1DKGD

Crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
381
structure length
376
Chain Sequence
b'KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKTGNRTIAVYDLGGGTFDISIIEIDEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOTIDE EXCHANGE FACTOR GRPE
publication title Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (hsp24/hsp70)
total genus 96
structure length 376
sequence length 381
ec nomenclature
pdb deposition date 1997-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 1dkgD02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1dkgD04
5F0XA 1HLUA 2QM1A 4LC9B 5I9EB 2P9LB 3O08A 3G25A 4BR2A 4H0OA 2D0OA 4JAXA 4WQ4C 4CZFA 3IUCA 5ELZA 4B1WB 4RTFD 1NGGA 4MLEA 1K8KB 3F9MA 1TYQB 3D2EB 4FWLA 2P9PA 4WQ5A 3ZETA 5BR9A 2NZTA 1DEJA 4IJNA 2WUSA 4DQ8A 3WEEB 1EQYA 3ZX0A 5AQRA 2HF4A 1DKGD 4FWRA 1GLJO 1R59O 3C7NB 3OHRA 5AQTA 2VCPA 5AQFA 2VYPA 2ITMA 4BR0A 3AY9A 3WXIA 1NGEA 1NMDA 1XQSC 2IIRA 4NO7A 4BG8A 1XUPO 3M1FA 3W3DA 1QZ6A 4H0VB 5AQLA 4GY2B 3VOVA 4H0XB 2D0PA 2H3GX 5EX5A 3CERA 1BUPA 3HI0A 4MLHA 2PAVA 1BU6O 1RDWX 2P9KB 4L3QA 2QWQA 1S22A 3CI5A 2HMPA 4PKGA 5BRFA 5AQHA 2KHOA 4M7YA 3WXLA 2UYTA 1U2VB 3A8YA 4WQ5C 3IFRA 4EAHD 2Q1NA 2E88A 2YJEA 3FLCO 1HX1A 4F9OA 3BUZB 2EWSA 4BRAA 1QZ5A 1Z05A 2V7ZA 3BP8A 2YHWA 4FPBA 1KAYA 1TUYA 2QWLA 3A5NC 3J8AA 5KPZA 1ESVA 3DWLA 4I6MB 1NWKA 1HUXA 3BF3A 1NGFA 3ATUA 2CH5A 2P9UA 5BPNA 1NGIA 3UKRA 4O5FA 2Q0RA 1J6ZA 3DJCA 4H0TB 3A5MC 1BG3A 2V52B 4K43A 1IJJA 1YAGA 4M7XA 4FWKA 3GBTA 1IG8A 3ENOA 3MMVA 1KXPA 4XH5A 3WUHA 2D4WA 3D2FA 4K41A 4GNIA 4BRCA 1JCGA 2A42A 5AQGA 1RFQA 2YJFA 5AFUH 5AQJA 3O6WA 1GLBG 2J4RA 3MN9A 3P4IA 4HTLA 5BN8A 1MA9B 1H1VA 3VESA 5KPTA 3L0QA 4WQ4A 2GTDA 4B1ZA 4CZJA 1BO5O 3H45C 3VF6A 4PKHA 2ZF5O 4BRIA 4BRMA 1T6DA 3UKUA 2I7PA 3JS6A 4CZLA 4BRDA 5AZIA 2P9NB 1GLFO 1G99A 5KPRA 2Q31A 3WQUA 4AM6A 5KQ8A 4JD2A 4RWTA 4O8KA 4HWIA 2QWOA 1TUUA 3EKUA 3TPQA 5AQOA 2W40A 3WXJA 3U4LA 3O1BA 3BEXA 2GWKA 4FPAA 4CZHA 2D1KA 3MCPA 3VERA 3QBXA 5E26A 4CD3A 4CI6A 3L6QA 3ZEUA 5LJVA 1BA1A 3GDQA 3MK6A 2ZGZA 3DXKA 1GLAG 