1DKGD

Crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
381
structure length
376
Chain Sequence
KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKTGNRTIAVYDLGGGTFDISIIEIDEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (hsp24/hsp70)
molecule keywords NUCLEOTIDE EXCHANGE FACTOR GRPE
total genus 96
structure length 376
sequence length 381
ec nomenclature
pdb deposition date 1997-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 1dkgD02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1dkgD04
4HWIA 3C7NA 3EKUA 3KHYA 1H1VA 3H3NO 4PKHA 1NWKA 4FOIA 4CI6A 3UB5A 4ISGA 5AFUH 2ASOA 2E2NA 2ZGZA 3SMPA 3HM8A 1NGGA 1GLAG 1WUAA 2BUPA 3FE1A 3G25A 2HF4A 4PL7A 1SQKA 1LCUA 3WUHA 5BPNA 3QFUA 4CZFA 5B8HA 4B9QA 3LL3A 3VGLA 2AP1A 3LDQA 2AA4A 3GBTA 2QWLA 2OANA 3ENHA 3VEWA 5JLFA 4PKGA 2GUPA 4IJNA 1S3XA 1KXPA 2E8AA 3A8YA 3VEOA 2P9KA 1XC3A 1ATRA 1NGJA 4BR0A 3GE1A 1GLLO 2CGKA 1HX1A 4WQ5A 3GL1A 1QQMA 2FF3B 3FZMA 2E2QA 5AQPA 3BEXA 4BRGA 2V51B 4O8KA 4DCHA 1V4SA 3H1QA 5AQMA 1QZ5A 2QW9A 4H0OA 4PL8A 1HLUA 4H5TA 2Q1NA 3I8BA 1GLBG 4M7XA 1GLFO 5BRHA 5AR0A 4JN4A 1Z05A 4BRCA 3WQTA 3MMVA 1MDUB 4JNEA 3CHWA 3R6MA 5AFUA 3ID8A 3HBTA 1D4XA 2E1ZA 1NGBA 3CETA 4NB4A 2E20A 2HMPA 3CJ9A 5FPNA 3O1WA 3SJHA 4H0XB 4JHDB 5KPTA 2EWSA 1ATNA 3FZLA 4NO7A 1G99A 3RSEA 1BOTO 1ESVA 3I33A 3IUCA 3L6QA 3CI5A 3FR0A 3HSCA 1HUXA 3FZHA 4CZEA 4H0PA 3MCPA 4BG8A 5AQIA 3AAQA 3O4WA 4BGAA 2IIRA 4BC4A 4H5WA 5E84A 4EIAA 1HJOA 3CJ7A 4WQ4A 3GG4A 5ADXH 4O5FA 1YXQA 1NGCA 3HZ6A 2HOEA 4H03B 4BR4A 1ZC6A 4I6MB 4FPAA 5TKYA 3DJCA 5AQXA 3A5NC 2QWOA 3F9MA 5EOYA 5AZIA 5AQWA 2NZTA 3QBWA 4BRHA 2D0OA 2CGLA 4CZLA 1WOQA 5EXWA 4XH4A 2IVPA 3EZWA 2P9LB 4RCHA 3VEXA 1GLEG 3IMXA 4FWNA 1QQNA 1TUYA 4CD3A 3H46O 2V7ZA 2P9IB 5AQJA 3B8AX 3SLCA 4FOEA 4IJAA 4BG9A 2FSNA 3H3OB 3SK3A 3VF6A 4CZMA 3CIPA 2YHWA 4BVOA 3QMLA 4JAXA 3O80A 3ENOA 2FSJA 4FWQA 4IWVA 1ZBSA 1T6CA 4A62A 4H5VA 4XEIA 2QWPA 1YVNA 3IFRA 3WXJA 4DQ8A 2A41A 2NRHA 2VCPA 1NGAA 3CJCA 5LJWA 1SAZA 2FSKA 1HKCA 3HI0A 4Y0WA 5CE3A 3D2EA 4BROA 1KAXA 3U9DA 4XH5A 1RDWX 1T6DA 3VEYA 4DB3A 3QICA 2A42A 3UKRA 3R9PA 4E1JA 1MWKA 3VGKA 3WXLA 4RWTA 3LDNA 4CD1A 4WQ4C 5EX5A 3ZX3A 1OKJA 3CJ1A 4CBXA 3VF2A 1U2VB 1EQYA 1X3NA 2DPNA 4J8FA 3UKUA 3ZETA 4EHUA 1BDGA 3R8EA 2ASPA 1BWFO 4JD2B 2WUSA 3EL2A 2IVOA 5ADXA 4MO4A 5AQRA 4EHTA 1BUPA 3H6EA 1SZ2A 5FPMA 4H0YB 2CH6A 3ZX2A 3U9ZA 3AAPA 5JICA 5ELZA 1QHAA 3A0IX 2YJEA 4FPBA 5AQUA 1X9JA 3GOIA 5KQ8A 5BN9A 2VWBA 1DEJA 5FPDA 3EO3A 3DAWA 1K8KA 4ISEA 3MN6A 5BRDA 5BRFA 2P9UA 3A5LC 1T44A 3VERA 4I6MA 3DWLA 4IXCA 3RSEB 5AQZA 1HPMA 2Q0RA 3WXIA 3ZEUA 4BRMA 4CZJA 4B1VA 1DGKN 1NGDA 2HF3A 2Q97A 4WQ5C 3HTVA 3CJAA 3SMSA 2IVNA 1MA9B 5AQTA 2P9SB 3VF4A 3WEEB 3WEEA 3QB0A 2YJFA 1E4FT 4FWMA 4BRKA 3QBXA 3UE5A 4GNIA 3BUZB 3C0BA 5JMVA 3KZBA 1C0GA 4BGBA 3O08A 2P9PA 1GLJO 1E4GT 2F9TA 5AZJB 3LM2A 4BRFA 2YCHA 2F9WA 3QFPA 4IZ9A 3BF3A 3WXKA 1JCEA 2VYPA 1NMDA 4JD2A 4LC9B 3ATUA 5F2RA 4FWOA 5FPEA 3UKUB 1RFQA 3CERA 1XQSC 4CBWA 3D2EB 1NGHA 1Z6RA 1GLDG 3CQXA 3AARA 3DXKB 1C0FA 3VENA 1TUUA 1NGIA 2GWJA 4BR9A 3O1BA 5KQDA 1NLVA 2Q36A 2PBDA 4BQLA 5BPMA 4M63C 3U8XA 4A61A 4BRLA 4BRDA 3IDHA 4BQZA 1YUWA 3BP8A 4H5NA 3A5OC 4MO5A 1TYQB 4FWSA 4BRNA 5BR9A 5AQSA 3ZETB 4FL9A 2A40A 3D2FA 1DKGD 3D7EO 4RTFD 1BA0A 2QWMA 1BO5O 1HKBA 3LDPA 3D2FB 4YDUC 1ZXOA 4BR7A 1X3MA 2P9LA 2P9SA 2FF6A 3DXMA 2BTFA 1U6ZA 3FZKA 2QXLA 2V7YA 3ULEB 2ZWHA 1NGFA 4C23A 3UKRB 3FLCO 4CZIA 1Y64A 3MN7A 2YHXA 3VEVA 3CQYA 5AZJA 3CJBA 2P9PB 2GELA 4A2BA 2P9KB 2P9NA 4FWRA 3VPZA 1K8KB 2A5XA 4Z94A 3O8MA 3EN9A 1CZAN 1GLCG 3MDQA 2ZGYA 3VEZA 4K41A 4B1XB 1JCGA 4BC5A 2W40A 3TPQA 1J6ZA 4BRIA 5BPLA 3W0LA 3ATVA 3EKSA 4CZHA 2QWRA 2ITMA 2A3ZA 2Q2RA 3JS6A 4A2AA 3M1FA 5AQYA 1Q18A 1JCFA 1LOTB 4QS8A 3GDQA 1RGIA 3VGMA 3MK6A 3OHRA 3MN9A 3FZFA 1XUPO 1U2VA 4H0TB 1BU6O 4BC3A 4EAHD 3U4LA 1IG8A 1BG3A 5AZIB 2P9NB 2ZF5O 1MWMA 4AM6A 5AQQA 3ZEUB 4CZGA 4FWKA 4JHDA 4BR2A 2FLOA 3L0QA 4H5RA 1IJJA 1NM1A 3H1VX 3ULEA 3DXMB 3H45C 3TU5A 4BVPA 2I7NA 4PKIA 4XH1A 2QM1A 2YHYA 3BF1A 3JXUA 2YI1A 3O6WA 2GTDA 2GWKA 2E1YA 1QZ6A 5AQFA 4KBOA 5AQOA 4M7YA 1NBWA 3VESA 1TYQA 2E88A 2GEMA 5LJVA 1KAZA 2E2OA 1YAGA 4B1ZA 4QS9A 2ASMA 2KHOA 2FXUA 4H0VB 3J8AA 4F9OA 2H3GX 4BC2A 2Q31A 5BN8A 5I9EB 3M3ZA 4MLEA 3WT0A 4CBUA 5F0XA 4MLHA 4L3QA 2CH5A 5E26A 2QWNA 3C7NB 2E2PA 5AQVA 1P8ZA 2P9IA 3S41A 3LDOA 4WYBA 1S22A 1V4TA 4DHYA 4IO8A 3DXKA 5AQGA 5AQNA 4FO0A 4B1WB 4BRPA 5EVZA 2D4WA 5F1XA 3L4IA 5AQHA 5AQKA 5KPZA 3WQUA 4CJ7A 1ATSA 4B1YB 4FSVA 5AQLA 2W41A 4BREA 3LDLA 4BRAA 1QQOA 1HKGA 4FWPA 4K43A 4GY2B 1R59O 3M6GA 2I7PA 2P9UB 4K42A 3O5BA 3VETA 2NLXA 3FFKB 4K25A 1KAYA 4ISFA 3LM9A 2UYTA 3A5MC 4YDUA 4BR5A 4CZKA 3VOVA 2QWQA 3MN5A 3ZX0A 3KVGA 2CGJA 4EFHA 5LY3A 1NGEA 2PAVA 2A6AA 4FWLA 2D1KA 5EY4A 2V52B 2J4RA 5KPRA 3W3DA 3P4IA 5BREA 4QS7A 3FGUA 2Q0UA 4B1UB 4AM7A 3AY9A 1BA1A 4BRQA 4HTLA 2D0PA 3QDKA 5JLHA
chains in the Genus database with same CATH superfamily
4HWIA 4JI6K 3QNOA 3OYEA 4CI6A 4BE2A 2K35A 1NWKA 4WCEL 2ZGZA 2E2NA 3SMPA 1JLFA 3AVFA 3G25A 3P5JA 1C56A 3TWHA 4WF9L 1SQKA 1LCUA 2ZD1A 5BPNA 5B8HA 1RT1A 2VGMA 3AA4A 4KH6A 4KB0A 3LDQA 3TAQA 4DS5A 1JLGA 4DV5K 1IBMK 1Q82O 3VEOA 4GVMA 1TAUA 1K73O 1ATRA 4CJEA 4DV4K 1BIUA 3LWMA 1GLLO 2IDOA 4WQ5A 2NRRA 1QQMA 2FF3B 2E2QA 2KFNA 4CF8A 1DTQA 1LWFA 4BRGA 1U45A 1CZ9A 3H1QA 2RF2A 3J81O 1QZ5A 4W5TA 2DTUA 2E5LK 5C2DA 3KIOA 4H0OA 1HLUA 4PL8A 2QK9A 4R79A 5CHIA 3E1YA 4IOXA 1ZVGA 4OLAA 1I2UA 2G8KA 4M7XA 1VQ5N 3OYBA 4G9ZA 5TKWA 3AV9A 5HBMA 4KHQA 2KBKA 3CHWA 5AFUA 2OPSA 1KVCA 1IKXA 3HK2A 1ASVA 1D4XA 4NB4A 4Z0UA 2E20A 3CJ9A 4OPJA 5LMNK 1NG9A 3FZLA 2RKIA 3QI7A 1M90O 3R1XA 3LDSA 4G1QA 1ESVA 3I33A 1NK0A 3PX0A 3CI5A 3DLGA 3HSCA 2XO7A 4MDAA 4E7JA 2FC0A 3KLHA 3KOYA 4E7HA 4BGAA 4FJGA 4BC4A 4CGFA 1HJOA 3CJ7A 4O5FA 1TK5A 4BE0A 3KK7A 2OPQA 4WE1A 5DMRA 5TKYA 2QWOA 5AQWA 2HNDA 4BRHA 4AEIA 1SS6A 4Z4FA 2OYQA 2GMOA 4CZLA 2P9LB 4RCHA 3WNFA 1TGOA 3IMXA 1QQNA 1RT7A 2P9IB 1I39A 3B8AX 4X64K 3U3YA 1Z26A 3UIQA 3H3OB 5I42A 3HT3A 4GMJB 3VQ9A 3E7RL 4QAGA 3QMLA 2I5JA 3M5RA 3NFAA 1ZVEA 5M1FA 1EO1A 2KW4A 2QKKA 4H5VA 3NGZA 4LH4A 4PA1A 2RE2A 4DQ8A 3K9KA 2A41A 1BHLA 2NRHA 1SKWA 3KJVA 3O9RA 1YTUA 1SAZA 2JDQD 3HI0A 3DLEA 2VY6A 4BROA 1N33K 1KAXA 1SN1A 3ULDA 3G0ZA 3V1QA 2VWJA 4N5SA 4XH5A 4OKKA 4AHSA 1T7AA 1Q8IA 5J2QA 2A42A 3UKRA 1SL2A 3VGKA 3NF9A 4E3SA 4FJ5A 3LDNA 2RN2A 4MQ3A 3QO9A 4CD1A 3ZX3A 3VF2A 1U2VB 3JSMA 4J8FA 3UKUA 4N41A 4OGCA 3R8EA 1TKXA 4JV5K 2WUSA 3EL2A 1EX4A 1W7AA 4EHTA 3PV8A 3AA3A 3OYLA 4H0YB 3TAEA 3ZX2A 3IRXA 5HOOA 5JICA 2A7TA 4B3SK 5H1SQ 3L56A 3V9UA 4KKOA 1VHXA 4DSLA 2YEOA 4CGJA 4BDZA 3GOIA 1FJGK 2VWBA 2LN8A 3MCAB 2B4JA 1DEJA 3KWIA 1CXQA 1K8KA 3CFRA 3ZT3A 3MN6A 1Y97A 1RDUA 3VERA 2G8VA 1UA0A 4LD0A 3TTDA 4IXCA 3RSEB 4KPYA 1HPMA 1QSYA 4CZJA 4B1VA 1NGDA 2LR3A 4JRQA 4C1NK 3HTVA 4O0IA 1EWQA 1WSIA 3R3LA 2RHKA 5M1OA 3SQ0A 4CERA 2X78A 3OTOK 5JS1A 2YJFA 1E4FT 4BRKA 2HNYA 2IS3A 2YV0X 1LWCA 3BUZB 3KLFA 4BGBA 3O08A 4ILJA 2P9PA 3OYKA 1E4GT 3VQ8A 1HMVA 4CJRA 3QFPA 4NXMK 3AVJA 4CJ4A 4JD2A 3ATUA 3ISNC 1L3SA 1P90A 5FLXO 3IS9A 2KPYA 3ZCMA 2GL1A 2PYJA 3D2EB 2HMIA 3LZIA 3DXKB 4WFAL 1C0FA 1BMRA 1RT2A 4DTXA 1ZYQA 1NGIA 1Q86O 4FK0A 4I2QA 4BQZA 3M8SA 2C1GA 1TYQB 1S9GA 4XIUA 1U4BA 3OYCA 1XHXA 3C6TA 3L2VA 1L5UA 4M3RA 3RMCA 3D2FA 1DKGD 3HVRA 3P83D 3SPYA 1HKBA 2E3FA 4YDUC 4CIEA 1NJWA 4B9UA 3SUQA 1SNBA 2KBHA 3DXMA 4MFBA 2BTFA 1U6ZA 3FZKA 1NRAA 2F8TA 3P38A 4CECA 3C94A 2Y1JA 4FJJA 2HB5A 3I56N 3CJBA 4ELTA 4RW7A 1SKSA 4ILHA 2P9NA 1VNAA 2JWKA 3VPZA 3AGKA 4DTOA 2N69A 1VQNN 3O8MA 4FK2A 1CZAN 2A1RA 3VEZA 1JCGA 1LAWA 2X6NA 1T03A 4CE9A 1RBTA 4KRFA 2X74A 2Q2RA 3OJSA 1O13A 1KSPA 3KK2A 4FJ8A 4R5PA 4JKCA 1JCFA 1RDDA 3AVAA 4QS8A 3VQCA 4CGHA 4YY3K 3T69A 3VGMA 1Q9YA 3OHRA 3MN9A 1NJZA 4C8NA 3SAGA 4H0TB 2YC1C 2YKNA 4IOCL 5AZIB 2P9NB 3M8PA 2ZF5O 3BY5A 4CZGA 1M1KO 3K2PA 2SN3A 2FLOA 4H5RA 4JKGA 5KGWA 3DXMB 3CC4N 3H45C 3TU5A 2I7NA 3TSPA 1A5WA 3ID6A 3C6AA 3BF1A 1TVRA 4E1NA 1VK0A 2PFUA 1E3MA 4UAEF 2DFFA 2E1YA 4I9LA 4KBOA 1C0MA 4RW6A 4DQQA 4CJ5A 1NBWA 3VESA 1TYQA 5LJVA 5AJ3K 1JJ2M 4FJKA 1UOCA 2ASMA 4H0VB 3MEEA 3TSQA 3ASMA 1K6YA 4KH5A 1RTHA 1KLNA 5I9EB 4DFKA 3M3ZA 3T19A 3WT0A 4B3OA 2CH5A 4LF6K 3K5MA 3LDOA 4J2EA 1S6QA 4WYBA 