH5A 2B3CA 4HWIA 2QWRA 5AR0A 1SNBA 2KBKA 3ATUA 5AQWA 1KAXA 1PE4A 3GKUA 5AQZA 1NGAA 1BUPA 5AQKA 3KHWA 5AQJA 3R2VA 4HE7A 5FPNA 5F1XA 1MR4A 1P0AA 1LQQA 1BA0A 5FPDA 4KBOA 1NGJA 2YC1C 2KPYA 1NGIA 2LR3A 5AQRA 3LDLA 4UAFE 1OMYA 2E3FA 2NY8X 2YBRC 3LDQA 3FZMA 3M3ZA 5EX5A 4CQKA 5CY0A 4AAZA 1NGHA 5F0XA 3D2EB 3L4IA 1BMRA 2QWOA 3FZLA 2QXLA 1T7BA 5AQSA 1KAYA 1HPMA 5EXWA 2V7ZA 1DKGD 1CN2A 4UADE 3CQXA 2LI7A 1XRSB 3D2EA 1AYJA 1PTXA 2I61A 1SN1A 2YIOA 3E7RL 5EY4A 1LQHA 5AQQA 1KAZA 3KOWA 3LDPA 5AQGA 1NPIA 1ZVEA 2KJAA 5AQYA 2QWLA 1UGLA 3KVGA 1NGGA 2N66A 3AY9A 1NGFA 1NGBA 1QQMA 3KOXA 3FZKA 2M8BB 3SF4D 1NGEA 5AQOA 3KP1A 1WT7A 1LQIA 3E7UX 3KOZA 3D2FB 1SN4A 1HJOA 2GL1A 3FZFA 2KYQA 4KYPA 1ZYVA 1B7DA 1ZFUA 2A7TA 1HX1A 5AQNA 1K8BA 2BUPA 2N69A 2QWMA 3D2FA 2LN8A 1ICAA 4H5TA 1PX9A 3FE1A 5AQVA 5AQHA 1S3XA 1GPSA 1NRBA 2SN3A 5BN9A 1TI5A 5AQMA 5AQUA 2E88A 2N2QA 3LDOA 5AQFA 1POIA 3KC6A 1FH3A 1BCGA 3KP0A 1T1TA 2LY5A 2NY9X 1JKZA 1B3CA 1YUWA 4UJ0A 1ATSA 5AQTA 4AB0A 3JXUA 1DQ7A 5AQPA 3CW4A 3GL1A 3I33A 4H5RA 1GPTA 1JZBA 2KBJA 1I6FA 3LDNA 3QFUA 4H5NA 2MN5A 2E2FA 4V1DC 1WWNA 3PSMA 1BA1A 5FPEA 1I2UA 2E3GA 4IO8A 3GDQA 3L6QA 1ATRA 2ASCA 2QW9A 5AQLA 1SEGA 1I2VA 1I6GA 2E0HA 3C7NB 2K35A 2ATBA 1WMTA 1JZAA 4AEIA 2BRZA 3HSCA 2E8AA 1BRZA 1NRAA 2KBHA 2B68A 4H5WA 1OZZA 3A8YA 2N2RA 2G2KA 3C7NA 3IUCA 2MBKA 1L4VA 2VY6A 1C55A 5BPNA 2YIPA 4FL9A 4H5VA 1ZU3A 2LY6A 3L56A 1P00A 3KOYA 1QQOA 1C56A 1T0ZA 1T7EA 2JDQD 2YEOA 3BK3C 2LT8A 3FZHA 4UAEF 1VNBA 1DJTA 1NGCA 5AQIA 1BK8A 5BPLA 1N4NA 5AQXA 5EVZA 1NGDA 4HHFA 3ATVA 2QWNA 2KGQA 2LJ7A 5F2RA 5BPMA 2GMOA 2YILA 2QWPA 1CHZA 1QQNA 1ZUTA 2KSKA 1KV0A 2LKBA 2KHOA 3QFPA 4GNIA 5BN8A 3QI7A 2QWQA 1NE5A 1JXCA 5FPMA 1AHOA 1ZVGA 2LJMA 3QMLA 4FSVA 1VNAA
chains in the Genus database with same CATH topology
