1C55A

Nmr solution structure of butantoxin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
40
structure length
40
Chain Sequence
WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUTANTOXIN
publication title NMR solution structure of butantoxin.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1c55A00
1I6FA 2LY5A 1BK8A 1VNAA 2N2RA 1NE5A 1SEGA 1KV0A 2LR3A 1GPSA 1ICAA 1LQHA 1SNBA 2B68A 2YC1C 1NH5A 1NRBA 1WT7A 2LI7A 2N2QA 2YBRC 2KBKA 1B3CA 1T1TA 2KBJA 1AHOA 2I61A 1CN2A 1C56A 2E3FA 1JZBA 2N69A 2SN3A 2LJ7A 4CQKA 2LKBA 4HHFA 5CY0A 1SN1A 1JZAA 3E7UX 2M8BB 1FH3A 1B7DA 2E3GA 2LJMA 2KYQA 1MYNA 1TI5A 1I6GA 2KGQA 2KBHA 4AB0A 4V1DC 1P0AA 2KPYA 4AEIA 4UJ0A 5KK4A 2GL1A 4HE7A 1ZFUA 1ZUTA 1I2VA 1OMYA 1JXCA 1T7AA 1ZVGA 1ZU3A 2LY6A 1N4NA 1AYJA 1VNBA 1WMTA 2KSKA 1T7BA 2ASCA 2E0HA 1MR4A 2ATBA 2NY8X 2LT8A 1C55A 1NPIA 2NY9X 1WWNA 3PSMA 4AAZA 1NRAA 4KYPA 1T0ZA 1L4VA 1ZYWA 1BMRA 1PE4A 1OZZA 2BRZA 1PTXA 1ZYVA 1BRZA 2A7TA 1I2UA 3E7RL 1LQQA 1SN4A 1T7EA 1DJTA 1DQ7A 2YEOA 1P00A 2N66A 1CHZA 1PX9A 2B3CA 2KJAA 2MZ0A 1BCGA 1ZVEA 1GPTA 1JKZA 1LQIA
chains in the Genus database with same CATH superfamily
1I6FA 3ATUA 5AQFA 2LY5A 1NGJA 5AQKA 2QWNA 1KAYA 1BK8A 5AQYA 4H5WA 5FPNA 1VNAA 2N2RA 5F1XA 1NE5A 1SEGA 1KV0A 2JDQD 2LR3A 3KC6A 1GPSA 1ICAA 1S3XA 4FSVA 1LQHA 2E88A 1ATRA 1SNBA 3LDOA 5BPNA 2B68A 2YC1C 1NH5A 1NRBA 3FZKA 1WT7A 2LI7A 5AQRA 2N2QA 2YBRC 3R2VA 5AQOA 1POIA 5AQGA 2KBKA 3KP0A 1B3CA 1NGFA 1QQMA 1T1TA 2KBJA 1NGHA 1AHOA 2I61A 2YILA 1CN2A 1C56A 1HX1A 1KAZA 5AQWA 1NGDA 3QFUA 1NGGA 2E3FA 5BN8A 1UGLA 5EY4A 5F0XA 2D56A 1JZBA 2N69A 2QXLA 2SN3A 1NGAA 1QQNA 2LJ7A 3CW4A 2LKBA 4FL9A 3QI7A 4HHFA 4CQKA 5CY0A 3LDNA 4H5VA 1SN1A 1JZAA 3FZFA 2YIPA 3D2FB 3GKUA 3SF4D 3E7UX 2M8BB 3D2FA 1K8BA 1FH3A 3CQXA 3LDQA 2G2KA 2V7ZA 1B7DA 2E3GA 3FZMA 2KHOA 3KOXA 2LJMA 2KYQA 5AQXA 2QWOA 5AQJA 1MYNA 1TI5A 5AQHA 3FE1A 1I6GA 5FPMA 1QQOA 2KGQA 2KBHA 5F2RA 4AB0A 4V1DC 1P0AA 1HPMA 3D2EB 2KPYA 1BUPA 2QWQA 3D2EA 2QWPA 4AEIA 3QMLA 5AR0A 4UJ0A 2MN5A 5KK4A 1NGIA 3KOWA 3GL1A 3LDPA 2GL1A 4HE7A 1ZFUA 5AQPA 1ZUTA 1I2VA 1NGEA 1OMYA 3GDQA 4H5TA 3AY9A 3BK3C 3JXUA 1JXCA 1T7AA 1ZVGA 1ZU3A 2LY6A 4UAEF 1N4NA 5BPMA 1VNBA 4UADE 1AYJA 2MBKA 3QFPA 5AQVA 1WMTA 