4KAZA 3DXKA 2MBKA 5AQNA 1A5VA 5EVZA 1LQQA 4B8AB 3NMUA 5AQKA 3DOLA 5KPZA 2HVIA 3KD5E 1I94K 1IBKK 4CHOA 4TSXA 4Q5VA 1ATSA 5AQLA 3QEWA 4BREA 3LDLA 4DTPA 4BRAA 3SV4A 1QQOA 4FWPA 4K43A 1NK4A 3QIPA 2I7PA 1IKYA 4K42A 3HP6A 4PUOA 3FFKB 3KP0A 4ISFA 1OMYA 3LM9A 4BR5A 4CF2A 1WLJA 2GV9A 4CZKA 3VOVA 4IBNA 1GOCA 1JLAA 1NK8A 4C8LA 2G8HA 5DM6L 4OPKA 4CJFA 1KV0A 4LF8K 4DR6K 4JKAA 4JKHA 2B3CA 4N56A 3E9LA 3QINA 3CFOA 2CGJA 2NY9X 2OZMA 3RR8A 1NGEA 4CK1A 1NE5A 1QVFM 2PAVA 2O4GA 2V52B 4YOWA 3DRSA 4CJUA 4QS7A 3NHGA 3TR8A 2O4IA 1UGLA 1BA1A 5C42A 3THWA 3HYFA 4BECA 5HRSA 3QDKA 3C7NA 4HHFA 1H1VA 3H3NO 4PKHA 3UB5A 1L3UA 5AFUH 5J2MA 3HM8A 1JZAA 3THXA 1GLAG 1WUAA 2BUPA 3FE1A 1W2BM 3T1HK 3WUHA 1VQLN 3QFUA 3HXMA 3GBTA 3U3GA 1BCMA 4A59A 3PLAA 3OJUA 2WTUA 5CY0A 5JLFA 1HYSA 2GUPA 2WC9A 4OKJA 4AF1A 4CEDA 1NOYA 3SCXA 4BR0A 4B9NA 3TANA 4JI4K 4AILC 3G71N 5J1EA 3GL1A 4RW4A 3SYZA 4LF5K 1RDBA 1S1UA 1R0AA 1OH5A 1HNVA 1EKEA 4PHTX 3BEXA 4O8KA 1VSEA 4FLUA 1RTDA 3K5OA 3KLIA 1JLQA 2ZJPL 3K5NA 5BR8K 2OPRA 1NKCA 3LP0A 2Q1NA 3I8BA 1GLFO 4GV9A 2O8CB 4JN4A 4I2PA 1Z05A 1I3AA 3WQTA 2WBNA 3DLKA 1MDUB 4JNEA 2JLEA 4E72A 3IG1A 4O5BA 3CF5L 2E1ZA 2HMPA 5CYMA 3CCQN 4LSLA 4H0XB 4UY8O 3MWPA 2EWSA 1ATNA 3DM2A 5KTQA 4CEFA 1VAZA 1SUQA 1G15A 1NJXA 3HO1A 1KC8O 1ASWA 3L2UA 1HUXA 1VRTA 3KKRA 3HPHA 4CQKA 3MCPA 3QETA 1IG9A 3O4WA 3P31A 4LSNA 1OH6A 3J7AP 1DQ7A 3DLRA 3C6HA 4KTWA 3VQ6A 3DMJA 4WQ4A 3GG4A 5IWAK 1NJIO 4JS4A 3LPTA 1ZBHA 3RWUA 4OVLA 3ZSYA 1WB9A 4I6MB 4JK9A 4AHTA 1OH7A 5CYQA 2OCEA 4M3WA 4AAZA 5GAHP 1VSLA 3DI6A 2CGLA 1WOQA 2LT8A 4UAFE 2HHUA 3EZWA 1GPSA 3VEXA 1GLEG 4CD3A 4NCBA 2E4LA 1S5JA 2V7ZA 4LFCK 5AQJA 1FK9A 1YJNN 4B9SA 4CHZA 4IJAA 2F4VK 1S72N 3KP1A 5JENA 4CZMA 3CIPA 4Z4HA 4DQPA 4O55A 4DS4A 3N4PA 4IWVA 4OLBA 4A62A 1YVNA 3MXIA 3WXJA 3ZSXA 1ZBFA 4IFYA 4QOZB 3AA2A 3CJCA 5LJWA 3V9SA 1B7DA 1HKCA 4JI8K 5CE3A 1VSFA 4CEBA 1BRZA 2ASCA 1LW2A 4M41A 4E1JA 5CR4A 1VQPN 1T0ZA 1KLMA 5EX5A 1JLEA 3ZSRA 3HJFA 3OYJA 3TAFA 1IKVA 1T7BA 2W00A 3CC7N 3E01A 2N2RA 4M42A 1JXEA 1EQYA 3KLEA 1HNXK 2ZE2A 2JWLA 4ILGB 2LI7A 2P5GA 2RPIA 2VWKA 1VSJA 2IVOA 4MO4A 3CFPA 1KTQA 1BUPA 3QEXA 3H6EA 3VQQA 4F2RA 5FPMA 2LKBA 4DSIA 5FROA 3TAMA 1S1VA 4RW9A 1EP4A 4CFDA 3ZSVA 1OVYA 1XI1A 5HP1A 5LL6Z 1RBUA 1XWLA 1J9AA 3A0IX 3LZJA 2YNIA 3VQEA 4B3RK 1YI2N 4MDBA 2P1JA 5KQ8A 5BN9A 3Q7BA 1WSJA 1T05A 4JI3K 3EO3A 2XHBA 3NBPA 4JYAK 2O8EA 3G4SN 3NF7A 2P9UA 3DWLA 4FJLA 3I0SA 4H4OA 4Z4IA 3CJAA 2KBJA 3SMSA 3WEEB 2P9SB 4W5OA 2B68A 3A2FA 1SN4A 3UE5A 1T3VA 1NMNA 4CHNA 4AH9A 4FM1A 4LF4K 3P1GA 4ZHRA 3KZBA 5C25A 1C0GA 2F9TA 3PIPL 5AZJB 3CCSN 4KHSA 3ZSWA 4IZ9A 1JCEA 3PX6A 5FPEA 1RFQA 4DSFA 4CBWA 1Z6RA 4LY7A 1QTMA 3AARA 2G8IA 1N32K 1X9SA 4BR9A 5KGXA 1LAVA 5C12A 2NRWA 3VQ7A 4FLZA 2PY5A 1FH3A 5BPMA 4HVJA 4JI7K 2O8BB 4M63C 4BRLA 4A61A 2YIPA 5CZ2A 4JI2K 3IDHA 5GIOA 5HRRA 4JKFA 4HTUA 5AQSA 4KO0A 5GINA 3EZ5A 4U67L 3D2FB 2P51A 1X3MA 3VTHA 5JS2A 3PSMA 3ZSQA 3AGRA 2P9SA 2VQEK 4IDKA 1C55A 1VQON 3VTIA 3VQAA 1J5OA 1HQUA 3FLCO 1HQEA 4CZIA 4KHNA 1LQHA 4FJIA 3VEVA 4M3YA 3CQYA 1K8BA 4L8RB 1S1TA 3E66A 3WNEA 3OYNA 3BGRA 1Q7YO 3QESA 4Z94A 4CEEA 4CIGA 1SL1A 2YHAA 4DR7K 2W40A 1ASUA 3KK1A 2IC3A 3HVTA 3ATVA 2YIOA 1QE1A 4CZHA 2ITMA 5GAGP 1SL0A 2A3ZA 3M1FA 4JEPA 4OPAA 4K0KK 1K9MO 3HL8A 1Q18A 1XMQK 3LPUA 2NRTA 1TKDA 1S1XA 2E3GA 3LANA 3MK6A 2G2KA 3ZLJA 4M45A 3RMBA 3S3NA 5C24A 1QHTA 3FZFA 1TK0A 1XUPO 4CFAA 1N36K 4CF0A 1BG3A 1MWMA 5AQQA 1BCGA 3S5TA 4FWKA 4JHDA 3PSIA 3L0QA 2BRZA 3AVBA 3H1VX 1D5AA 4A5AA 3ULEA 1WAJA 4AB0A 3K57A 4J2BA 1FKPA 2QTDA 2Z1IA 4XH1A 3ZT4A 3V9ZA 3VMFB 4ZTJA 1TL3A 2YI1A 2YNHA 3O6WA 1T8EA 3THVA 4O8UA 1KCFA 4CJ3A 5AQFA 2W6KA 3LAMA 1C1BA 4DUYK 4M3ZA 3K5LA 1S6PA 3PO5A 2UUAK 1REVA 1KAZA 2E2OA 3F5TA 1B9DA 1D9DA 4BACA 4F9OA 2H3GX 4BC2A 4E7IA 5BN8A 3OS1A 4MLEA 5C10A 3ZYYX 5E26A 1NH5A 3C7NB 4U7BA 3DLBA 2MN5A 3CM5A 1C0UA 3RTVA 3AVMA 1I6GA 1XNRK 3BK3C 1I6FA 4BE1A 2D4WA 5F1XA 4E89A 1JXCA 3SBTA 1DTTA 1QQCA 4LFAK 5I3UA 1OZZA 4B1YB 4KI4A 1YVUA 4EP4A 1VSIA 1HKGA 2NNWA 1QSSA 5SWMA 1PE4A 3O5BA 4K25A 3A5MC 3KWGA 3M8QA 3MN5A 1F21A 3T3FA 4NCGA 3EEQA 4DTJA 4DR3K 2IAJA 3KVGA 4DU1A 3NGYA 5KRTA 5FRNA 2VG7A 3ITHA 3KKSA 1MYNA 3KD1E 3R2VA 2A6AA 4FWLA 3W3DA 1RT5A 4F2SA 2NRVA 2E6LA 1WSGA 2IGIA 1C1CA 4YOXA 2D0AA 4BRQA 4HTLA 4IOAL 3CMAN 4X65K 4FLTA 3EKUA 3HP9A 3C6UA 4HHTA 4FOIA 1KRPA 1SEGA 4ISGA 1WSHA 2ASOA 2OPPA 3B6OA 1RTJA 4PL7A 3NE6A 1WN7A 1HPZA 4B9QA 3LL3A 1D8YA 2HHXA 3VGLA 3CPWM 2AA4A 2O8BA 4UJ0A 2OANA 3ENHA 3V1OA 2QXFA 2UXBK 3N4QA 2E8AA 1EWRA 3CG7A 5KRSA 1EXQA 2P9KA 2QEXN 2XY7A 3GE1A 1HX1A 2BE2A 3CC2N 4DSJA 3FZMA 4B8CA 5AQPA 1VQ4N 1KQSM 1JLBA 3EYZA 3O3FA 1YHQN 2V51B 4DCHA 1Q9XA 1FKOA 3THXB 2QW9A 1WBBA 4H5TA 3L2WA 1TAQA 2EHGA 1RILA 3D45A 4CEQA 5BRHA 1XRSB 1WWNA 3VA0A 1NJYA 4B08A 2GBZA 1ZBUA 3MMVA 3Q7CA 3CETA 4DR5K 4DTNA 5FPNA 3CCLN 4JHDB 5KPTA 1JKHA 4NO7A 1G99A 1S9EA 1N6QA 1TV6A 3ENBA 4OJRA 4OX9K 1BOTO 4CW7B 3VA3A 4DV7K 4FJNA 3L6QA 3BZKA 2GX9A 2HBLA 3FR0A 4KI6A 4B3TK 5M1KA 4CZEA 3AAQA 1KVBA 1BQNA 1NKEA 3QIOA 4EIAA 5ADXH 4F8RA 2W42A 3HZ6A 2HOEA 4FZZA 4Q0BA 2DY4A 1IKWA 4CK3A 3SF4D 4FPAA 3DJCA 3A5NC 3F9MA 2F7TA 1KD1O 4YOTA 3PX4A 2NZTA 3QBWA 2D0BA 3SBGA 1NK7A 5EXWA 4XH4A 2LJMA 4O0JA 4KTZA 4CF1A 4FWNA 3TABA 2B6AA 3PO4A 2LY6A 2FSNA 3RR7A 3ZT2A 3NGIA 3DLHA 3SK3A 2YHWA 2NUBA 4NLBA 2XRIA 1D9FA 1ZU3A 5A2QO 4DFJA 4DV0K 2Z1GA 3RMAA 1T6CA 2KFZA 2HHSA 1BIZA 2QWPA 4CGGA 2Q3SA 2XY6A 4CF9A 1HYZA 3D2EA 2FBVA 3U9DA 4JKBA 1BI4B 1NK9A 1RDWX 4DB3A 3OBWA 3VQ5A 3R9PA 1NU0A 2E0HA 3WXLA 4CESA 2MZ0A 1PTXA 1OKJA 3CJ1A 1UA1A 4CBXA 3CXCM 2YNGA 2D56A 1X3NA 3SUPA 1BDGA 2ASPA 1BWFO 4JD2B 3K9JA 5ADXA 4B9LA 1NKBA 1SZ2A 5KI6A 3B6PA 1C0TA 1K8AO 1TI5A 2CH6A 3QEPA 3U9ZA 4HUEA 2NRXA 2F96A 1QVGM 1QHAA 1GOAA 4DR2K 2YJEA 4DWIA 4YOYA 1YF5L 3BZCA 3AVGA 3TI0A 1VQ7N 4V19S 5FPDA 2O8FA 2ITGA 4ISEA 3J7YP 2HHVA 5BRDA 1JZBA 3A5LC 3OYHA 4I6MA 3TSUA 3RRHA 4KTQA 1KFDA 2XY5A 2E6MA 3F9KA 3V9XA 3V4IA 4J2DA 2HF3A 3S3MA 3CCVN 1UWBA 4DSKA 4NYFA 3SUOA 2IVNA 1MA9B 3VF4A 3WEEA 4FWMA 4BWMA 2UXCK 3O4QA 5IT9O 4GNIA 3PIOL 2VQFK 1HNWK 2LSNA 1NRBA 3O9TA 1I2VA 3LM2A 4C8OA 5M1PA 3THYB 1NK5A 3I0RA 2F9WA 3E7UX 3WXKA 1WNSA 2VYPA 4UADE 1NMDA 4CJLA 4FXDA 4N47A 5F2RA 2KTQA 3KOXA 4FWOA 3JAMO 1P00A 4CIFA 3CERA 3WNHA 3NF8A 5GAEP 1RDAA 4OGEA 2UU9K 1NGHA 1C1AA 1GLDG 4LH5A 4GV6A 2I61A 3K58A 3E9PA 3CD6N 3QLHA 3AO2A 4H4MA 2Z1HA 2Q36A 3V9WA 2C1IA 2PBDA 2OA8A 4KV8A 4BRDA 5DK5A 4DF8A 4OO1J 1RNHA 4H5NA 4FM0A 3A5OC 1BISA 2YILA 5BR9A 2UXDK 4FL9A 3SZ2A 3JYTA 4FVUA 4J2AA 2QWMA 3IKMA 3LDPA 4AHUA 1IV0A 3O9SA 1LV5A 4CFBA 4X66K 2FF6A 3EY1A 3ULEB 2ZWHA 1NGFA 1JL2A 1IH7A 3MN7A 3G6EN 1J53A 3OA9A 5AZJA 2LY5A 2P9PB 4YNQA 3SNNA 1RTIA 3CCEN 4KB1A 2NY8X 4A2BA 2HNZA 1GOBA 2P9KB 4FWRA 1K8KB 2A5XA 3F73A 3MXJA 3EN9A 3MDQA 4B1XB 1HNIA 2BANA 4BRIA 3OS0A 4HCCA 1ILYA 3I55N 1B3CA 4F3OA 4CGDA 3AVKA 3W0LA 4DG1A 2QWRA 1ZBIA 4A2AA 3OS2A 3C65A 1LOTB 1CZBA 1FXXA 3CM6A 3PY8A 4H8KA 3LP3A 4W5NA 1TL1A 3MEGA 3F2KA 4CJKA 3SAFA 1VSKA 2HBMA 1U2VA 4CFCA 1BU6O 4WFBL 4FJXA 5CY4A 3U4LA 4AHRA 3ZEUB 3OYMA 4B3MK 4BR2A 1IJJA 3NCIA 1WAFA 4B9TA 4PWDA 1U49A 1X1PA 4E19A 1SKRA 4DV3K 4BVPA 4PKIA 3SQ2A 1T1TA 3AVNA 4CVNE 2YHYA 3D6RA 3VQDA 4BY9C 3JXUA 2GWKA 1QZ6A 4ZTFA 4CHQA 3VN5A 2YKMA 4EP5A 3HPOA 2G8WA 3L2QA 4Z4GA 2YBRC 4FLWA 1VQ6N 4DLGA 2E88A 2GEMA 4IO9L 2OTLN 2HBKA 1S1WA 1QSLA 2ATQA 4B1ZA 4QS9A 4KHWA 4YFUA 2FXUA 3J8AA 4WFNL 4FJ9A 3QEVA 1WSFA 3HOTA 4K8ZA 5LMUK 2X6SA 4L3QA 4FJHA 2P9IA 3O9UA 2XY8A 1L4VA 1BGXT 1S22A 1V4TA 4IO8A 4JI5K 3D0PA 4BRPA 4B1WB 4JKEA 2KYQA 3LALA 3L4IA 3AO5A 1FW6A 4YHHK 3U6FA 3WQUA 3ZT0A 3MECA 4FVMA 2W41A 3THYA 3TTFA 4FZXC 1R59O 1JL1A 4RW8A 3THWB 4M3XA 1KAYA 4YDUA 2ETJA 2QWQA 4F3TA 3SI6A 2ATBA 4CK2A 1BQMA 4UQGA 1RCHA 1IBLK 4AQYK 5GIPA 1SV5A 1U04A 4JI0K 3SAHA 2IOCA 1A5XA 2J4RA 2EX3A 5KPRA 4XJXA 1ZFUA 4F4KA 3P4IA 3SUNA 5HL7L 2JGUA 4Z4EA 2Q0UA 3RVCA 4B1UB 4AM7A 1NNEA 3AY9A 1DLOA 1ICAA 5J2PA 3KHYA 3V81A 4OPHA 2UUCK 4IKFA 3EE9A 4E1MA 3TAPA 1NGGA 1DJTA 1OH8A 3NH2A 2HF4A 3VQPA 3M8RA 4CZFA 4LF7K 2KSKA 2AP1A 3ZSOA 2ZM6K 3MX2A 2QWLA 1TK8A 2G8UA 2GUIA 3VEWA 4PKGA 1L3VA 4IJNA 4CHYA 3LP2A 4QCLA 4GKKK 1S3XA 1KXPA 3A8YA 5M1NA 3VQBA 1WBDA 1XC3A 1NGJA 1CXUA 3CCMN 4YORA 2CGKA 1TKZA 1XNQK 3VQ4A 