1T7AA 5KK4A 1MYNA 2MZ0A 1ZYWA 1NH5A 2B3CA 1AYJA 1SNBA 2KBKA 1PE4A 4HE7A 1MR4A 1P0AA 1LQQA 2YC1C 2KPYA 2LR3A 1OMYA 2E3FA 2NY8X 2YBRC 5CY0A 4CQKA 4AAZA 1BMRA 1T7BA 2LI7A 2I61A 1PTXA 1SN1A 3E7RL 1LQHA 1NPIA 1ZVEA 2KJAA 2N66A 2M8BB 1WT7A 1LQIA 3E7UX 1SN4A 4KYPA 2GL1A 2KYQA 1ZYVA 1B7DA 1ZFUA 2A7TA 2N69A 1ICAA 1PX9A 1GPSA 1NRBA 2SN3A 1TI5A 2N2QA 1FH3A 1BCGA 1T1TA 2LY5A 2NY9X 1JKZA 1B3CA 4UJ0A 4AB0A 1DQ7A 1GPTA 1JZBA 2KBJA 1I6FA 4V1DC 1WWNA 3PSMA 1I2UA 2E3GA 2ASCA 1I6GA 1I2VA 1SEGA 2E0HA 2ATBA 1WMTA 1JZAA 4AEIA 2BRZA 1BRZA 1NRAA 2KBHA 2B68A 1OZZA 2N2RA 1L4VA 1C55A 1ZU3A 2LY6A 1P00A 1T0ZA 1C56A 1T7EA 2YEOA 2LT8A 1VNBA 1DJTA 1BK8A 1N4NA 4HHFA 2KGQA 2LJ7A 1CN2A 1CHZA 1ZUTA 2LKBA 2KSKA 1KV0A 1NE5A 1JXCA 1AHOA 1ZVGA 2LJMA 1VNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7A A;  5KK4 A;  1MYN A;  2MZ0 A;  1ZYW A;  1NH5 A;  2B3C A;  1AYJ A;  1SNB A;  2KBK A;  1PE4 A;  4HE7 A;  1MR4 A;  1P0A A;  1LQQ A;  2YC1 C;  2KPY A;  2LR3 A;  1OMY A;  2E3F A;  2NY8 X;  2YBR C;  5CY0 A;  4CQK A;  4AAZ A;  1BMR A;  1T7B A;  2LI7 A;  2I61 A;  1PTX A;  1SN1 A;  3E7R L;  1LQH A;  1NPI A;  1ZVE A;  2KJA A;  2N66 A;  2M8B B;  1WT7 A;  1LQI A;  3E7U X;  1SN4 A;  4KYP A;  2GL1 A;  2KYQ A;  1ZYV A;  1B7D A;  1ZFU A;  2A7T A;  2N69 A;  1ICA A;  1PX9 A;  1GPS A;  1NRB A;  2SN3 A;  1TI5 A;  2N2Q A;  1FH3 A;  1BCG A;  1T1T A;  2LY5 A;  2NY9 X;  1JKZ A;  1B3C A;  4UJ0 A;  4AB0 A;  1DQ7 A;  1GPT A;  1JZB A;  2KBJ A;  1I6F A;  4V1D C;  1WWN A;  3PSM A;  1I2U A;  2E3G A;  2ASC A;  1I6G A;  1I2V A;  1SEG A;  2E0H A;  2ATB A;  1WMT A;  1JZA A;  4AEI A;  2BRZ A;  1BRZ A;  1NRA A;  2KBH A;  2B68 A;  1OZZ A;  2N2R A;  1L4V A;  1C55 A;  1ZU3 A;  2LY6 A;  1P00 A;  1T0Z A;  1C56 A;  1T7E A;  2YEO A;  2LT8 A;  1VNB A;  1DJT A;  1BK8 A;  1N4N A;  4HHF A;  2KGQ A;  2LJ7 A;  1CN2 A;  1CHZ A;  1ZUT A;  2LKB A;  2KSK A;  1KV0 A;  1NE5 A;  1JXC A;  1AHO A;  1ZVG A;  2LJM A;  1VNA A; 
#chains in the Genus database with same CATH topology