2KSKA 1T7BA 2VY6A 5AQQA 3KOYA 2ASCA 2E0HA 2E2FA 1MR4A 2QWMA 3FZHA 3ATVA 1BA1A 2ATBA 3I33A 3KP1A 3L4IA 5AQUA 2NY8X 2LT8A 5FPEA 4HWIA 1C55A 1NPIA 2NY9X 4IO8A 3L56A 1BA0A 1WWNA 5AQZA 3PSMA 4AAZA 5FPDA 2QWLA 1NRAA 3LDLA 4KYPA 1T0ZA 1L4VA 2QW9A 5AQTA 5AQLA 3FZLA 3C7NB 1ZYWA 2E8AA 3C7NA 1NGBA 1BMRA 1PE4A 1OZZA 2BRZA 1PTXA 1XRSB 5EVZA 1ZYVA 5BN9A 3KOZA 1BRZA 2A7TA 2QWRA 1DKGD 3E7RL 3HSCA 1LQQA 3KVGA 5BPLA 1I2UA 2GMOA 1SN4A 1T7EA 1NGCA 3A8YA 1DJTA 3L6QA 1DQ7A 2K35A 2LN8A 2YEOA 3M3ZA 1P00A 5AQIA 2N66A 5AQMA 1ATSA 3KHWA 1CHZA 1PX9A 2B3CA 2KJAA 2YIOA 2MZ0A 3IUCA 4H5RA 5AQNA 1BCGA 1YUWA 4UAFE 1KAXA 1ZVEA 2BUPA 5AQSA 4GNIA 5EXWA 1GPTA 1HJOA 5EX5A 4H5NA 1JKZA 4KBOA 1LQIA
chains in the Genus database with same CATH topology
1I6FA 2LY5A 1BK8A 1VNAA 2N2RA 1NE5A 1SEGA 1KV0A 2LR3A 1GPSA 1ICAA 1LQHA 1SNBA 2B68A 2YC1C 1NH5A 1NRBA 1WT7A 2LI7A 2N2QA 2YBRC 2KBKA 1B3CA 1T1TA 2KBJA 1AHOA 2I61A 1CN2A 1C56A 2E3FA 1JZBA 2N69A 2SN3A 2LJ7A 4CQKA 2LKBA 4HHFA 5CY0A 1SN1A 1JZAA 3E7UX 2M8BB 1FH3A 1B7DA 2E3GA 2LJMA 2KYQA 1MYNA 1TI5A 1I6GA 2KGQA 2KBHA 4AB0A 4V1DC 1P0AA 2KPYA 4AEIA 4UJ0A 5KK4A 2GL1A 4HE7A 1ZFUA 1ZUTA 1I2VA 1OMYA 1JXCA 1T7AA 1ZVGA 1ZU3A 2LY6A 1N4NA 1AYJA 1VNBA 1WMTA 2KSKA 1T7BA 2ASCA 2E0HA 1MR4A 2ATBA 2NY8X 2LT8A 1C55A 1NPIA 2NY9X 1WWNA 3PSMA 4AAZA 1NRAA 4KYPA 1T0ZA 1L4VA 1ZYWA 1BMRA 1PE4A 1OZZA 2BRZA 1PTXA 1ZYVA 1BRZA 2A7TA 1I2UA 3E7RL 1LQQA 1SN4A 1T7EA 1DJTA 1DQ7A 2YEOA 1P00A 2N66A 1CHZA 1PX9A 2B3CA 2KJAA 2MZ0A 1BCGA 1ZVEA 1GPTA 1JKZA 1LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6F A;  2LY5 A;  1BK8 A;  1VNA A;  2N2R A;  1NE5 A;  1SEG A;  1KV0 A;  2LR3 A;  1GPS A;  1ICA A;  1LQH A;  1SNB A;  2B68 A;  2YC1 C;  1NH5 A;  1NRB A;  1WT7 A;  2LI7 A;  2N2Q A;  2YBR C;  2KBK A;  1B3C A;  1T1T A;  2KBJ A;  1AHO A;  2I61 A;  1CN2 A;  1C56 A;  2E3F A;  1JZB A;  2N69 A;  2SN3 A;  2LJ7 A;  4CQK A;  2LKB A;  4HHF A;  5CY0 A;  1SN1 A;  1JZA A;  3E7U X;  2M8B B;  1FH3 A;  1B7D A;  2E3G A;  2LJM A;  2KYQ A;  1MYN A;  1TI5 A;  1I6G A;  2KGQ A;  2KBH A;  4AB0 A;  4V1D C;  1P0A A;  2KPY A;  4AEI A;  4UJ0 A;  5KK4 A;  2GL1 A;  4HE7 A;  1ZFU A;  1ZUT A;  1I2V A;  1OMY A;  1JXC A;  1T7A A;  1ZVG A;  1ZU3 A;  2LY6 A;  