3AA5X 3KOWA 2DFEA 1ITGA 4JLHA 2KGQA 4E7LA 1V4SA 5D3GA 5AQMA 3I8DA 2OTJN 4DV1K 4DF4A 1YIJN 3OYDA 2W6LA 3NH0A 3HPGA 4W5QA 1CLQA 1GLBG 3L8BA 5AR0A 3WNGA 1VNBA 4BRCA 4CGIA 2BGGA 2A1SA 3TTCA 3R6MA 3ID8A 3HBTA 3PSFA 1NGBA 2Y1IA 3O1WA 3SJHA 4AHCA 3S3OA 4KH4A 1NPIA 3SV3A 1YT3A 3RSEA 4DUZK 3V1RA 5FRMA 3IUCA 4ID1A 4Y1DA 4HCBA 1VQMN 3FZHA 4X62K 4H0PA 4BG8A 5AQIA 4NCAA 1VSMA 1O1WA 2IIRA 2D0CA 3KTQA 4JI1K 4H5WA 2R7YA 5E84A 2O8DB 1YXQA 4DTSA 1NGCA 4I9QA 3OVNA 4H03B 4BR4A 1ZC6A 2D5RA 4GVEA 1GPTA 5MLCQ 4DFPA 4DSEA 5AQXA 5AZIA 5EOYA 2AJQA 3OYGA 1RBSA 2D0OA 3AO3A 4FLYA 4HE7A 2HHIA 2IVPA 2HVHA 1TUYA 1POIA 3H46O 1XC9A 3J7ZO 1ZYVA 4YOVA 4JRPA 3SLCA 4FOEA 4BG9A 3T1YK 1RT4A 4CJWA 2HW3A 3AVLA 3VF6A 4GV3A 4BVOA 1T7EA 4JAXA 3O80A 4KYPA 3QEIA 1RT3A 3QERA 3CPEA 3ENOA 2FSJA 3MWTA 4FWQA 3S9HA 1BL3A 1ZBSA 1ZBLA 1ZYWA 3PUFA 4B9VA 4DFMA 2BDPA 4XEIA 4CEOA 4E0DA 2HHHK 3IFRA 1KFSA 2KZMA 4FW1A 2KKZA 1J5EK 4HUGA 2VCPA 1T7PA 1NGAA 4NXNK 2PZSA 1U47A 1TKTA 3OY9A 1RDCA 2FSKA 1U48A 1VQ9N 4Y0WA 3KK3A 3K59A 1CHZA 3LAKA 1LWEA 2KZZA 1T6DA 3VEYA 3QICA 4DKWA 1MWKA 3OYIA 4RWTA 4DTMA 1XMOK 3L2RA 4IFVA 4WQ4C 2NRZA 4GW6A 1KVAA 4BE7B 2YHBA 3SQ4A 1ZUTA 2DPNA 3ZETA 4AHVA 1RBRA 1JKZA 4EHUA 1HRHA 4CJSA 2ZJQL 1JLCA 4CJQA 4E7KA 5AQRA 4CJTA 3OYFA 3TAGA 3LWLA 4EZ9A 2HHQA 4FLXA 1BI4A 2FBYA 4KFBA 4IFEA 1Z25A 4ICLA 1X9WA 3AAPA 4IEIA 1RBVA 4A5BA 5ELZA 5GADP 1OVQA 3OBYA 3CYMA 4FPBA 5AQUA 4FLVA 1X9JA 1YITN 2KQ2A 5JVHL 2QA4N 3DAWA 1UAXA 2F8SA 3SPZA 5BRFA 4DQSA 1T44A 2VG6A 3DLLL 1WT7A 2LJ7A 5AQZA 2Q0RA 3WXIA 2QKBA 3ZEUA 1YJ9N 4BRMA 4ID5A 1DGKN 1N4NA 3CQ8A 4K8XA 2Q97A 4FW2A 4WQ5C 3KC6A 3ZSZA 4DV2K 5M1QA 5AQTA 5HROA 3CYGA 2G8FA 3QB0A 3QBXA 2YNFA 2O8CA 2UUBK 3NVKA 1N5YA 3C0BA 2WONA 5JMVA 4JS5A 3HOSA 1Q81O 1VQ8N 1GLJO 4DU4A 4CCHA 3OW2M 4EZ6A 5C2FA 3ZT1A 4BRFA 2YCHA 4BEBA 5J2NA 1DT9A 3BF3A 4LC9B 1EETA 4BDYA 1VQKN 3E9OA 4FJ7A 3H08A 3UKUB 1XQSC 3CQXA 5CZ1A 4DR4K 4V1DC 1YTAA 1WSEA 3AVIA 3VENA 3NAEA 4RG8A 1TUUA 1XHZA 3DRPA 2GWJA 4CJPA 3O1BA 1RT6A 1PX9A 4HUFA 3FFIA 5KQDA 1N34K 1NLVA 4DQRA 4FK4A 5EU7A 4BQLA 3HM9A 3U8XA 1YUWA 3BP8A 3T1AA 3C95A 4A57A 3AO1A 4MO5A 4FWSA 4BRNA 3CCRN 4FM2A 4IDHA 3HSTB 3ZETB 2A40A 2HSTA 3WXMB 2BH1A 3D7EO 4RTFD 1BA0A 2HHWA 1BO5O 1ZXOA 3MXMA 4N76A 4BR7A 1C6VA 4OKEA 1QS4A 1VRUA 2P9LA 3CCJN 1YJWN 2QXLA 2V7YA 4JKDA 4C23A 3K0SA 3UKRB 5E41A 5HLFA 3AVHA 1HYVA 2Z1JA 4DU3A 1Y64A 3O4NA 2YHXA 5DM7L 3O9QA 3EE8A 2WFBA 4O44A 3DRRA 2GELA 4CEAA 2VGNA 4CHPA 4FYDA 1IO2A 2HHTA 2HBJA 4M3UA 2O8FB 1GLCG 3NVMA 2ZGYA 4K41A 2P5OA 4BC5A 4ELUA 3TPQA 1J6ZA 4FCYA 2N2QA 4DR1K 4KHYA 5HRPA 2B5JA 5BPLA 1AHOA 4DLEA 3SQ1A 3DYAA 4PY5A 3EKSA 4FJMA 3JS6A 3L3UA 2N66A 5AQYA 4CEZA 2O8DA 1NOZA 3GKUA 3GDQA 1RGIA 4O4GA 3L4QA 3ALYA 3NDKA 3NF6A 4W5RA 5HRNA 1W9HA 2QI2A 3IAYA 3O3GA 4BC3A 3NH1A 4EAHD 5KK4A 4I7FA 1IG8A 1WMTA 4AM6A 3CCUN 1NM1A 4DTRA 1AYJA 1X9MA 2OZSA 4IG0A 1P0AA 3O3HA 3BDPA 2FBTA 2QM1A 1HJRA 2VG5A 2FBXA 4Z4CA 2E2FA 4ELVA 4LFBK 1VSDA 2GTDA 4LF9K 1VSHA 3KHWA 2PYLA 4M3TA 3LP1A 5AQOA 4M7YA 4KREA 3G10A 1N8RO 1L3TA 4B9MA 1B9FA 3AVCA 3KOZA 1JXBA 3MEDA 4C1NI 1YAGA 2KHOA 4BDPA 2Q31A 5SZTA 3J80O 5JVGL 1NK6A 4CBUA 5F0XA 4MLHA 2DFHA 3QNNA 1BCOA 2QWNA 5AQVA 1P8ZA 2E2PA 3DOKA 3S41A 3TARA 4DHYA 4DTUA 5T7BA 3L3VA 1J54A 5AQGA 4FO0A 2KLAA 5AQHA 5FDLA 4CJ7A 1CN2A 4FSVA 5C15A 2KJAA 2ZQBA 3P39A 4JKGB 4DV6K 4GY2B 4JK7A 3M6GA 4C8MA 2P9UB 1BK8A 4Y1CA 4DQIA 1W97L 3CW4A 3HRGA 3VETA 2NLXA 4C8KA 2ZJRL 4IEEA 3V6DA 2UYTA 1W0HA 4IG3A 1B92A 3MX5A 4GKJK 5C0YA 4BWJA 4YOUA 2YX6A 1LQIA 3ZX0A 4CJVA 4PQUA 1MU2A 1MR4A 4KHUA 4FZYA 3OYAA 4EFHA 3SJJA 5LY3A 3KLGA 4NLCA 1HNZK 3CMEN 2D1KA 5EY4A 2O8EB 3AO4A 5BREA 3T7ZA 3RMDA 5K14A 3FGUA 4DMNA 4JK8A 2WOMA 3MAQA 2M8BB 1LW0A 4KHPK 4NYNA 3RRGA 2D0PA 5JLHA 1HR0K
chains in the Genus database with same CATH topology
4HWIA 3C7NA 3EKUA 3KHYA 1H1VA 3H3NO 2K35A 1NWKA 4FOIA 4OPHA 4PKHA 3UB5A 4CI6A 4ISGA 4WCEL 5AFUH 2ASOA 2E2NA 2ZGZA 3SMPA 3EE9A 3HM8A 1NGGA 1GLAG 1WUAA 2BUPA 3FE1A 3G25A 2HF4A 4PL7A 1SQKA 1LCUA 4WF9L 1W2BM 3WUHA 5BPNA 3QFUA 4CZFA 5B8HA 4B9QA 1VQLN 2VGMA 3LL3A 4KH6A 3VGLA 2AP1A 3LDQA 2AA4A 3GBTA 4A59A 3CPWM 3PLAA 3MX2A 2QWLA 2OANA 3ENHA 3VEWA 5JLFA 4PKGA 2GUPA 4IJNA 1Q82O 2WC9A 4AF1A 3N4QA 1S3XA 1KXPA 2E8AA 3A8YA 3VEOA 5M1NA 2P9KA 2QEXN 1K73O 1XC3A 1ATRA 1NGJA 4BR0A 3GE1A 3CCMN 4YORA 1GLLO 2CGKA 1HX1A 3G71N 3CC2N 4WQ5A 2NRRA 3GL1A 1QQMA 2FF3B 3FZMA 2E2QA 5AQPA 1VQ4N 1KQSM 4PHTX 3BEXA 4BRGA 1YHQN 2V51B 4O8KA 4DCHA 1V4SA 3H1QA 5AQMA 1QZ5A 2OTJN 1YIJN 2QW9A 5C2DA 4H0OA 4PL8A 1HLUA 2ZJPL 4H5TA 4R79A 5CHIA 3E1YA 4IOXA 2Q1NA 3I8BA 1GLBG 4M7XA 1VQ5N 1GLFO 4G9ZA 5TKWA 5BRHA 5AR0A 4JN4A 4GV9A 1Z05A 3ZYYX 4BRCA 3WQTA 2WBNA 3TTCA 3MMVA 1MDUB 4JNEA 3CHWA 3R6MA 5AFUA 3ID8A 3HBTA 3CF5L 1D4XA 2E1ZA 1NGBA 3CETA 3Q7CA 4NB4A 2E20A 2HMPA 3CJ9A 3CCQN 5FPNA 3O1WA 3SJHA 4H0XB 3CCLN 4UY8O 3MWPA 4JHDB 2EWSA 5KPTA 4KH4A 1ATNA 3FZLA 4NO7A 1G99A 1VAZA 3ENBA 3QI7A 1M90O 3RSEA 3R1XA 1BOTO 1ESVA 3I33A 3IUCA 3L6QA 2GX9A 2HBLA 3CI5A 3FR0A 3HSCA 1KC8O 1KD1O 4MDAA 5M1KA 1HUXA 1VQMN 3FZHA 4CZEA 4H0PA 3MCPA 4BG8A 5AQIA 3AAQA 3O4WA 3P31A 4BGAA 2IIRA 3C6HA 4BC4A 4H5WA 5E84A 4EIAA 1HJOA 3CJ7A 4WQ4A 3GG4A 5ADXH 4O5FA 1YXQA 1NJIO 1NGCA 3HZ6A 2HOEA 3KK7A 4H03B 4BR4A 1ZC6A 4I6MB 4JK9A 3SF4D 4FPAA 4GVEA 5MLCQ 5TKYA 3DJCA 5AQXA 3A5NC 2QWOA 2F7TA 3F9MA 5EOYA 5AZIA 5AQWA 4YOTA 2NZTA 3QBWA 1SS6A 4BRHA 5GAHP 2D0OA 2GMOA 2CGLA 4CZLA 1WOQA 3SBGA 5EXWA 4XH4A 4UAFE 2IVPA 3EZWA 2P9LB 4RCHA 3VEXA 1GLEG 3IMXA 4FWNA 1QQNA 1POIA 1TUYA 4CD3A 3H46O 2V7ZA 2P9IB 5AQJA 3B8AX 3J7ZO 1YJNN 4YOVA 3SLCA 4FOEA 4IJAA 4BG9A 2FSNA 4BECA 3H3OB 1S72N 3SK3A 3VF6A 4CZMA 4GV3A 3CIPA 2YHWA 4BVOA 4NLBA 3QMLA 4JAXA 3O80A 3M5RA 3CPEA 3ENOA 3N4PA 2FSJA 3MWTA 4FWQA 5M1FA 4IWVA 1ZBSA 1EO1A 1T6CA 4A62A 4H5VA 4XEIA 2QWPA 1YVNA 3IFRA 4IOAL 2KKZA 3WXJA 2RE2A 4DQ8A 3K9KA 2A41A 2NRHA 2VCPA 1NGAA 3O9RA 3CJCA 5LJWA 1SAZA 2JDQD 2FSKA 1HKCA 3HI0A 1VQ9N 4Y0WA 2VY6A 5CE3A 3D2EA 4BROA 1KAXA 3U9DA 4JKBA 4XH5A 1RDWX 1T6DA 3VEYA 4DB3A 3OBWA 3QICA 2A42A 3UKRA 3R9PA 4DKWA 1MWKA 4E1JA 3VGKA 3WXLA 5CR4A 4RWTA 1VQPN 3LDNA 4CD1A 4WQ4C 5EX5A 3ZX3A 2NRZA 1OKJA 3CJ1A 4CBXA 3VF2A 4BE7B 2W00A 1U2VB 3CXCM 3CC7N 1EQYA 2D56A 1X3NA 2DPNA 4J8FA 3UKUA 3ZETA 4EHUA 1BDGA 2JWLA 4ILGB 3R8EA 2ASPA 2ZJQL 1BWFO 4JD2B 2WUSA 3K9JA 3EL2A 2IVOA 5ADXA 4MO4A 5AQRA 4EHTA 1BUPA 3H6EA 1SZ2A 5FPMA 4H0YB 1K8AO 4IFEA 2CH6A 3ZX2A 3U9ZA 3AAPA 5HOOA 1OVYA 4IEIA 2NRXA 4A5BA 5JICA 5ELZA 5GADP 3L56A 5H1SQ 1QVGM 1QHAA 3A0IX 3OBYA 2YJEA 4FPBA 5AQUA 1YI2N 1X9JA 3GOIA 4YOYA 4MDBA 5KQ8A 1YF5L 1VQ7N 5BN9A 2LN8A 2VWBA 3MCAB 1YITN 1DEJA 3KWIA 5FPDA 3Q7BA 5JVHL 2QA4N 3EO3A 3DAWA 1K8KA 4ISEA 3G4SN 3MN6A 5BRDA 5BRFA 2P9UA 1RDUA 1T44A 3A5LC 4I6MA 3TSUA 3DWLA 3VERA 3DLLL 3TTDA 4IXCA 3RSEB 5AQZA 1HPMA 2Q0RA 3WXIA 3ZEUA 1YJ9N 4BRMA 4CZJA 4B1VA 1VQON 1DGKN 1NGDA 2HF3A 2Q97A 4WQ5C 4C1NK 3KC6A 3HTVA 3CCVN 3CJAA 3R3LA 2RHKA 3SMSA 2IVNA 1MA9B 5M1OA 5M1QA 5AQTA 2P9SB 3VF4A 3WEEB 3WEEA 3QB0A 2YJFA 1E4FT 4FWMA 4BRKA 3QBXA 3UE5A 1T3VA 3NVKA 4GNIA 3BUZB 3C0BA 3PIOL 5JMVA 3KZBA 1C0GA 3HOSA 4BGBA 3O08A 4ILJA 1Q81O 1VQ8N 2P9PA 1GLJO 1E4GT 3O9TA 3OW2M 2F9TA 5C2FA 5AZJB 3PIPL 3LM2A 4BRFA 3CCSN 5M1PA 2YCHA 2F9WA 3QFPA 4IZ9A 1DT9A 3BF3A 3WXKA 4BEBA 1JCEA 4UADE 1NMDA 2VYPA 4JD2A 4LC9B 1VQKN 3ATUA 3E9OA 5F2RA 4FWOA 1P90A 5FPEA 3UKUB 1RFQA 3CERA 5GAEP 1XQSC 4CBWA 3D2EB 1NGHA 1Z6RA 1GLDG 3CQXA 3AARA 3DXKB 4WFAL 1C0FA 4GV6A 3VENA 1TUUA 3E9PA 1NGIA 2GWJA 4BR9A 3O1BA 5C12A 1Q86O 3CD6N 2NRWA 5KQDA 1NLVA 2Q36A 2C1IA 2PBDA 4BQLA 5BPMA 4M63C 3U8XA 4A61A 2YIPA 4BRLA 4BRDA 3IDHA 4BQZA 5GIOA 1YUWA 3BP8A 4JKFA 4OO1J 2C1GA 4H5NA 3A5OC 4A57A 4MO5A 1TYQB 4FWSA 4BRNA 3CCRN 2YILA 4IDHA 5AQSA 5BR9A 3ZETB 4FL9A 2A40A 2HSTA 5GINA 3D2FA 4FVUA 1DKGD 3WXMB 2BH1A 3D7EO 4RTFD 1BA0A 2QWMA 1BO5O 1HKBA 3LDPA 3IKMA 4U67L 3D2FB 4YDUC 1ZXOA 3O9SA 4BR7A 1X3MA 3VTHA 2P9LA 3AGRA 2P9SA 3CCJN 2FF6A 3DXMA 1YJWN 2BTFA 1U6ZA 3FZKA 2QXLA 2V7YA 3ULEB 3VTIA 2ZWHA 1NGFA 4JKDA 4C23A 3P38A 3UKRB 3FLCO 4CZIA 1Y64A 3MN7A 2YHXA 5DM7L 3VEVA 3O9QA 3CQYA 2WFBA 3EE8A 3I56N 3OA9A 3G6EN 5AZJA 3CJBA 2P9PB 3CCEN 2GELA 3E66A 4A2BA 2VGNA 2P9KB 4ILHA 2P9NA 4FWRA 2JWKA 1K8KB 2A5XA 2HBJA 3AGKA 3VPZA 1Q7YO 