 2D56 A;  1T7A A;  5KK4 A;  1MYN A;  2MZ0 A;  1ZYW A;  1NH5 A;  2B3C A;  4HWI A;  2QWR A;  5AR0 A;  1SNB A;  2KBK A;  3ATU A;  5AQW A;  1KAX A;  1PE4 A;  3GKU A;  5AQZ A;  1NGA A;  1BUP A;  5AQK A;  3KHW A;  5AQJ A;  3R2V A;  4HE7 A;  5FPN A;  5F1X A;  1MR4 A;  1P0A A;  1LQQ A;  1BA0 A;  5FPD A;  4KBO A;  1NGJ A;  2YC1 C;  2KPY A;  1NGI A;  2LR3 A;  5AQR A;  3LDL A;  4UAF E;  1OMY A;  2E3F A;  2NY8 X;  2YBR C;  3LDQ A;  3FZM A;  3M3Z A;  5EX5 A;  4CQK A;  5CY0 A;  4AAZ A;  1NGH A;  5F0X A;  3D2E B;  3L4I A;  1BMR A;  2QWO A;  3FZL A;  2QXL A;  1T7B A;  5AQS A;  1KAY A;  1HPM A;  5EXW A;  2V7Z A;  1DKG D;  1CN2 A;  4UAD E;  3CQX A;  2LI7 A;  1XRS B;  3D2E A;  1AYJ A;  1PTX A;  2I61 A;  1SN1 A;  2YIO A;  3E7R L;  5EY4 A;  1LQH A;  5AQQ A;  1KAZ A;  3KOW A;  3LDP A;  5AQG A;  1NPI A;  1ZVE A;  2KJA A;  5AQY A;  2QWL A;  1UGL A;  3KVG A;  1NGG A;  2N66 A;  3AY9 A;  1NGF A;  1NGB A;  1QQM A;  3KOX A;  3FZK A;  2M8B B;  3SF4 D;  1NGE A;  5AQO A;  3KP1 A;  1WT7 A;  1LQI A;  3E7U X;  3KOZ A;  3D2F B;  1SN4 A;  1HJO A;  2GL1 A;  3FZF A;  2KYQ A;  4KYP A;  1ZYV A;  1B7D A;  1ZFU A;  2A7T A;  1HX1 A;  5AQN A;  1K8B A;  2BUP A;  2N69 A;  2QWM A;  3D2F A;  2LN8 A;  1ICA A;  4H5T A;  1PX9 A;  3FE1 A;  5AQV A;  5AQH A;  1S3X A;  1GPS A;  1NRB A;  2SN3 A;  5BN9 A;  1TI5 A;  5AQM A;  5AQU A;  2E88 A;  2N2Q A;  3LDO A;  5AQF A;  1POI A;  3KC6 A;  1FH3 A;  1BCG A;  3KP0 A;  1T1T A;  2LY5 A;  2NY9 X;  1JKZ A;  1B3C A;  1YUW A;  4UJ0 A;  1ATS A;  5AQT A;  4AB0 A;  3JXU A;  1DQ7 A;  5AQP A;  3CW4 A;  3GL1 A;  3I33 A;  4H5R A;  1GPT A;  1JZB A;  2KBJ A;  1I6F A;  3LDN A;  3QFU A;  4H5N A;  2MN5 A;  2E2F A;  4V1D C;  1WWN A;  3PSM A;  1BA1 A;  5FPE A;  1I2U A;  2E3G A;  4IO8 A;  3GDQ A;  3L6Q A;  1ATR A;  2ASC A;  2QW9 A;  5AQL A;  1SEG A;  1I2V A;  1I6G A;  2E0H A;  3C7N B;  2K35 A;  2ATB A;  1WMT A;  1JZA A;  4AEI A;  2BRZ A;  3HSC A;  2E8A A;  1BRZ A;  1NRA A;  2KBH A;  2B68 