1N4N A;  1AYJ A;  1VNB A;  1WMT A;  2KSK A;  1T7B A;  2ASC A;  2E0H A;  1MR4 A;  2ATB A;  2NY8 X;  2LT8 A;  1C55 A;  1NPI A;  2NY9 X;  1WWN A;  3PSM A;  4AAZ A;  1NRA A;  4KYP A;  1T0Z A;  1L4V A;  1ZYW A;  1BMR A;  1PE4 A;  1OZZ A;  2BRZ A;  1PTX A;  1ZYV A;  1BRZ A;  2A7T A;  1I2U A;  3E7R L;  1LQQ A;  1SN4 A;  1T7E A;  1DJT A;  1DQ7 A;  2YEO A;  1P00 A;  2N66 A;  1CHZ A;  1PX9 A;  2B3C A;  2KJA A;  2MZ0 A;  1BCG A;  1ZVE A;  1GPT A;  1JKZ A;  1LQI A; 
#chains in the Genus database with same CATH topology
 1I6F A;  3ATU A;  5AQF A;  2LY5 A;  1NGJ A;  5AQK A;  2QWN A;  1KAY A;  1BK8 A;  5AQY A;  4H5W A;  5FPN A;  1VNA A;  2N2R A;  5F1X A;  1NE5 A;  1SEG A;  1KV0 A;  2JDQ D;  2LR3 A;  3KC6 A;  1GPS A;  1ICA A;  1S3X A;  4FSV A;  1LQH A;  2E88 A;  1ATR A;  1SNB A;  3LDO A;  5BPN A;  2B68 A;  2YC1 C;  1NH5 A;  1NRB A;  3FZK A;  1WT7 A;  2LI7 A;  5AQR A;  2N2Q A;  2YBR C;  3R2V A;  5AQO A;  1POI A;  5AQG A;  2KBK A;  3KP0 A;  1B3C A;  1NGF A;  1QQM A;  1T1T A;  2KBJ A;  1NGH A;  1AHO A;  2I61 A;  2YIL A;  1CN2 A;  1C56 A;  1HX1 A;  1KAZ A;  5AQW A;  1NGD A;  3QFU A;  1NGG A;  2E3F A;  5BN8 A;  1UGL A;  5EY4 A;  5F0X A;  2D56 A;  1JZB A;  2N69 A;  2QXL A;  2SN3 A;  1NGA A;  1QQN A;  2LJ7 A;  3CW4 A;  2LKB A;  4FL9 A;  3QI7 A;  4HHF A;  4CQK A;  5CY0 A;  3LDN A;  4H5V A;  1SN1 A;  1JZA A;  3FZF A;  2YIP A;  3D2F B;  3GKU A;  3SF4 D;  3E7U X;  2M8B B;  3D2F A;  1K8B A;  1FH3 A;  3CQX A;  3LDQ A;  2G2K A;  2V7Z A;  1B7D A;  2E3G A;  3FZM A;  2KHO A;  3KOX A;  2LJM A;  2KYQ A;  5AQX A;  2QWO A;  5AQJ A;  1MYN A;  1TI5 A;  5AQH A;  3FE1 A;  1I6G A;  5FPM A;  1QQO A;  2KGQ A;  2KBH A;  5F2R A;  4AB0 A;  4V1D C;  1P0A A;  1HPM A;  3D2E B;  2KPY A;  1BUP A;  2QWQ A;  3D2E A;  2QWP A;  4AEI A;  3QML A;  5AR0 A;  4UJ0 A;  2MN5 A;  5KK4 A;  1NGI A;  3KOW A;  3GL1 A;  3LDP A;  2GL1 A;  4HE7 A;  1ZFU A;  5AQP A;  1ZUT A;  1I2V A;  1NGE A;  1OMY A;  3GDQ A;  4H5T A;  3AY9 A;  3BK3 C;  3JXU A;  1JXC A;  1T7A A;  1ZVG A;  1ZU3 A;  2LY6 A;  4UAE F;  1N4N A;  5BPM A;  1VNB A;  4UAD E;  1AYJ A;  2MBK A;  3QFP A;  5AQV A;  1WMT A;  2KSK A;  1T7B A;  2VY6 A;  5AQQ A;  3KOY A;  2ASC A;  2E0H A;  2E2F A;  