1VQNN 4Z94A 3O8MA 3EN9A 1CZAN 1GLCG 3MDQA 3NVMA 2ZGYA 3VEZA 4K41A 4B1XB 1JCGA 4BC5A 2W40A 3TPQA 1J6ZA 4BRIA 1ILYA 3I55N 5BPLA 3W0LA 3ATVA 2YIOA 3EKSA 4CZHA 2QWRA 2ITMA 5GAGP 2A3ZA 2Q2RA 3JS6A 4A2AA 3M1FA 5AQYA 1O13A 4JEPA 4OPAA 3C65A 1K9MO 4JKCA 1Q18A 1JCFA 1LOTB 4QS8A 3GDQA 1RGIA 2NRTA 3L4QA 3T69A 3VGMA 3MK6A 3F2KA 3OHRA 3MN9A 2QI2A 3FZFA 1XUPO 3SAFA 3SAGA 2HBMA 1U2VA 4H0TB 1BU6O 4BC3A 4WFBL 4EAHD 3U4LA 4IOCL 1IG8A 1BG3A 5AZIB 2P9NB 2ZF5O 1MWMA 4AM6A 5AQQA 3ZEUB 4CZGA 4FWKA 4JHDA 4BR2A 1M1KO 3CCUN 2FLOA 3L0QA 4H5RA 1IJJA 1NM1A 4JKGA 3H1VX 4A5AA 3ULEA 3DXMB 3CC4N 3H45C 3TU5A 4BVPA 2I7NA 4PKIA 2QTDA 4XH1A 2QM1A 3TSPA 3VMFB 2E2FA 2YHYA 3C6AA 3D6RA 3BF1A 3ID6A 4BY9C 3JXUA 2YI1A 3O6WA 2GTDA 2PFUA 4UAEF 4O8UA 2GWKA 3KHWA 1QZ6A 2E1YA 5AQFA 4KBOA 5AQOA 4M7YA 1NBWA 3VESA 1N8RO 1VQ6N 1TYQA 2E88A 2GEMA 4IO9L 2OTLN 5LJVA 2HBKA 1KAZA 2E2OA 3F5TA 4C1NI 1YAGA 4B1ZA 1JJ2M 4QS9A 2ASMA 2KHOA 2FXUA 4H0VB 3TSQA 3J8AA 4F9OA 2H3GX 4BC2A 4KH5A 2Q31A 4WFNL 5BN8A 5I9EB 3HOTA 5JVGL 3M3ZA 4MLEA 3WT0A 4CBUA 5F0XA 4MLHA 4L3QA 5C10A 2CH5A 5E26A 2QWNA 3C7NB 2E2PA 5AQVA 1P8ZA 2P9IA 3O9UA 3S41A 4U7BA 2MN5A 3LDOA 4WYBA 1S22A 1V4TA 4DHYA 4IO8A 3DXKA 2MBKA 5AQNA 5AQGA 4FO0A 4B1WB 3BK3C 4BRPA 5EVZA 4JKEA 2KLAA 5F1XA 3L4IA 2D4WA 3NMUA 5AQHA 5AQKA 5KPZA 3SBTA 3WQUA 4CJ7A 1ATSA 4B1YB 4FSVA 5AQLA 2W41A 4BREA 3LDLA 4BRAA 5C15A 1QQOA 1HKGA 3P39A 4JKGB 3TTFA 2NNWA 4FWPA 4K43A 4GY2B 1R59O 4JK7A 3M6GA 2I7PA 2P9UB 4K42A 1W97L 3CW4A 3HRGA 3O5BA 2NLXA 3FFKB 4K25A 3VETA 2ZJRL 4IEEA 1KAYA 4ISFA 3LM9A 2UYTA 3A5MC 4YDUA 4BR5A 3KWGA 3MX5A 4CZKA 3VOVA 2QWQA 3MN5A 5C0YA 4YOUA 5DM6L 2YX6A 3ZX0A 4JKAA 4JKHA 3KVGA 3E9LA 2CGJA 4EFHA 5LY3A 1NGEA 4NLCA 1QVFM 2PAVA 5GIPA 3R2VA 2A6AA 4FWLA 3CMEN 2D1KA 5EY4A 3SAHA 2V52B 2J4RA 5KPRA 3W3DA 4XJXA 2NRVA 4YOWA 3P4IA 5BREA 3T7ZA 4QS7A 5HL7L 3FGUA 2Q0UA 3RVCA 4B1UB 4JK8A 4AM7A 4YOXA 3AY9A 1BA1A 4BRQA 4HTLA 2D0PA 3QDKA 3CMAN 5JLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI A;  3C7N A;  3EKU A;  3KHY A;  1H1V A;  3H3N O;  4PKH A;  1NWK A;  4FOI A;  4CI6 A;  3UB5 A;  4ISG A;  5AFU H;  2ASO A;  2E2N A;  2ZGZ A;  3SMP A;  3HM8 A;  1NGG A;  1GLA G;  1WUA A;  2BUP A;  3FE1 A;  3G25 A;  2HF4 A;  4PL7 A;  1SQK A;  1LCU A;  3WUH A;  5BPN A;  3QFU A;  4CZF A;  5B8H A;  4B9Q A;  3LL3 A;  3VGL A;  2AP1 A;  3LDQ A;  2AA4 A;  3GBT A;  2QWL A;  2OAN A;  3ENH A;  3VEW A;  5JLF A;  4PKG A;  2GUP A;  4IJN A;  1S3X A;  1KXP A;  2E8A A;  3A8Y A;  3VEO A;  2P9K A;  1XC3 A;  1ATR A;  1NGJ A;  4BR0 A;  3GE1 A;  1GLL O;  2CGK A;  1HX1 A;  4WQ5 A;  3GL1 A;  1QQM A;  2FF3 B;  3FZM A;  2E2Q A;  5AQP A;  3BEX A;  4BRG A;  2V51 B;  4O8K A;  4DCH A;  1V4S A;  3H1Q A;  5AQM A;  1QZ5 A;  2QW9 A;  4H0O A;  4PL8 A;  1HLU A;  4H5T A;  2Q1N A;  3I8B A;  1GLB G;  4M7X A;  1GLF O;  5BRH A;  5AR0 A;  4JN4 A;  1Z05 A;  4BRC A;  3WQT A;  3MMV A;  1MDU B;  4JNE A;  3CHW A;  3R6M A;  5AFU A;  3ID8 A;  3HBT A;  1D4X A;  2E1Z A;  1NGB A;  3CET A;  4NB4 A;  2E20 A;  2HMP A;  3CJ9 A;  5FPN A;  3O1W A;  3SJH A;  4H0X B;  4JHD B;  5KPT A;  2EWS A;  1ATN A;  3FZL A;  4NO7 A;  1G99 A;  3RSE A;  1BOT O;  1ESV A;  3I33 A;  3IUC A;  3L6Q A;  3CI5 A;  3FR0 A;  3HSC A;  1HUX A;  3FZH A;  4CZE A;  4H0P A;  3MCP A;  4BG8 A;  5AQI A;  3AAQ A;  3O4W A;  4BGA A;  2IIR A;  4BC4 A;  4H5W A;  5E84 A;  4EIA A;  1HJO A;  3CJ7 A;  4WQ4 A;  3GG4 A;  5ADX H;  4O5F A;  1YXQ A;  1NGC A;  3HZ6 A;  2HOE A;  4H03 B;  4BR4 A;  1ZC6 A;  4I6M B;  4FPA A;  5TKY A;  3DJC A;  5AQX A;  3A5N C;  2QWO A;  3F9M A;  5EOY A;  5AZI A;  5AQW A;  2NZT A;  3QBW A;  4BRH A;  2D0O A;  2CGL A;  4CZL A;  1WOQ A;  5EXW A;  4XH4 A;  2IVP A;  3EZW A;  2P9L B;  4RCH A;  3VEX A;  1GLE G;  3IMX A;  4FWN A;  1QQN A;  1TUY A;  4CD3 A;  3H46 O;  2V7Z A;  2P9I B;  5AQJ A;  3B8A X;  3SLC A;  4FOE A;  4IJA A;  4BG9 A;  2FSN A;  3H3O B;  3SK3 A;  3VF6 A;  4CZM A;  3CIP A;  2YHW A;  4BVO A;  3QML A;  4JAX A;  3O80 A;  3ENO A;  2FSJ A;  4FWQ A;  4IWV A;  1ZBS A;  1T6C A;  4A62 A;  4H5V A;  4XEI A;  2QWP A;  1YVN A;  3IFR A;  3WXJ A;  4DQ8 A;  2A41 A;  2NRH A;  2VCP A;  1NGA A;  3CJC A;  5LJW A;  1SAZ A;  2FSK A;  1HKC A;  3HI0 A;  4Y0W A;  5CE3 A;  3D2E A;  4BRO A;  1KAX A;  3U9D A;  4XH5 A;  1RDW X;  1T6D A;  3VEY A;  4DB3 A;  3QIC A;  2A42 A;  3UKR A;  3R9P A;  4E1J A;  1MWK A;  3VGK A;  3WXL A;  4RWT A;  3LDN A;  4CD1 A;  4WQ4 C;  5EX5 A;  3ZX3 A;  1OKJ A;  3CJ1 A;  4CBX A;  3VF2 A;  1U2V B;  1EQY A;  1X3N A;  2DPN A;  4J8F A;  3UKU A;  3ZET A;  4EHU A;  1BDG A;  3R8E A;  2ASP A;  1BWF O;  4JD2 B;  2WUS A;  3EL2 A;  2IVO A;  5ADX A;  4MO4 A;  5AQR A;  4EHT A;  1BUP A;  3H6E A;  1SZ2 A;  5FPM A;  4H0Y B;  2CH6 A;  3ZX2 A;  3U9Z A;  3AAP A;  5JIC A;  5ELZ A;  1QHA A;  3A0I X;  2YJE A;  4FPB A;  5AQU A;  1X9J A;  3GOI A;  5KQ8 A;  5BN9 A;  2VWB A;  1DEJ A;  5FPD A;  3EO3 A;  3DAW A;  1K8K A;  4ISE A;  3MN6 A;  5BRD A;  5BRF A;  2P9U A;  3A5L C;  1T44 A;  3VER A;  4I6M A;  3DWL A;  4IXC A;  3RSE B;  5AQZ A;  1HPM A;  2Q0R A;  3WXI A;  3ZEU A;  4BRM A;  4CZJ A;  4B1V A;  1DGK N;  1NGD A;  2HF3 A;  2Q97 A;  4WQ5 C;  3HTV A;  3CJA A;  3SMS A;  2IVN A;  1MA9 B;  5AQT A;  2P9S B;  3VF4 A;  3WEE B;  3WEE A;  3QB0 A;  2YJF A;  1E4F T;  4FWM A;  4BRK A;  3QBX A;  3UE5 A;  4GNI A;  3BUZ B;  3C0B A;  5JMV A;  3KZB A;  1C0G A;  4BGB A;  3O08 A;  2P9P A;  1GLJ O;  1E4G T;  2F9T A;  5AZJ B;  3LM2 A;  4BRF A;  2YCH A;  2F9W A;  3QFP A;  4IZ9 A;  3BF3 A;  3WXK A;  1JCE A;  2VYP A;  1NMD A;  4JD2 A;  4LC9 B;  3ATU A;  5F2R A;  4FWO A;  5FPE A;  3UKU B;  1RFQ A;  3CER A;  1XQS C;  4CBW A;  3D2E B;  1NGH A;  1Z6R A;  1GLD G;  3CQX A;  3AAR A;  3DXK B;  1C0F A;  3VEN A;  1TUU A;  1NGI A;  2GWJ A;  4BR9 A;  3O1B A;  5KQD A;  1NLV A;  2Q36 A;  2PBD A;  4BQL A;  5BPM A;  4M63 C;  3U8X A;  4A61 A;  4BRL A;  4BRD A;  3IDH A;  4BQZ A;  1YUW A;  3BP8 A;  4H5N A;  3A5O C;  4MO5 A;  1TYQ B;  4FWS A;  4BRN A;  5BR9 A;  5AQS A;  3ZET B;  4FL9 A;  2A40 A;  3D2F A;  1DKG D;  3D7E O;  4RTF D;  1BA0 A;  2QWM A;  1BO5 O;  1HKB A;  3LDP A;  3D2F B;  4YDU C;  1ZXO A;  4BR7 A;  1X3M A;  2P9L A;  2P9S A;  2FF6 A;  3DXM A;  2BTF A;  1U6Z A;  3FZK A;  2QXL A;  2V7Y A;  3ULE B;  2ZWH A;  1NGF A;  4C23 A;  3UKR B;  3FLC O;  4CZI A;  1Y64 A;  3MN7 A;  2YHX A;  3VEV A;  3CQY A;  5AZJ A;  3CJB A;  2P9P B;  2GEL A;  4A2B A;  2P9K B;  2P9N A;  4FWR A;  3VPZ A;  1K8K B;  2A5X A;  4Z94 A;  3O8M A;  3EN9 A;  1CZA N;  1GLC G;  3MDQ A;  2ZGY A;  3VEZ A;  4K41 A;  4B1X B;  1JCG A;  4BC5 A;  2W40 A;  3TPQ A;  1J6Z A;  4BRI A;  5BPL A;  3W0L A;  3ATV A;  3EKS A;  4CZH A;  2QWR A;  2ITM A;  2A3Z A;  2Q2R A;  3JS6 A;  4A2A A;  3M1F A;  5AQY A;  1Q18 A;  1JCF A;  1LOT B;  4QS8 A;  3GDQ A;  1RGI A;  3VGM A;  3MK6 A;  3OHR A;  3MN9 A;  3FZF A;  1XUP O;  1U2V A;  4H0T B;  1BU6 O;  4BC3 A;  4EAH D;  3U4L A;  1IG8 A;  1BG3 A;  5AZI B;  2P9N B;  2ZF5 O;  1MWM A;  4AM6 A;  5AQQ A;  3ZEU B;  4CZG A;  4FWK A;  4JHD A;  4BR2 A;  2FLO A;  3L0Q A;  4H5R A;  1IJJ A;  1NM1 A;  3H1V X;  3ULE A;  3DXM B;  3H45 C;  3TU5 A;  4BVP A;  2I7N A;  4PKI A;  4XH1 A;  2QM1 A;  2YHY A;  3BF1 A;  3JXU A;  2YI1 A;  3O6W A;  2GTD A;  2GWK A;  2E1Y A;  1QZ6 A;  5AQF A;  4KBO A;  5AQO A;  4M7Y A;  1NBW A;  3VES A;  1TYQ A;  2E88 A;  2GEM A;  5LJV A;  1KAZ A;  2E2O A;  1YAG A;  4B1Z A;  4QS9 A;  2ASM A;  2KHO A;  2FXU A;  4H0V B;  3J8A A;  4F9O A;  2H3G X;  4BC2 A;  2Q31 A;  5BN8 A;  5I9E B;  3M3Z A;  4MLE A;  3WT0 A;  4CBU A;  5F0X A;  4MLH A;  4L3Q A;  2CH5 A;  5E26 A;  2QWN A;  3C7N B;  2E2P A;  5AQV A;  1P8Z A;  2P9I A;  3S41 A;  3LDO A;  4WYB A;  1S22 A;  1V4T A;  4DHY A;  4IO8 A;  3DXK A;  5AQG A;  5AQN A;  4FO0 A;  4B1W B;  4BRP A;  5EVZ A;  2D4W A;  5F1X A;  3L4I A;  5AQH A;  5AQK A;  5KPZ A;  3WQU A;  4CJ7 A;  1ATS A;  4B1Y B;  4FSV A;  5AQL A;  2W41 A;  4BRE A;  3LDL A;  4BRA A;  1QQO A;  1HKG A;  4FWP A;  4K43 A;  4GY2 B;  1R59 O;  3M6G A;  2I7P A;  2P9U B;  4K42 A;  3O5B A;  3VET A;  2NLX A;  3FFK B;  4K25 A;  1KAY A;  4ISF A;  3LM9 A;  2UYT A;  3A5M C;  4YDU A;  4BR5 A;  4CZK A;  3VOV A;  2QWQ A;  3MN5 A;  3ZX0 A;  3KVG A;  2CGJ A;  4EFH A;  5LY3 A;  1NGE A;  2PAV A;  2A6A A;  4FWL A;  2D1K A;  5EY4 A;  2V52 B;  2J4R A;  5KPR A;  3W3D A;  3P4I A;  5BRE A;  4QS7 A;  3FGU A;  2Q0U A;  4B1U B;  4AM7 A;  3AY9 A;  1BA1 A;  4BRQ A;  4HTL A;  2D0P A;  3QDK A;  5JLH A; 