3TU5A 3FZHA 5JLHA 3UE5A 5LY3A 3QICA 5AQMA 3CQXA 5CE3A 3WXKA 3FZKA 3LDLA 5AQPA 4H5NA 3DXMB 4FL9A 3CJ9A 3AARA 4Y0WA 5FPMA 3MN6A 4JNEA 2P9SA 4BR9A 3FZFA 3VEYA 1ZC6A 3VGKA 3JXUA 3CJ7A 3CJ1A 3FGUA 3UKUB 4XEIA 2YHXA 2QWRA 2ZWHA 1NGBA 4JHDA 3CJCA 1WUAA 4A2BA 3MDQA 5AZIB 3EZWA 4PL7A 4BRGA 4A61A 4H5VA 4BGBA 5AQYA 1CZAN 2P9IB 3KZBA 3GG4A 4BGAA 5EOYA 5BN9A 4DCHA 5AQWA 5BRHA 1SZ2A 3A5LC 1BDGA 4BVPA 4E1JA 1HJOA 5AZJA 2QWMA 4IWVA 3RSEA 1Q18A 4EHUA 3VPZA 5AQQA 1QQNA 2VWBA 3QDKA 4H0PA 4FOIA 3ULEA 4H5TA 2CH6A 4MO4A 3ZX2A 4BQLA 2FLOA 3VEZA 4BRKA 1MWKA 2QWNA 1QHAA 2E20A 5JICA 1X9JA 3DXKB 2F9WA 1BWFO 2ASOA 3WT0A 4FWSA 2ASPA 2E2PA 4A62A 5AR0A 5B8HA 4BRQA 2QWPA 3FZLA 2A41A 1Z6RA 2YCHA 4KBOA 3B8AX 4BC2A 3H1QA 4AM7A 4PKIA 2P9SB 3EN9A 3ZX3A 2P9PB 1ATSA 3UB5A 2CGKA 3ZETB 4DHYA 5JMVA 3H3OB 4RCHA 3ATVA 3C0BA 4M63C 5BPLA 4QS7A 5AQIA 5LJWA 5ADXA 2Q0UA 2A5XA 3LDQA 5AQUA 4BR5A 1HPMA 1BA0A 3VETA 3AAQA 3S41A 3SJHA 1E4FT 4CJ7A 3LDPA 4CZGA 5EY4A 2IVPA 4BQZA 4FWMA 2V7YA 4EHTA 3O4WA 4K42A 4BRHA 2FF3B 4J8FA 4BVOA 1JCFA 2E8AA 4YDUC 1S3XA 3FZMA 1GLCG 1U6ZA 1V4SA 2P9LA 2Q36A 4DB3A 3KHYA 2E2OA 5BRDA 3VGLA 4BC3A 3ID8A 2E1ZA 3SLCA 3CHWA 4A2AA 5AQXA 4IO8A 4C23A 3SMSA 4CD1A 2V51B 3EKSA 2CGLA 4FO0A 1K8KA 4BR7A 1ATRA 3D2EA 1TYQA 1T6CA 4JN4A 2YI1A 2ZGYA 3O8MA 3WEEA 3DAWA 4B1UB 2P9UB 3GOIA 2A3ZA 2HF3A 3UKRB 2NRHA 3H6EA 2GELA 4XH4A 3SK3A 3LDNA 3HSCA 1E4GT 5KQDA 2HOEA 3D2FB 1RGIA 5TKYA 1YXQA 4FOEA 4CZMA 3VF2A 5AQKA 1X3MA 2PBDA 4IXCA 2DPNA 3IMXA 1DGKN 4EFHA 1GLDG 3LM2A 2AP1A 3EL2A 4BR4A 1OKJA 4BRPA 1NGJA 5FPEA 2GWJA 2P9KA 2CGJA 3ENHA 5AQNA 1D4XA 4BRLA 1NLVA 4IJAA 4ISGA 3MN5A 3GE1A 1U2VA 3LDOA 2FSKA 4JD2B 1XC3A 3O80A 5BREA 2IVNA 4H0YB 3I8BA 4CBUA 4BG9A 3HBTA 3CETA 1ZBSA 5FPDA 3O5BA 3HTVA 3WQTA 1NGAA 1JCEA 4I6MA 4IZ9A 3VGMA 1SAZA 4NB4A 4H5RA 3M3ZA 4K25A 4FSVA 3VEWA 3QFUA 3R8EA 3ZEUB 3D7EO 4BREA 4CZKA 2QXLA 5JLFA 3VEOA 5FPNA 5EVZA 5BPMA 4EIAA 2YHYA 2OANA 3CJBA 5F1XA 4YDUA 1MWMA 1NGDA 2BTFA 2W41A 4FWNA 1LCUA 1BOTO 1LOTB 5AQVA 3AAPA 4FWQA 4FWPA 1C0GA 3CJAA 1NGCA 1Y64A 3QMLA 4JHDB 4CBXA 3QBWA 