1MR4 A;  2QWM A;  3FZH A;  3ATV A;  1BA1 A;  2ATB A;  3I33 A;  3KP1 A;  3L4I A;  5AQU A;  2NY8 X;  2LT8 A;  5FPE A;  4HWI A;  1C55 A;  1NPI A;  2NY9 X;  4IO8 A;  3L56 A;  1BA0 A;  1WWN A;  5AQZ A;  3PSM A;  4AAZ A;  5FPD A;  2QWL A;  1NRA A;  3LDL A;  4KYP A;  1T0Z A;  1L4V A;  2QW9 A;  5AQT A;  5AQL A;  3FZL A;  3C7N B;  1ZYW A;  2E8A A;  3C7N A;  1NGB A;  1BMR A;  1PE4 A;  1OZZ A;  2BRZ A;  1PTX A;  1XRS B;  5EVZ A;  1ZYV A;  5BN9 A;  3KOZ A;  1BRZ A;  2A7T A;  2QWR A;  1DKG D;  3E7R L;  3HSC A;  1LQQ A;  3KVG A;  5BPL A;  1I2U A;  2GMO A;  1SN4 A;  1T7E A;  1NGC A;  3A8Y A;  1DJT A;  3L6Q A;  1DQ7 A;  2K35 A;  2LN8 A;  2YEO A;  3M3Z A;  1P00 A;  5AQI A;  2N66 A;  5AQM A;  1ATS A;  3KHW A;  1CHZ A;  1PX9 A;  2B3C A;  2KJA A;  2YIO A;  2MZ0 A;  3IUC A;  4H5R A;  5AQN A;  1BCG A;  1YUW A;  4UAF E;  1KAX A;  1ZVE A;  2BUP A;  5AQS A;  4GNI A;  5EXW A;  1GPT A;  1HJO A;  5EX5 A;  4H5N A;  1JKZ A;  4KBO A;  1LQI A; 
#chains in the Genus database with same CATH homology
 1I6F A;  2LY5 A;  1BK8 A;  1VNA A;  2N2R A;  1NE5 A;  1SEG A;  1KV0 A;  2LR3 A;  1GPS A;  1ICA A;  1LQH A;  1SNB A;  2B68 A;  2YC1 C;  1NH5 A;  1NRB A;  1WT7 A;  2LI7 A;  2N2Q A;  2YBR C;  2KBK A;  1B3C A;  1T1T A;  2KBJ A;  1AHO A;  2I61 A;  1CN2 A;  1C56 A;  2E3F A;  1JZB A;  2N69 A;  2SN3 A;  2LJ7 A;  4CQK A;  2LKB A;  4HHF A;  5CY0 A;  1SN1 A;  1JZA A;  3E7U X;  2M8B B;  1FH3 A;  1B7D A;  2E3G A;  2LJM A;  2KYQ A;  1MYN A;  1TI5 A;  1I6G A;  2KGQ A;  2KBH A;  4AB0 A;  4V1D C;  1P0A A;  2KPY A;  4AEI A;  4UJ0 A;  5KK4 A;  2GL1 A;  4HE7 A;  1ZFU A;  1ZUT A;  1I2V A;  1OMY A;  1JXC A;  1T7A A;  1ZVG A;  1ZU3 A;  2LY6 A;  1N4N A;  1AYJ A;  1VNB A;  1WMT A;  2KSK A;  1T7B A;  2ASC A;  2E0H A;  1MR4 A;  2ATB A;  2NY8 X;  2LT8 A;  1C55 A;  1NPI A;  2NY9 X;  1WWN A;  3PSM A;  4AAZ A;  1NRA A;  4KYP A;  1T0Z A;  1L4V A;  1ZYW A;  1BMR A;  1PE4 A;  1OZZ A;  2BRZ A;  1PTX A;  1ZYV A;  1BRZ A;  2A7T A;  1I2U A;  3E7R L;  1LQQ A;  1SN4 A;  1T7E A;  1DJT A;  1DQ7 A;  2YEO A;  1P00 A;  2N66 A;  1CHZ A;  1PX9 A;  2B3C A;  2KJA A;  2MZ0 A;  1BCG A;  1ZVE A;  1GPT A;  1JKZ A;  1LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...