#chains in the Genus database with same CATH topology
 4HWI A;  4JI6 K;  3QNO A;  3OYE A;  4CI6 A;  4BE2 A;  2K35 A;  1NWK A;  4WCE L;  2ZGZ A;  2E2N A;  3SMP A;  1JLF A;  3AVF A;  3G25 A;  3P5J A;  1C56 A;  3TWH A;  4WF9 L;  1SQK A;  1LCU A;  2ZD1 A;  5BPN A;  5B8H A;  1RT1 A;  2VGM A;  3AA4 A;  4KH6 A;  4KB0 A;  3LDQ A;  3TAQ A;  4DS5 A;  1JLG A;  4DV5 K;  1IBM K;  1Q82 O;  3VEO A;  4GVM A;  1TAU A;  1K73 O;  1ATR A;  4CJE A;  4DV4 K;  1BIU A;  3LWM A;  1GLL O;  2IDO A;  4WQ5 A;  2NRR A;  1QQM A;  2FF3 B;  2E2Q A;  2KFN A;  4CF8 A;  1DTQ A;  1LWF A;  4BRG A;  1U45 A;  1CZ9 A;  3H1Q A;  2RF2 A;  3J81 O;  1QZ5 A;  4W5T A;  2DTU A;  2E5L K;  5C2D A;  3KIO A;  4H0O A;  1HLU A;  4PL8 A;  2QK9 A;  4R79 A;  5CHI A;  3E1Y A;  4IOX A;  1ZVG A;  4OLA A;  1I2U A;  2G8K A;  4M7X A;  1VQ5 N;  3OYB A;  4G9Z A;  5TKW A;  3AV9 A;  5HBM A;  4KHQ A;  2KBK A;  3CHW A;  5AFU A;  2OPS A;  1KVC A;  1IKX A;  3HK2 A;  1ASV A;  1D4X A;  4NB4 A;  4Z0U A;  2E20 A;  3CJ9 A;  4OPJ A;  5LMN K;  1NG9 A;  3FZL A;  2RKI A;  3QI7 A;  1M90 O;  3R1X A;  3LDS A;  4G1Q A;  1ESV A;  3I33 A;  1NK0 A;  3PX0 A;  3CI5 A;  3DLG A;  3HSC A;  2XO7 A;  4MDA A;  4E7J A;  2FC0 A;  3KLH A;  3KOY A;  4E7H A;  4BGA A;  4FJG A;  4BC4 A;  4CGF A;  1HJO A;  3CJ7 A;  4O5F A;  1TK5 A;  4BE0 A;  3KK7 A;  2OPQ A;  4WE1 A;  5DMR A;  5TKY A;  2QWO A;  5AQW A;  2HND A;  4BRH A;  4AEI A;  1SS6 A;  4Z4F A;  2OYQ A;  2GMO A;  4CZL A;  2P9L B;  4RCH A;  3WNF A;  1TGO A;  3IMX A;  1QQN A;  1RT7 A;  2P9I B;  1I39 A;  3B8A X;  4X64 K;  3U3Y A;  1Z26 A;  3UIQ A;  3H3O B;  5I42 A;  3HT3 A;  4GMJ B;  3VQ9 A;  3E7R L;  4QAG A;  3QML A;  2I5J A;  3M5R A;  3NFA A;  1ZVE A;  5M1F A;  1EO1 A;  2KW4 A;  2QKK A;  4H5V A;  3NGZ A;  4LH4 A;  4PA1 A;  2RE2 A;  4DQ8 A;  3K9K A;  2A41 A;  1BHL A;  2NRH A;  1SKW A;  3KJV A;  3O9R A;  1YTU A;  1SAZ A;  2JDQ D;  3HI0 A;  3DLE A;  2VY6 A;  4BRO A;  1N33 K;  1KAX A;  1SN1 A;  3ULD A;  3G0Z A;  3V1Q A;  2VWJ A;  4N5S A;  4XH5 A;  4OKK A;  4AHS A;  1T7A A;  1Q8I A;  5J2Q A;  2A42 A;  3UKR A;  1SL2 A;  3VGK A;  3NF9 A;  4E3S A;  4FJ5 A;  3LDN A;  2RN2 A;  4MQ3 A;  3QO9 A;  4CD1 A;  3ZX3 A;  3VF2 A;  1U2V B;  3JSM A;  4J8F A;  3UKU A;  4N41 A;  4OGC A;  3R8E A;  1TKX A;  4JV5 K;  2WUS A;  3EL2 A;  1EX4 A;  1W7A A;  4EHT A;  3PV8 A;  3AA3 A;  3OYL A;  4H0Y B;  3TAE A;  3ZX2 A;  3IRX A;  5HOO A;  5JIC A;  2A7T A;  4B3S K;  5H1S Q;  3L56 A;  3V9U A;  4KKO A;  1VHX A;  4DSL A;  2YEO A;  4CGJ A;  4BDZ A;  3GOI A;  1FJG K;  2VWB A;  2LN8 A;  3MCA B;  2B4J A;  1DEJ A;  3KWI A;  1CXQ A;  1K8K A;  3CFR A;  3ZT3 A;  3MN6 A;  1Y97 A;  1RDU A;  3VER A;  2G8V A;  1UA0 A;  4LD0 A;  3TTD A;  4IXC A;  3RSE B;  4KPY A;  1HPM A;  1QSY A;  4CZJ A;  4B1V A;  1NGD A;  2LR3 A;  4JRQ A;  4C1N K;  3HTV A;  4O0I A;  1EWQ A;  1WSI A;  3R3L A;  2RHK A;  5M1O A;  3SQ0 A;  4CER A;  2X78 A;  3OTO K;  5JS1 A;  2YJF A;  1E4F T;  4BRK A;  2HNY A;  2IS3 A;  2YV0 X;  1LWC A;  3BUZ B;  3KLF A;  4BGB A;  3O08 A;  4ILJ A;  2P9P A;  3OYK A;  1E4G T;  3VQ8 A;  1HMV A;  4CJR A;  3QFP A;  4NXM K;  3AVJ A;  4CJ4 A;  4JD2 A;  3ATU A;  3ISN C;  1L3S A;  1P90 A;  5FLX O;  3IS9 A;  2KPY A;  3ZCM A;  2GL1 A;  2PYJ A;  3D2E B;  2HMI A;  3LZI A;  3DXK B;  4WFA L;  1C0F A;  1BMR A;  1RT2 A;  4DTX A;  1ZYQ A;  1NGI A;  1Q86 O;  4FK0 A;  4I2Q A;  4BQZ A;  3M8S A;  2C1G A;  1TYQ B;  1S9G A;  4XIU A;  1U4B A;  3OYC A;  1XHX A;  3C6T A;  3L2V A;  1L5U A;  4M3R A;  3RMC A;  3D2F A;  1DKG D;  3HVR A;  3P83 D;  3SPY A;  1HKB A;  2E3F A;  4YDU C;  4CIE A;  1NJW A;  4B9U A;  3SUQ A;  1SNB A;  2KBH A;  3DXM A;  4MFB A;  2BTF A;  1U6Z A;  3FZK A;  1NRA A;  2F8T A;  3P38 A;  4CEC A;  3C94 A;  2Y1J A;  4FJJ A;  2HB5 A;  3I56 N;  3CJB A;  4ELT A;  4RW7 A;  1SKS A;  4ILH A;  2P9N A;  1VNA A;  2JWK A;  3VPZ A;  3AGK A;  4DTO A;  2N69 A;  1VQN N;  3O8M A;  4FK2 A;  1CZA N;  2A1R A;  3VEZ A;  1JCG A;  1LAW A;  2X6N A;  1T03 A;  4CE9 A;  1RBT A;  4KRF A;  2X74 A;  2Q2R A;  3OJS A;  1O13 A;  1KSP A;  3KK2 A;  4FJ8 A;  4R5P A;  4JKC A;  1JCF A;  1RDD A;  3AVA A;  4QS8 A;  3VQC A;  4CGH A;  4YY3 K;  3T69 A;  3VGM A;  1Q9Y A;  3OHR A;  3MN9 A;  1NJZ A;  4C8N A;  3SAG A;  4H0T B;  2YC1 C;  2YKN A;  4IOC L;  5AZI B;  2P9N B;  3M8P A;  2ZF5 O;  3BY5 A;  4CZG A;  1M1K O;  3K2P A;  2SN3 A;  2FLO A;  4H5R A;  4JKG A;  5KGW A;  3DXM B;  3CC4 N;  3H45 C;  3TU5 A;  2I7N A;  3TSP A;  1A5W A;  3ID6 A;  3C6A A;  3BF1 A;  1TVR A;  4E1N A;  1VK0 A;  2PFU A;  1E3M A;  4UAE F;  2DFF A;  2E1Y A;  4I9L A;  4KBO A;  1C0M A;  4RW6 A;  4DQQ A;  4CJ5 A;  1NBW A;  3VES A;  1TYQ A;  5LJV A;  5AJ3 K;  1JJ2 M;  4FJK A;  1UOC A;  2ASM A;  4H0V B;  3MEE A;  3TSQ A;  3ASM A;  1K6Y A;  4KH5 A;  1RTH A;  1KLN A;  5I9E B;  4DFK A;  3M3Z A;  3T19 A;  3WT0 A;  4B3O A;  2CH5 A;  4LF6 K;  3K5M A;  3LDO A;  4J2E A;  1S6Q A;  4WYB A;  4KAZ A;  3DXK A;  2MBK A;  5AQN A;  1A5V A;  5EVZ A;  1LQQ A;  4B8A B;  3NMU A;  5AQK A;  3DOL A;  5KPZ A;  2HVI A;  3KD5 E;  1I94 K;  1IBK K;  4CHO A;  4TSX A;  4Q5V A;  1ATS A;  5AQL A;  3QEW A;  4BRE A;  3LDL A;  4DTP A;  4BRA A;  3SV4 A;  1QQO A;  4FWP A;  4K43 A;  1NK4 A;  3QIP A;  2I7P A;  1IKY A;  4K42 A;  3HP6 A;  4PUO A;  3FFK B;  3KP0 A;  4ISF A;  1OMY A;  3LM9 A;  4BR5 A;  4CF2 A;  1WLJ A;  2GV9 A;  4CZK A;  3VOV A;  4IBN A;  1GOC A;  1JLA A;  1NK8 A;  4C8L A;  2G8H A;  5DM6 L;  4OPK A;  4CJF A;  1KV0 A;  4LF8 K;  4DR6 K;  4JKA A;  4JKH A;  2B3C A;  4N56 A;  3E9L A;  3QIN A;  3CFO A;  2CGJ A;  2NY9 X;  2OZM A;  3RR8 A;  1NGE A;  4CK1 A;  1NE5 A;  1QVF M;  2PAV A;  2O4G A;  2V52 B;  4YOW A;  3DRS A;  4CJU A;  4QS7 A;  3NHG A;  3TR8 A;  2O4I A;  1UGL A;  1BA1 A;  5C42 A;  3THW A;  3HYF A;  4BEC A;  5HRS A;  3QDK A;  3C7N A;  4HHF A;  1H1V A;  3H3N O;  4PKH A;  3UB5 A;  1L3U A;  5AFU H;  5J2M A;  3HM8 A;  1JZA A;  3THX A;  1GLA G;  1WUA A;  2BUP A;  3FE1 A;  1W2B M;  3T1H K;  3WUH A;  1VQL N;  3QFU A;  3HXM A;  3GBT A;  3U3G A;  1BCM A;  4A59 A;  3PLA A;  3OJU A;  2WTU A;  5CY0 A;  5JLF A;  1HYS A;  2GUP A;  2WC9 A;  4OKJ A;  4AF1 A;  4CED A;  1NOY A;  3SCX A;  4BR0 A;  4B9N A;  3TAN A;  4JI4 K;  4AIL C;  3G71 N;  5J1E A;  3GL1 A;  4RW4 A;  3SYZ A;  4LF5 K;  1RDB A;  1S1U A;  1R0A A;  1OH5 A;  1HNV A;  1EKE A;  4PHT X;  3BEX A;  4O8K A;  1VSE A;  4FLU A;  1RTD A;  3K5O A;  3KLI A;  1JLQ A;  2ZJP L;  3K5N A;  5BR8 K;  2OPR A;  1NKC A;  3LP0 A;  2Q1N A;  3I8B A;  1GLF O;  4GV9 A;  2O8C B;  4JN4 A;  4I2P A;  1Z05 A;  1I3A A;  3WQT A;  2WBN A;  3DLK A;  1MDU B;  4JNE A;  2JLE A;  4E72 A;  3IG1 A;  4O5B A;  3CF5 L;  2E1Z A;  2HMP A;  5CYM A;  3CCQ N;  4LSL A;  4H0X B;  4UY8 O;  3MWP A;  2EWS A;  1ATN A;  3DM2 A;  5KTQ A;  4CEF A;  1VAZ A;  1SUQ A;  1G15 A;  1NJX A;  3HO1 A;  1KC8 O;  1ASW A;  3L2U A;  1HUX A;  1VRT A;  3KKR A;  3HPH A;  4CQK A;  3MCP A;  3QET A;  1IG9 A;  3O4W A;  3P31 A;  4LSN A;  1OH6 A;  3J7A P;  1DQ7 A;  3DLR A;  3C6H A;  4KTW A;  3VQ6 A;  3DMJ A;  4WQ4 A;  3GG4 A;  5IWA K;  1NJI O;  4JS4 A;  3LPT A;  1ZBH A;  3RWU A;  4OVL A;  3ZSY A;  1WB9 A;  4I6M B;  4JK9 A;  4AHT A;  1OH7 A;  5CYQ A;  2OCE A;  4M3W A;  4AAZ A;  5GAH P;  1VSL A;  3DI6 A;  2CGL A;  1WOQ A;  2LT8 A;  4UAF E;  2HHU A;  3EZW A;  1GPS A;  3VEX A;  1GLE G;  4CD3 A;  4NCB A;  2E4L A;  1S5J A;  2V7Z A;  4LFC K;  5AQJ A;  1FK9 A;  1YJN N;  4B9S A;  4CHZ A;  4IJA A;  2F4V K;  1S72 N;  3KP1 A;  5JEN A;  4CZM A;  3CIP A;  4Z4H A;  4DQP A;  4O55 A;  4DS4 A;  3N4P A;  4IWV A;  4OLB A;  4A62 A;  1YVN A;  3MXI A;  3WXJ A;  3ZSX A;  1ZBF A;  4IFY A;  4QOZ B;  3AA2 A;  3CJC A;  5LJW A;  3V9S A;  1B7D A;  1HKC A;  4JI8 K;  5CE3 A;  1VSF A;  4CEB A;  1BRZ A;  2ASC A;  1LW2 A;  4M41 A;  4E1J A;  5CR4 A;  1VQP N;  1T0Z A;  1KLM A;  5EX5 A;  1JLE A;  3ZSR A;  3HJF