A;  4H5W A;  1OZZ A;  3A8Y A;  2N2R A;  2G2K A;  3C7N A;  3IUC A;  2MBK A;  1L4V A;  2VY6 A;  1C55 A;  5BPN A;  2YIP A;  4FL9 A;  4H5V A;  1ZU3 A;  2LY6 A;  3L56 A;  1P00 A;  3KOY A;  1QQO A;  1C56 A;  1T0Z A;  1T7E A;  2JDQ D;  2YEO A;  3BK3 C;  2LT8 A;  3FZH A;  4UAE F;  1VNB A;  1DJT A;  1NGC A;  5AQI A;  1BK8 A;  5BPL A;  1N4N A;  5AQX A;  5EVZ A;  1NGD A;  4HHF A;  3ATV A;  2QWN A;  2KGQ A;  2LJ7 A;  5F2R A;  5BPM A;  2GMO A;  2YIL A;  2QWP A;  1CHZ A;  1QQN A;  1ZUT A;  2KSK A;  1KV0 A;  2LKB A;  2KHO A;  3QFP A;  4GNI A;  5BN8 A;  3QI7 A;  2QWQ A;  1NE5 A;  1JXC A;  5FPM A;  1AHO A;  1ZVG A;  2LJM A;  3QML A;  4FSV A;  1VNA A; 
#chains in the Genus database with same CATH homology
 1T7A A;  5KK4 A;  1MYN A;  2MZ0 A;  1ZYW A;  1NH5 A;  2B3C A;  1AYJ A;  1SNB A;  2KBK A;  1PE4 A;  4HE7 A;  1MR4 A;  1P0A A;  1LQQ A;  2YC1 C;  2KPY A;  2LR3 A;  1OMY A;  2E3F A;  2NY8 X;  2YBR C;  5CY0 A;  4CQK A;  4AAZ A;  1BMR A;  1T7B A;  2LI7 A;  2I61 A;  1PTX A;  1SN1 A;  3E7R L;  1LQH A;  1NPI A;  1ZVE A;  2KJA A;  2N66 A;  2M8B B;  1WT7 A;  1LQI A;  3E7U X;  1SN4 A;  4KYP A;  2GL1 A;  2KYQ A;  1ZYV A;  1B7D A;  1ZFU A;  2A7T A;  2N69 A;  1ICA A;  1PX9 A;  1GPS A;  1NRB A;  2SN3 A;  1TI5 A;  2N2Q A;  1FH3 A;  1BCG A;  1T1T A;  2LY5 A;  2NY9 X;  1JKZ A;  1B3C A;  4UJ0 A;  4AB0 A;  1DQ7 A;  1GPT A;  1JZB A;  2KBJ A;  1I6F A;  4V1D C;  1WWN A;  3PSM A;  1I2U A;  2E3G A;  2ASC A;  1I6G A;  1I2V A;  1SEG A;  2E0H A;  2ATB A;  1WMT A;  1JZA A;  4AEI A;  2BRZ A;  1BRZ A;  1NRA A;  2KBH A;  2B68 A;  1OZZ A;  2N2R A;  1L4V A;  1C55 A;  1ZU3 A;  2LY6 A;  1P00 A;  1T0Z A;  1C56 A;  1T7E A;  2YEO A;  2LT8 A;  1VNB A;  1DJT A;  1BK8 A;  1N4N A;  4HHF A;  2KGQ A;  2LJ7 A;  1CN2 A;  1CHZ A;  1ZUT A;  2LKB A;  2KSK A;  1KV0 A;  1NE5 A;  1JXC A;  1AHO A;  1ZVG A;  2LJM A;  1VNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...