A;  3OYJ A;  3TAF A;  1IKV A;  1T7B A;  2W00 A;  3CC7 N;  3E01 A;  2N2R A;  4M42 A;  1JXE A;  1EQY A;  3KLE A;  1HNX K;  2ZE2 A;  2JWL A;  4ILG B;  2LI7 A;  2P5G A;  2RPI A;  2VWK A;  1VSJ A;  2IVO A;  4MO4 A;  3CFP A;  1KTQ A;  1BUP A;  3QEX A;  3H6E A;  3VQQ A;  4F2R A;  5FPM A;  2LKB A;  4DSI A;  5FRO A;  3TAM A;  1S1V A;  4RW9 A;  1EP4 A;  4CFD A;  3ZSV A;  1OVY A;  1XI1 A;  5HP1 A;  5LL6 Z;  1RBU A;  1XWL A;  1J9A A;  3A0I X;  3LZJ A;  2YNI A;  3VQE A;  4B3R K;  1YI2 N;  4MDB A;  2P1J A;  5KQ8 A;  5BN9 A;  3Q7B A;  1WSJ A;  1T05 A;  4JI3 K;  3EO3 A;  2XHB A;  3NBP A;  4JYA K;  2O8E A;  3G4S N;  3NF7 A;  2P9U A;  3DWL A;  4FJL A;  3I0S A;  4H4O A;  4Z4I A;  3CJA A;  2KBJ A;  3SMS A;  3WEE B;  2P9S B;  4W5O A;  2B68 A;  3A2F A;  1SN4 A;  3UE5 A;  1T3V A;  1NMN A;  4CHN A;  4AH9 A;  4FM1 A;  4LF4 K;  3P1G A;  4ZHR A;  3KZB A;  5C25 A;  1C0G A;  2F9T A;  3PIP L;  5AZJ B;  3CCS N;  4KHS A;  3ZSW A;  4IZ9 A;  1JCE A;  3PX6 A;  5FPE A;  1RFQ A;  4DSF A;  4CBW A;  1Z6R A;  4LY7 A;  1QTM A;  3AAR A;  2G8I A;  1N32 K;  1X9S A;  4BR9 A;  5KGX A;  1LAV A;  5C12 A;  2NRW A;  3VQ7 A;  4FLZ A;  2PY5 A;  1FH3 A;  5BPM A;  4HVJ A;  4JI7 K;  2O8B B;  4M63 C;  4BRL A;  4A61 A;  2YIP A;  5CZ2 A;  4JI2 K;  3IDH A;  5GIO A;  5HRR A;  4JKF A;  4HTU A;  5AQS A;  4KO0 A;  5GIN A;  3EZ5 A;  4U67 L;  3D2F B;  2P51 A;  1X3M A;  3VTH A;  5JS2 A;  3PSM A;  3ZSQ A;  3AGR A;  2P9S A;  2VQE K;  4IDK A;  1C55 A;  1VQO N;  3VTI A;  3VQA A;  1J5O A;  1HQU A;  3FLC O;  1HQE A;  4CZI A;  4KHN A;  1LQH A;  4FJI A;  3VEV A;  4M3Y A;  3CQY A;  1K8B A;  4L8R B;  1S1T A;  3E66 A;  3WNE A;  3OYN A;  3BGR A;  1Q7Y O;  3QES A;  4Z94 A;  4CEE A;  4CIG A;  1SL1 A;  2YHA A;  4DR7 K;  2W40 A;  1ASU A;  3KK1 A;  2IC3 A;  3HVT A;  3ATV A;  2YIO A;  1QE1 A;  4CZH A;  2ITM A;  5GAG P;  1SL0 A;  2A3Z A;  3M1F A;  4JEP A;  4OPA A;  4K0K K;  1K9M O;  3HL8 A;  1Q18 A;  1XMQ K;  3LPU A;  2NRT A;  1TKD A;  1S1X A;  2E3G A;  3LAN A;  3MK6 A;  2G2K A;  3ZLJ A;  4M45 A;  3RMB A;  3S3N A;  5C24 A;  1QHT A;  3FZF A;  1TK0 A;  1XUP O;  4CFA A;  1N36 K;  4CF0 A;  1BG3 A;  1MWM A;  5AQQ A;  1BCG A;  3S5T A;  4FWK A;  4JHD A;  3PSI A;  3L0Q A;  2BRZ A;  3AVB A;  3H1V X;  1D5A A;  4A5A A;  3ULE A;  1WAJ A;  4AB0 A;  3K57 A;  4J2B A;  1FKP A;  2QTD A;  2Z1I A;  4XH1 A;  3ZT4 A;  3V9Z A;  3VMF B;  4ZTJ A;  1TL3 A;  2YI1 A;  2YNH A;  3O6W A;  1T8E A;  3THV A;  4O8U A;  1KCF A;  4CJ3 A;  5AQF A;  2W6K A;  3LAM A;  1C1B A;  4DUY K;  4M3Z A;  3K5L A;  1S6P A;  3PO5 A;  2UUA K;  1REV A;  1KAZ A;  2E2O A;  3F5T A;  1B9D A;  1D9D A;  4BAC A;  4F9O A;  2H3G X;  4BC2 A;  4E7I A;  5BN8 A;  3OS1 A;  4MLE A;  5C10 A;  3ZYY X;  5E26 A;  1NH5 A;  3C7N B;  4U7B A;  3DLB A;  2MN5 A;  3CM5 A;  1C0U A;  3RTV A;  3AVM A;  1I6G A;  1XNR K;  3BK3 C;  1I6F A;  4BE1 A;  2D4W A;  5F1X A;  4E89 A;  1JXC A;  3SBT A;  1DTT A;  1QQC A;  4LFA K;  5I3U A;  1OZZ A;  4B1Y B;  4KI4 A;  1YVU A;  4EP4 A;  1VSI A;  1HKG A;  2NNW A;  1QSS A;  5SWM A;  1PE4 A;  3O5B A;  4K25 A;  3A5M C;  3KWG A;  3M8Q A;  3MN5 A;  1F21 A;  3T3F A;  4NCG A;  3EEQ A;  4DTJ A;  4DR3 K;  2IAJ A;  3KVG A;  4DU1 A;  3NGY A;  5KRT A;  5FRN A;  2VG7 A;  3ITH A;  3KKS A;  1MYN A;  3KD1 E;  3R2V A;  2A6A A;  4FWL A;  3W3D A;  1RT5 A;  4F2S A;  2NRV A;  2E6L A;  1WSG A;  2IGI A;  1C1C A;  4YOX A;  2D0A A;  4BRQ A;  4HTL A;  4IOA L;  3CMA N;  4X65 K;  4FLT A;  3EKU A;  3HP9 A;  3C6U A;  4HHT A;  4FOI A;  1KRP A;  1SEG A;  4ISG A;  1WSH A;  2ASO A;  2OPP A;  3B6O A;  1RTJ A;  4PL7 A;  3NE6 A;  1WN7 A;  1HPZ A;  4B9Q A;  3LL3 A;  1D8Y A;  2HHX A;  3VGL A;  3CPW M;  2AA4 A;  2O8B A;  4UJ0 A;  2OAN A;  3ENH A;  3V1O A;  2QXF A;  2UXB K;  3N4Q A;  2E8A A;  1EWR A;  3CG7 A;  5KRS A;  1EXQ A;  2P9K A;  2QEX N;  2XY7 A;  3GE1 A;  1HX1 A;  2BE2 A;  3CC2 N;  4DSJ A;  3FZM A;  4B8C A;  5AQP A;  1VQ4 N;  1KQS M;  1JLB A;  3EYZ A;  3O3F A;  1YHQ N;  2V51 B;  4DCH A;  1Q9X A;  1FKO A;  3THX B;  2QW9 A;  1WBB A;  4H5T A;  3L2W A;  1TAQ A;  2EHG A;  1RIL A;  3D45 A;  4CEQ A;  5BRH A;  1XRS B;  1WWN A;  3VA0 A;  1NJY A;  4B08 A;  2GBZ A;  1ZBU A;  3MMV A;  3Q7C A;  3CET A;  4DR5 K;  4DTN A;  5FPN A;  3CCL N;  4JHD B;  5KPT A;  1JKH A;  4NO7 A;  1G99 A;  1S9E A;  1N6Q A;  1TV6 A;  3ENB A;  4OJR A;  4OX9 K;  1BOT O;  4CW7 B;  3VA3 A;  4DV7 K;  4FJN A;  3L6Q A;  3BZK A;  2GX9 A;  2HBL A;  3FR0 A;  4KI6 A;  4B3T K;  5M1K A;  4CZE A;  3AAQ A;  1KVB A;  1BQN A;  1NKE A;  3QIO A;  4EIA A;  5ADX H;  4F8R A;  2W42 A;  3HZ6 A;  2HOE A;  4FZZ A;  4Q0B A;  2DY4 A;  1IKW A;  4CK3 A;  3SF4 D;  4FPA A;  3DJC A;  3A5N C;  3F9M A;  2F7T A;  1KD1 O;  4YOT A;  3PX4 A;  2NZT A;  3QBW A;  2D0B A;  3SBG A;  1NK7 A;  5EXW A;  4XH4 A;  2LJM A;  4O0J A;  4KTZ A;  4CF1 A;  4FWN A;  3TAB A;  2B6A A;  3PO4 A;  2LY6 A;  2FSN A;  3RR7 A;  3ZT2 A;  3NGI A;  3DLH A;  3SK3 A;  2YHW A;  2NUB A;  4NLB A;  2XRI A;  1D9F A;  1ZU3 A;  5A2Q O;  4DFJ A;  4DV0 K;  2Z1G A;  3RMA A;  1T6C A;  2KFZ A;  2HHS A;  1BIZ A;  2QWP A;  4CGG A;  2Q3S A;  2XY6 A;  4CF9 A;  1HYZ A;  3D2E A;  2FBV A;  3U9D A;  4JKB A;  1BI4 B;  1NK9 A;  1RDW X;  4DB3 A;  3OBW A;  3VQ5 A;  3R9P A;  1NU0 A;  2E0H A;  3WXL A;  4CES A;  2MZ0 A;  1PTX A;  1OKJ A;  3CJ1 A;  1UA1 A;  4CBX A;  3CXC M;  2YNG A;  2D56 A;  1X3N A;  3SUP A;  1BDG A;  2ASP A;  1BWF O;  4JD2 B;  3K9J A;  5ADX A;  4B9L A;  1NKB A;  1SZ2 A;  5KI6 A;  3B6P A;  1C0T A;  1K8A O;  1TI5 A;  2CH6 A;  3QEP A;  3U9Z A;  4HUE A;  2NRX A;  2F96 A;  1QVG M;  1QHA A;  1GOA A;  4DR2 K;  2YJE A;  4DWI A;  4YOY A;  1YF5 L;  3BZC A;  3AVG A;  3TI0 A;  1VQ7 N;  4V19 S;  5FPD A;  2O8F A;  2ITG A;  4ISE A;  3J7Y P;  2HHV A;  5BRD A;  1JZB A;  3A5L C;  3OYH A;  4I6M A;  3TSU A;  3RRH A;  4KTQ A;  1KFD A;  2XY5 A;  2E6M A;  3F9K A;  3V9X A;  3V4I A;  4J2D A;  2HF3 A;  3S3M A;  3CCV N;  1UWB A;  4DSK A;  4NYF A;  3SUO A;  2IVN A;  1MA9 B;  3VF4 A;  3WEE A;  4FWM A;  4BWM A;  2UXC K;  3O4Q A;  5IT9 O;  4GNI A;  3PIO L;  2VQF K;  1HNW K;  2LSN A;  1NRB A;  3O9T A;  1I2V A;  3LM2 A;  4C8O A;  5M1P A;  3THY B;  1NK5 A;  3I0R A;  2F9W A;  3E7U X;  3WXK A;  1WNS A;  2VYP A;  4UAD E;  1NMD A;  4CJL A;  4FXD A;  4N47 A;  5F2R A;  2KTQ A;  3KOX A;  4FWO A;  3JAM O;  1P00 A;  4CIF A;  3CER A;  3WNH A;  3NF8 A;  5GAE P;  1RDA A;  4OGE A;  2UU9 K;  1NGH A;  1C1A A;  1GLD G;  4LH5 A;  4GV6 A;  2I61 A;  3K58 A;  3E9P A;  3CD6 N;  3QLH A;  3AO2 A;  4H4M A;  2Z1H A;  2Q36 A;  3V9W A;  2C1I A;  2PBD A;  2OA8 A;  4KV8 A;  4BRD A;  5DK5 A;  4DF8 A;  4OO1 J;  1RNH A;  4H5N A;  4FM0 A;  3A5O C;  1BIS A;  2YIL A;  5BR9 A;  2UXD K;  4FL9 A;  3SZ2 A;  3JYT A;  4FVU A;  4J2A A;  2QWM A;  3IKM A;  3LDP A;  4AHU A;  1IV0 A;  3O9S A;  1LV5 A;  4CFB A;  4X66 K;  2FF6 A;  3EY1 A;  3ULE B;  2ZWH A;  1NGF A;  1JL2 A;  1IH7 A;  3MN7 A;  3G6E N;  1J53 A;  3OA9 A;  5AZJ A;  2LY5 A;  2P9P B;  4YNQ A;  3SNN A;  1RTI A;  3CCE N;  4KB1 A;  2NY8 X;  4A2B A;  2HNZ A;  1GOB A;  2P9K B;  4FWR A;  1K8K B;  2A5X A;  3F73 A;  3MXJ A;  3EN9 A;  3MDQ A;  4B1X B;  1HNI A;  2BAN A;  4BRI A;  3OS0 A;  4HCC A;  1ILY A;  3I55 N;  1B3C A;  4F3O A;  4CGD A;  3AVK A;  3W0L A;  4DG1 A;  2QWR A;  1ZBI A;  4A2A A;  3OS2 A;  3C65 A;  1LOT B;  1CZB A;  1FXX A;  3CM6 A;  3PY8 A;  4H8K A;  3LP3 A;  4W5N A;  1TL1 A;  3MEG A;  3F2K A;  4CJK A;  3SAF A;  1VSK A;  2HBM A;  1U2V A;  4CFC A;  1BU6 O;  4WFB L;  4FJX A;  5CY4 A;  3U4L A;  4AHR A;  3ZEU B;  3OYM A;  4B3M K;  4BR2 A;  1IJJ A;  3NCI A;  1WAF A;  4B9T A;  4PWD A;  1U49 A;  1X1P A;  4E19 A;  1SKR A;  4DV3 K;  4BVP A;  4PKI A;  3SQ2 A;  1T1T A;  3AVN A;  4CVN E;  2YHY A;  3D6R A;  3VQD A;  4BY9 C;  3JXU A;  2GWK A;  1QZ6 A;  4ZTF A;  4CHQ A;  3VN5 A;  2YKM A;  4EP5 A;  3HPO A;  2G8W A;  3L2Q A;  4Z4G A;  2YBR C;  4FLW A;  1VQ6 N;  4DLG A;  2E88 A;  2GEM A;  4IO9 L;  2OTL N;  2HBK A;  1S1W A;  1QSL A;  2ATQ A;  4B1Z A;  4QS9 A;  4KHW A;  4YFU A;  2FXU A;  3J8A A;  4WFN L;  4FJ9 A;  3QEV A;  1WSF A;  3HOT A;  4K8Z A;  5LMU K;  2X6S A;  4L3Q A;  4FJH A;  2P9I A;  3O9U A;  2XY8 A;  1L4V A;  1BGX T;  1S22 A;  1V4T A;  4IO8 A;  4JI5 K;  3D0P A;  4BRP A;  4B1W B;  4JKE A;  2KYQ A;  3LAL A;  3L4I A;  3AO5 A;  1FW6 A;  4YHH K;  3U6F A;  3WQU A;  3ZT0 A;  3MEC A;  4FVM A;  2W41 A;  3THY A;  3TTF A;  4FZX C;  1R59 O;  1JL1 A;  4RW8 A;  3THW B;  4M3X A;  1KAY A;  4YDU A;  2ETJ A;  2QWQ A;  4F3T A;  3SI6 A;  2ATB A;  4CK2 A;  1BQM A;  4UQG A;  1RCH A;  1IBL K;  4AQY K;  5GIP A;  1SV5 A;  1U04 A;  4JI0 K;  3SAH A;  2IOC A;  1A5X A;  2J4R A;  2EX3 A;  5KPR A;  4XJX A;  1ZFU A;  4F4K A;  3P4I A;  3SUN A;  5HL7 L;  2JGU A;  4Z4E A;  2Q0U A;  3RVC A;  4B1U B;  4AM7 A;  1NNE A;  3AY9 A;  1DLO A;  1ICA A;  5J2P A;  3KHY A;  3V81 A;  4OPH A;  2UUC K;  4IKF A;  3EE9 A;  4E1M A;  3TAP A;  1NGG A;  1DJT A;  1OH8 A;  3NH2 A;  2HF4 A;  3VQP A;  3M8R A;  4CZF A;  4LF7 K;  2KSK A;  2AP1 A;  3ZSO A;  2ZM6 K;  3MX2 A;  2QWL A;  1TK8 A;  2G8U A;  2GUI A;  3VEW A;  4PKG A;  1L3V A;  4IJN A;  4CHY A;  3LP2 A;  4QCL A;  4GKK K;  1S3X A;  1KXP A;  3A8Y A;  5M1N A;  3VQB A;  1WBD A;  1XC3 A;  1NGJ A;  1CXU A;  3CCM N;  4YOR A;  2CGK A;  1TKZ A;  1XNQ K;  3VQ4 A;  3AA5 X;  3KOW A;  2DFE A;  1ITG A;  4JLH A;  2KGQ A;  4E7L A;  1V4S A;  5D3G A;  5AQM A;  3I8D A;  2OTJ N;  4DV1 K;  4DF4 A;  1YIJ N;  3OYD A;  2W6L A;  3NH0 A;  3HPG A;  4W5Q A;  1CLQ A;  1GLB G;  3L8B A;  5AR0 A;  3WNG A;  1VNB A;  4BRC A;  4CGI A;  2BGG A;  2A1S A;  3TTC A;  3R6M A;  3ID8 A;  3HBT A;  3PSF A;  1NGB A;  2Y1I A;  3O1W A;  3SJH A;  4AHC A;  3S3O A;  4KH4 A;  1NPI A;  3SV3 A;  1YT3 A;  3RSE A;  4DUZ K;  3V1R A;  5FRM A;  3IUC A;  4ID1 A;  4Y1D A;  4HCB A;  1VQM N;  3FZH A;  4X62 K;  4H0P A;  4BG8 A;  5AQI A;  4NCA A;  1VSM A;  1O1W A;  2IIR A;  2D0C A;  3KTQ A;  4JI1 K;  4H5W A;  2R7Y A;  5E84 A;  2O8D B;  1YXQ A;  4DTS A;  1NGC A;  4I9Q A;  3OVN A;  4H03 B;  4BR4 A;  1ZC6 A;  2D5R A;  4GVE A;  1GPT A;  5MLC Q;  4DFP A;  4DSE A;  5AQX A;  5AZI A;  5EOY A;  2AJQ A;  3OYG A;  1RBS A;  2D0O A;  3AO3 A;  4FLY A;  4HE7 A;  2HHI A;  2IVP A;  2HVH A;  1TUY A;  1POI A;  3H46 O;  1XC9 A;  3J7Z O;  1ZYV A;  4YOV A;  4JRP A;  3SLC A;  4FOE A;  4BG9 A;  3T1Y K;  1RT4 A;  4CJW A;  2HW3 A;  3AVL A;  3VF6 A;  4GV3 A;  4BVO A;  1T7E A;  4JAX A;  3O80 A;  4KYP A;  3QEI A;  1RT3 A;  3QER A;  3CPE A;  3ENO A;  2FSJ A;  3MWT A;  4FWQ A;  3S9H A;  1BL3 A;  1ZBS A;  1ZBL A;  1ZYW A;  3PUF A;  4B9V A;  4DFM A;  2BDP A;  4XEI A;  4CEO A;  4E0D A;  2HHH K;  3IFR A;  1KFS A;  2KZM A;  4FW1 A;  2KKZ A;  1J5E K;  4HUG A;  2VCP A;  1T7P A;  1NGA A;  4NXN K;  2PZS A;  1U47 A;  1TKT A;  3OY9 A;  1RDC A;  2FSK A;  1U48 A;  1VQ9 N;  4Y0W A;  3KK3 A;  3K59 A;  1CHZ A;  3LAK A;  1LWE A;  2KZZ A;  1T6D A;  3VEY A;  3QIC A;  4DKW A;  1MWK A;  3OYI A;  4RWT A;  4DTM A;  1XMO K;  3L2R A;  4IFV A;  4WQ4 C;  2NRZ A;  4GW6 A;  1KVA A;  4BE7 B;  2YHB A;  3SQ4 A;  1ZUT A;  2DPN A;  3ZET A;  4AHV A;  1RBR A;  1JKZ A;  4EHU A;  1HRH A;  4CJS A;  2ZJQ L;  1JLC A;  4CJQ A;  4E7K A;  5AQR A;  4CJT A;  3OYF A;  3TAG A;  3LWL A;  4EZ9 A;  2HHQ A;  4FLX A;  1BI4 A;  2FBY A;  4KFB A;  4IFE A;  1Z25 A;  4ICL A;  1X9W A;  3AAP A;  4IEI A;  1RBV A;  4A5B A;  5ELZ A;  5GAD P;  1OVQ A;  3OBY A;  3CYM A;  4FPB A;  5AQU A;  4FLV A;  1X9J A;  1YIT N;  2KQ2 A;  5JVH L;  2QA4 N;  3DAW A;  1UAX A;  2F8S A;  3SPZ A;  5BRF A;  4DQS A;  1T44 A;  2VG6 A;  3DLL L;  1WT7 A;  2LJ7 A;  5AQZ A;  2Q0R A;  3WXI A;  2QKB A;  3ZEU A;  1YJ9 N;  4BRM A;  4ID5 A;  1DGK N;  1N4N A;  3CQ8 A;  4K8X A;  2Q97 A;  4FW2 A;  4WQ5 C;  3KC6 A;  3ZSZ A;  4DV2 K;  5M1Q A;  5AQT A;  5HRO A;  3CYG A;  2G8F A;  3QB0 A;  3QBX A;  2YNF A;  2O8C A;  2UUB K;  3NVK A;  1N5Y A;  3C0B A;  2WON A;  5JMV A;  4JS5 A;  3HOS A;  1Q81 O;  1VQ8 N;  1GLJ O;  4DU4 A;  4CCH A;  3OW2 M;  4EZ6 A;  5C2F A;  3ZT1 A;  4BRF A;  2YCH A;  4BEB A;  5J2N A;  1DT9 A;  3BF3 A;  4LC9 B;  1EET A;  4BDY A;  1VQK N;  3E9O A;  4FJ7 A;  3H08 A;  3UKU B;  1XQS C;  3CQX A;  5CZ1 A;  4DR4 K;  4V1D C;  1YTA A;  1WSE A;  3AVI A;  3VEN A;  3NAE A;  4RG8 A;  1TUU A;  1XHZ A;  3DRP A;  2GWJ A;  4CJP A;  3O1B A;  1RT6 A;  1PX9 A;  4HUF A;  3FFI A;  5KQD A;  1N34 K;  1NLV A;  4DQR A;  4FK4 A;  5EU7 A;  4BQL A;  3HM9 A;  3U8X A;  1YUW A;  3BP8 A;  3T1A A;  3C95 A;  4A57 A;  3AO1 A;  4MO5 A;  4FWS A;  4BRN A;  3CCR N;  4FM2 A;  4IDH A;  3HST B;  3ZET B;  2A40 A;  2HST A;  3WXM B;  2BH1 A;  3D7E O;  4RTF D;  1BA0 A;  2HHW A;  1BO5 O;  1ZXO A;  3MXM A;  4N76 A;  4BR7 A;  1C6V A;  4OKE A;  1QS4 A;  1VRU A;  2P9L A;  3CCJ N;  1YJW N;  2QXL A;  2V7Y A;  4JKD A;  4C23 A;  3K0S A;  3UKR B;  5E41 A;  5HLF A;  3AVH A;  1HYV A;  2Z1J A;  4DU3 A;  1Y64 A;  3O4N A;  2YHX A;  5DM7 L;  3O9Q A;  3EE8 A;  2WFB A;  4O44 A;  3DRR A;  2GEL A;  4CEA A;  2VGN A;  4CHP A;  4FYD A;  1IO2 A;  2HHT A;  2HBJ A;  4M3U A;  2O8F B;  1GLC G;  3NVM A;  2ZGY A;  4K41 A;  2P5O A;  4BC5 A;  4ELU A;  3TPQ A;  1J6Z A;  4FCY A;  2N2Q A;  4DR1 K;  4KHY A;  5HRP A;  2B5J A;  5BPL A;  1AHO A;  4DLE A;  3SQ1 A;  3DYA A;  4PY5 A;  3EKS A;  4FJM A;  3JS6 A;  3L3U A;  2N66 A;  5AQY A;  4CEZ A;  2O8D A;  1NOZ A;  3GKU A;  3GDQ A;  1RGI A;  4O4G A;  3L4Q A;  3ALY A;  3NDK A;  3NF6 A;  4W5R A;  5HRN A;  1W9H A;  2QI2 A;  3IAY A;  3O3G A;  4BC3 A;  3NH1 A;  4EAH D;  5KK4 A;  4I7F A;  1IG8 A;  1WMT A;  4AM6 A;  3CCU N;  1NM1 A;  4DTR A;  1AYJ A;  1X9M A;  2OZS A;  4IG0 A;  1P0A A;  3O3H A;  3BDP A;  2FBT A;  2QM1 A;  1HJR A;  2VG5 A;  2FBX A;  4Z4C A;  2E2F A;  4ELV A;  4LFB K;  1VSD A;  2GTD A;  4LF9 K;  1VSH A;  3KHW A;  2PYL A;  4M3T A;  3LP1 A;  5AQO A;  4M7Y A;  4KRE A;  3G10 A;  1N8R O;  1L3T A;  4B9M A;  1B9F A;  3AVC A;  3KOZ A;  1JXB A;  3MED A;  4C1N I;  1YAG A;  2KHO A;  4BDP A;  2Q31 A;  5SZT A;  3J80 O;  5JVG L;  1NK6 A;  4CBU A;  5F0X A;  4MLH A;  2DFH A;  3QNN A;  1BCO A;  2QWN A;  5AQV A;  1P8Z A;  2E2P A;  3DOK A;  3S41 A;  3TAR A;  4DHY A;  4DTU A;  5T7B A;  3L3V A;  1J54 A;  5AQG A;  4FO0 A;  2KLA A;  5AQH A;  5FDL A;  4CJ7 A;  1CN2 A;  4FSV A;  5C15 A;  2KJA A;  2ZQB A;  3P39 A;  4JKG B;  4DV6 K;  4GY2 B;  4JK7 A;  3M6G A;  4C8M A;  2P9U B;  1BK8 A;  4Y1C A;  4DQI A;  1W97 L;  3CW4 A;  3HRG A;  3VET A;  2NLX A;  4C8K A;  2ZJR L;  4IEE A;  3V6D A;  2UYT A;  1W0H A;  4IG3 A;  1B92 A;  3MX5 A;  4GKJ K;  5C0Y A;  4BWJ A;  4YOU A;  2YX6 A;  1LQI A;  3ZX0 A;  4CJV A;  4PQU A;  1MU2 A;  1MR4 A;  4KHU A;  4FZY A;  3OYA A;  4EFH A;  3SJJ A;  5LY3 A;  3KLG A;  4NLC A;  1HNZ K;  3CME N;  2D1K A;  5EY4 A;  2O8E B;  3AO4 A;  5BRE A;  3T7Z A;  3RMD A;  5K14 A;  3FGU A;  4DMN A;  4JK8 A;  2WOM A;  3MAQ A;  2M8B B;  1LW0 A;  4KHP K;  4NYN A;  3RRG A;  2D0P A;  5JLH A;  1HR0 K; 
#chains in the Genus database with same CATH homology
 4HWI A;  3C7N A;  3EKU A;  3KHY A;  1H1V A;  3H3N O;  2K35 A;  1NWK A;  4FOI A;  4OPH A;  4PKH A;  3UB5 A;  4CI6 A;  4ISG A;  4WCE L;  5AFU H;  2ASO A;  2E2N A;  2ZGZ A;  3SMP A;  3EE9 A;  3HM8 A;  1NGG A;  1GLA G;  1WUA A;  2BUP A;  3FE1 A;  3G25 A;  2HF4 A;  4PL7 A;  1SQK A;  1LCU A;  4WF9 L;  1W2B M;  3WUH A;  5BPN A;  3QFU A;  4CZF A;  5B8H A;  4B9Q A;  1VQL N;  2VGM A;  3LL3 A;  4KH6 A;  3VGL A;  2AP1 A;  3LDQ A;  2AA4 A;  3GBT A;  4A59 A;  3CPW M;  3PLA A;  3MX2 A;  2QWL A;  2OAN A;  3ENH A;  3VEW A;  5JLF A;  4PKG A;  2GUP A;  4IJN A;  1Q82 O;  2WC9 A;  4AF1 A;  3N4Q A;  1S3X A;  1KXP A;  2E8A A;  3A8Y A;  3VEO A;  5M1N A;  2P9K A;  2QEX N;  1K73 O;  1XC3 A;  1ATR A;  1NGJ A;  4BR0 A;  3GE1 A;  3CCM N;  4YOR A;  1GLL O;  2CGK A;  1HX1 A;  3G71 N;  3CC2 N;  4WQ5 A;  2NRR A;  3GL1 A;  1QQM A;  2FF3 B;  3FZM A;  2E2Q A;  5AQP A;  1VQ4 N;  1KQS M;  4PHT X;  3BEX A;  4BRG A;  1YHQ N;  2V51 B;  4O8K A;  4DCH A;  1V4S A;  3H1Q A;  5AQM A;  1QZ5 A;  2OTJ N;  1YIJ N;  2QW9 A;  5C2D A;  4H0O A;  4PL8 A;  1HLU A;  2ZJP L;  4H5T A;  4R79 A;  5CHI A;  3E1Y A;  4IOX A;  2Q1N A;  3I8B A;  1GLB G;  4M7X A;  1VQ5 N;  1GLF O;  4G9Z A;  5TKW A;  5BRH A;  5AR0 A;  4JN4 A;  4GV9 A;  1Z05 A;  3ZYY X;  4BRC A;  3WQT A;  2WBN A;  3TTC A;  3MMV A;  1MDU B;  4JNE A;  3CHW A;  3R6M A;  5AFU A;  3ID8 A;  3HBT A;  3CF5 L;  1D4X A;  2E1Z A;  1NGB A;  3CET A;  3Q7C A;  4NB4 A;  2E20 A;  2HMP A;  3CJ9 A;  3CCQ N;  5FPN A;  3O1W A;  3SJH A;  4H0X B;  3CCL N;  4UY8 O;  3MWP A;  4JHD B;  2EWS A;  5KPT A;  4KH4 A;  1ATN A;  3FZL A;  4NO7 A;  1G99 A;  1VAZ A;  3ENB A;  3QI7 A;  1M90 O;  3RSE A;  3R1X A;  1BOT O;  1ESV A;  3I33 A;  3IUC A;  3L6Q A;  2GX9 A;  2HBL A;  3CI5 A;  3FR0 A;  3HSC A;  1KC8 O;  1KD1 O;  4MDA A;  5M1K A;  1HUX A;  1VQM N;  3FZH A;  4CZE A;  4H0P A;  3MCP A;  4BG8 A;  5AQI A;  3AAQ A;  3O4W A;  3P31 A;  4BGA A;  2IIR A;  3C6H A;  4BC4 A;  4H5W A;  5E84 A;  4EIA A;  1HJO A;  3CJ7 A;  4WQ4 A;  3GG4 A;  5ADX H;  4O5F A;  1YXQ A;  1NJI O;  1NGC A;  3HZ6 A;  2HOE A;  3KK7 A;  4H03 B;  4BR4 A;  1ZC6 A;  4I6M B;  4JK9 A;  3SF4 D;  4FPA A;  4GVE A;  5MLC Q;  5TKY A;  3DJC A;  5AQX A;  3A5N C;  2QWO A;  2F7T A;  3F9M A;  5EOY A;  5AZI A;  5AQW A;  4YOT A;  2NZT A;  3QBW A;  1SS6 A;  4BRH A;  5GAH P;  2D0O A;  2GMO A;  2CGL A;  4CZL A;  1WOQ A;  3SBG A;  5EXW A;  4XH4 A;  4UAF E;  2IVP A;  3EZW A;  2P9L B;  4RCH A;  3VEX A;  1GLE G;  3IMX A;  4FWN A;  1QQN A;  1POI A;  1TUY A;  4CD3 A;  3H46 O;  2V7Z A;  2P9I B;  5AQJ A;  3B8A X;  3J7Z O;  1YJN N;  4YOV A;  3SLC A;  4FOE A;  4IJA A;  4BG9 A;  2FSN A;  4BEC A;  3H3O B;  1S72 N;  3SK3 A;  3VF6 A;  4CZM A;  4GV3 A;  3CIP A;  2YHW A;  4BVO A;  4NLB A;  3QML A;  4JAX A;  3O80 A;  3M5R A;  3CPE A;  3ENO A;  3N4P A;  2FSJ A;  3MWT A;  4FWQ A;  5M1F A;  4IWV A;  1ZBS A;  1EO1 A;  1T6C A;  4A62 A;  4H5V A;  4XEI A;  2QWP A;  1YVN A;  3IFR A;  4IOA L;  2KKZ A;  3WXJ A;  2RE2 A;  4DQ8 A;  3K9K A;  2A41 A;  2NRH A;  2VCP A;  1NGA A;  3O9R A;  3CJC A;  5LJW A;  1SAZ A;  2JDQ D;  2FSK A;  1HKC A;  3HI0 A;  1VQ9 N;  4Y0W A;  2VY6 A;  5CE3 A;  3D2E A;  4BRO A;  1KAX A;  3U9D A;  4JKB A;  4XH5 A;  1RDW X;  1T6D A;  3VEY A;  4DB3 A;  3OBW A;  3QIC A;  2A42 A;  3UKR A;  3R9P A;  4DKW A;  1MWK A;  4E1J A;  3VGK A;  3WXL A;  5CR4 A;  4RWT A;  1VQP N;  3LDN A;  4CD1 A;  4WQ4 C;  5EX5 A;  3ZX3 A;  2NRZ A;  1OKJ A;  3CJ1 A;  4CBX A;  3VF2 A;  4BE7 B;  2W00 A;  1U2V B;  3CXC M;  3CC7 N;  1EQY A;  2D56 A;  1X3N A;  2DPN A;  4J8F A;  3UKU A;  3ZET A;  4EHU A;  1BDG A;  2JWL A;  4ILG B;  3R8E A;  2ASP A;  2ZJQ L;  1BWF O;  4JD2 B;  2WUS A;  3K9J A;  3EL2 A;  2IVO A;  5ADX A;  4MO4 A;  5AQR A;  4EHT A;  1BUP A;  3H6E A;  1SZ2 A;  5FPM A;  4H0Y B;  1K8A O;  4IFE A;  2CH6 A;  3ZX2 A;  3U9Z A;  3AAP A;  5HOO A;  1OVY A;  4IEI A;  2NRX A;  4A5B A;  5JIC A;  5ELZ A;  5GAD P;  3L56 A;  5H1S Q;  1QVG M;  1QHA A;  3A0I X;  3OBY A;  2YJE A;  4FPB A;  5AQU A;  1YI2 N;  1X9J A;  3GOI A;  4YOY A;  4MDB A;  5KQ8 A;  1YF5 L;  1VQ7 N;  5BN9 A;  2LN8 A;  2VWB A;  3MCA B;  1YIT N;  1DEJ A;  3KWI A;  5FPD A;  3Q7B A;  5JVH L;  2QA4 N;  3EO3 A;  3DAW A;  1K8K A;  4ISE A;  3G4S N;  3MN6 A;  5BRD A;  5BRF A;  2P9U A;  1RDU A;  1T44 A;  3A5L C;  4I6M A;  3TSU A;  3DWL A;  3VER A;  3DLL L;  3TTD A;  4IXC A;  3RSE B;  5AQZ A;  1HPM A;  2Q0R A;  3WXI A;  3ZEU A;  1YJ9 N;  4BRM A;  4CZJ A;  4B1V A;  1VQO N;  1DGK N;  1NGD A;  2HF3 A;  2Q97 A;  4WQ5 C;  4C1N K;  3KC6 A;  3HTV A;  3CCV N;  3CJA A;  3R3L A;  2RHK A;  3SMS A;  2IVN A;  1MA9 B;  5M1O A;  5M1Q A;  5AQT A;  2P9S B;  3VF4 A;  3WEE B;  3WEE A;  3QB0 A;  2YJF A;  1E4F T;  4FWM A;  4BRK A;  3QBX A;  3UE5 A;  1T3V A;  3NVK A;  4GNI A;  3BUZ B;  3C0B A;  3PIO L;  5JMV A;  3KZB A;  1C0G A;  3HOS A;  4BGB A;  3O08 A;  4ILJ A;  1Q81 O;  1VQ8 N;  2P9P A;  1GLJ O;  1E4G T;  3O9T A;  3OW2 M;  2F9T A;  5C2F A;  5AZJ B;  3PIP L;  3LM2 A;  4BRF A;  3CCS N;  5M1P A;  2YCH A;  2F9W A;  3QFP A;  4IZ9 A;  1DT9 A;  3BF3 A;  3WXK A;  4BEB A;  1JCE A;  4UAD E;  1NMD A;  2VYP A;  4JD2 A;  4LC9 B;  1VQK N;  3ATU A;  3E9O A;  5F2R A;  4FWO A;  1P90 A;  5FPE A;  3UKU B;  1RFQ A;  3CER A;  5GAE P;  1XQS C;  4CBW A;  3D2E B;  1NGH A;  1Z6R A;  1GLD G;  3CQX A;  3AAR A;  3DXK B;  4WFA L;  1C0F A;  4GV6 A;  3VEN A;  1TUU A;  3E9P A;  1NGI A;  2GWJ A;  4BR9 A;  3O1B A;  5C12 A;  1Q86 O;  3CD6 N;  2NRW A;  5KQD A;  1NLV A;  2Q36 A;  2C1I A;  2PBD A;  4BQL A;  5BPM A;  4M63 C;  3U8X A;  4A61 A;  2YIP A;  4BRL A;  4BRD A;  3IDH A;  4BQZ A;  5GIO A;  1YUW A;  3BP8 A;  4JKF A;  4OO1 J;  2C1G A;  4H5N A;  3A5O C;  4A57 A;  4MO5 A;  1TYQ B;  4FWS A;  4BRN A;  3CCR N;  2YIL A;  4IDH A;  5AQS A;  5BR9 A;  3ZET B;  4FL9 A;  2A40 A;  2HST A;  5GIN A;  3D2F A;  4FVU A;  1DKG D;  3WXM B;  2BH1 A;  3D7E O;  4RTF D;  1BA0 A;  2QWM A;  1BO5 O;  1HKB A;  3LDP A;  3IKM A;  4U67 L;  3D2F B;  4YDU C;  1ZXO A;  3O9S A;  4BR7 A;  1X3M A;  3VTH A;  2P9L A;  3AGR A;  2P9S A;  3CCJ N;  2FF6 A;  3DXM A;  1YJW N;  2BTF A;  1U6Z A;  3FZK A;  2QXL A;  2V7Y A;  3ULE B;  3VTI A;  2ZWH A;  1NGF A;  4JKD A;  4C23 A;  3P38 A;  3UKR B;  3FLC O;  4CZI A;  1Y64 A;  3MN7 A;  2YHX A;  5DM7 L;  3VEV A;  3O9Q A;  3CQY A;  2WFB A;  3EE8 A;  3I56 N;  3OA9 A;  3G6E N;  5AZJ A;  3CJB A;  2P9P B;  3CCE N;  2GEL A;  3E66 A;  4A2B A;  2VGN A;  2P9K B;  4ILH A;  2P9N A;  4FWR A;  2JWK A;  1K8K B;  2A5X A;  2HBJ A;  3AGK A;  3VPZ A;  1Q7Y O;  1VQN N;  4Z94 A;  3O8M A;  3EN9 A;  1CZA N;  1GLC G;  3MDQ A;  3NVM A;  2ZGY A;  3VEZ A;  4K41 A;  4B1X B;  1JCG A;  4BC5 A;  2W40 A;  3TPQ A;  1J6Z A;  4BRI A;  1ILY A;  3I55 N;  5BPL A;  3W0L A;  3ATV A;  2YIO A;  3EKS A;  4CZH A;  2QWR A;  2ITM A;  5GAG P;  2A3Z A;  2Q2R A;  3JS6 A;  4A2A A;  3M1F A;  5AQY A;  1O13 A;  4JEP A;  4OPA A;  3C65 A;  1K9M O;  4JKC A;  1Q18 A;  1JCF A;  1LOT B;  4QS8 A;  3GDQ A;  1RGI A;  2NRT A;  3L4Q A;  3T69 A;  3VGM A;  3MK6 A;  3F2K A;  3OHR A;  3MN9 A;  2QI2 A;  3FZF A;  1XUP O;  3SAF A;  3SAG A;  2HBM A;  1U2V A;  4H0T B;  1BU6 O;  4BC3 A;  4WFB L;  4EAH D;  3U4L A;  4IOC L;  1IG8 A;  1BG3 A;  5AZI B;  2P9N B;  2ZF5 O;  1MWM A;  4AM6 A;  5AQQ A;  3ZEU B;  4CZG A;  4FWK A;  4JHD A;  4BR2 A;  1M1K O;  3CCU N;  2FLO A;  3L0Q A;  4H5R A;  1IJJ A;  1NM1 A;  4JKG A;  3H1V X;  4A5A A;  3ULE A;  3DXM B;  3CC4 N;  3H45 C;  3TU5 A;  4BVP A;  2I7N A;  4PKI A;  2QTD A;  4XH1 A;  2QM1 A;  3TSP A;  3VMF B;  2E2F A;  2YHY A;  3C6A A;  3D6R A;  3BF1 A;  3ID6 A;  4BY9 C;  3JXU A;  2YI1 A;  3O6W A;  2GTD A;  2PFU A;  4UAE F;  4O8U A;  2GWK A;  3KHW A;  1QZ6 A;  2E1Y A;  5AQF A;  4KBO A;  5AQO A;  4M7Y A;  1NBW A;  3VES A;  1N8R O;  1VQ6 N;  1TYQ A;  2E88 A;  2GEM A;  4IO9 L;  2OTL N;  5LJV A;  2HBK A;  1KAZ A;  2E2O A;  3F5T A;  4C1N I;  1YAG A;  4B1Z A;  1JJ2 M;  4QS9 A;  2ASM A;  2KHO A;  2FXU A;  4H0V B;  3TSQ A;  3J8A A;  4F9O A;  2H3G X;  4BC2 A;  4KH5 A;  2Q31 A;  4WFN L;  5BN8 A;  5I9E B;  3HOT A;  5JVG L;  3M3Z A;  4MLE A;  3WT0 A;  4CBU A;  5F0X A;  4MLH A;  4L3Q A;  5C10 A;  2CH5 A;  5E26 A;  2QWN A;  3C7N B;  2E2P A;  5AQV A;  1P8Z A;  2P9I A;  3O9U A;  3S41 A;  4U7B A;  2MN5 A;  3LDO A;  4WYB A;  1S22 A;  1V4T A;  4DHY A;  4IO8 A;  3DXK A;  2MBK A;  5AQN A;  5AQG A;  4FO0 A;  4B1W B;  3BK3 C;  4BRP A;  5EVZ A;  4JKE A;  2KLA A;  5F1X A;  3L4I A;  2D4W A;  3NMU A;  5AQH A;  5AQK A;  5KPZ A;  3SBT A;  3WQU A;  4CJ7 A;  1ATS A;  4B1Y B;  4FSV A;  5AQL A;  2W41 A;  4BRE A;  3LDL A;  4BRA A;  5C15 A;  1QQO A;  1HKG A;  3P39 A;  4JKG B;  3TTF A;  2NNW A;  4FWP A;  4K43 A;  4GY2 B;  1R59 O;  4JK7 A;  3M6G A;  2I7P A;  2P9U B;  4K42 A;  1W97 L;  3CW4 A;  3HRG A;  3O5B A;  2NLX A;  3FFK B;  4K25 A;  3VET A;  2ZJR L;  4IEE A;  1KAY A;  4ISF A;  3LM9 A;  2UYT A;  3A5M C;  4YDU A;  4BR5 A;  3KWG A;  3MX5 A;  4CZK A;  3VOV A;  2QWQ A;  3MN5 A;  5C0Y A;  4YOU A;  5DM6 L;  2YX6 A;  3ZX0 A;  4JKA A;  4JKH A;  3KVG A;  3E9L A;  2CGJ A;  4EFH A;  5LY3 A;  1NGE A;  4NLC A;  1QVF M;  2PAV A;  5GIP A;  3R2V A;  2A6A A;  4FWL A;  3CME N;  2D1K A;  5EY4 A;  3SAH A;  2V52 B;  2J4R A;  5KPR A;  3W3D A;  4XJX A;  2NRV A;  4YOW A;  3P4I A;  5BRE A;  3T7Z A;  4QS7 A;  5HL7 L;  3FGU A;  2Q0U A;  3RVC A;  4B1U B;  4JK8 A;  4AM7 A;  4YOX A;  3AY9 A;  1BA1 A;  4BRQ A;  4HTL A;  2D0P A;  3QDK A;  3CMA N;  5JLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...