2A40A 2E1YA 5E84A 1SQKA 3FE1A 2E2NA 4XH1A 2AA4A 2FSNA 4ISFA 2P9NA 3VEVA 1HKGA 3VF4A 5ADXH 2IVOA 3CQYA 1C0FA 3L4IA 3R6MA 1HKBA 5AZJB 1P8ZA 4BRNA 3R9PA 3RSEB 2QW9A 4BC4A 3ULEB 1YVNA 2Q2RA 3EO3A 1MDUB 4H5WA 1WOQA 3H46O 4H03B 3M6GA 1ZXOA 4CBWA 4QS9A 3VENA 2GUPA 3A0IX 4FWOA 3VEXA 1KAXA 1NGHA 1T44A 3H3NO 1X3NA 5AQZA 3U9DA 4BC5A 1V4TA 3LL3A 1QQMA 2Q97A 3HZ6A 1HKCA 1NM1A 5AFUA 1QQOA 3IDHA 3QFPA 3FFKB 1GLLO 3DXMA 4BROA 5EXWA 3BF1A 3LM9A 1ATNA 4ISEA 2FF6A 3H1VX 1KAZA 3SMPA 2BUPA 3HM8A 1YUWA 5F2RA 5AQSA 2E2QA 4MO5A 4BRFA 3U8XA 4CZIA 2F9TA 4PL8A 4CZEA 4B1YB 3C7NA 1NBWA 3MN7A 4B1XB 1GLEG 3A5OC 3O1WA 2GEMA 3I33A 2P9IA 4Z94A 3QB0A 2A6AA 4B9QA 2FSJA 3FR0A 3W0LA 3KVGA 4B1VA 2FXUA 2NLXA 4QS8A 3CIPA 3U9ZA 2ASMA 4WYBA 2I7NA 3GL1A
chains in the Genus database with same CATH superfamily
4CGDA 2O4GA 2P9LB 3HK2A 3G25A 4BR2A 3NF8A 1Q8IA 2NRTA 2D0OA 4DTXA 3IUCA 4V1DC 2HHIA 5ELZA 4B1WB 3K5NA 3P1GA 4RTFD 1NGGA 1TAUA 1K8KB 2YNIA 3C94A 3F9MA 3SPYA 4FWLA 1C0UA 3ZETA 4JS5A 2GX9A 1TKDA 2NZTA 4NXNK 4IJNA 2WUSA 1ZYQA 1EQYA 3AVAA 2GMOA 3ZX0A 3SF4D 3OS0A 1YHQN 3LZJA 4O4GA 4FWRA 3PV8A 2KPYA 1VQ4N 2KQ2A 3JSMA 5AQTA 2VCPA 4FM2A 3WNGA 4AHRA 1FKPA 1XQSC 1PTXA 4BG8A 4LSLA 1B7DA 3AVLA 4IBNA 1YTUA 1KVCA 4AQYK 3L56A 4CIGA 5AQLA 4DQRA 4GY2B 1ZBLA 1QHTA 4DSJA 3K5MA 4O0JA 4CGHA 2D0PA 4C1NK 1RDAA 3V9ZA 4CEFA 4BE1A 1VQ9N 4KRFA 4LD0A 2PAVA 3VQPA 2HMPA 5HBMA 4B3MK 2YNHA 4M3UA 1EO1A 1ZFUA 3Q7CA 4DV1K 3K5OA 1LV5A 1HX1A 4F9OA 2OTLN 2EWSA 2R7YA 1QZ5A 1NMNA 4OGCA 3A5NC 3J8AA 5KPZA 1ESVA 3ZCMA 1HQEA 3LP1A 4I6MB 1X9SA 4M3XA 1JKZA 3NF9A 3HVRA 2ZJQL 1BI4B 3EE8A 3L4QA 4H0TB 5BR8K 2V52B 1B9FA 2PZSA 4K8XA 1YAGA 3ZSYA 1IG8A 3ENOA 3CM6A 3CD6N 1LWFA 4FJXA 2ZQBA 4BRCA 3K9KA 2A42A 2KTQA 3NGIA 4CGGA 2IGIA 5HRNA 2YJFA 4CVNE 4FVUA 1GLBG 2E5LK 3E9LA 1OVQA 1EWRA 4LF4K 2KZZA 3E7UX 3OJUA 3RMCA 1P90A 3KJVA 2NRWA 5LMUK 4IEEA 1LW2A 1VSHA 4DWIA 1N6QA 3WQUA 4AM6A 1UWBA 5HROA 1IKXA 4IG3A 5KQ8A 4JD2A 1T7EA 4FLXA 1WMTA 1FW6A 3EKUA 2IDOA 5AQOA 1SL2A 2B68A 3U4LA 4C8KA 2GWKA 4CZHA 4B8CA 1RT6A 5LMNK 3CCQN 5CZ2A 4NCGA 3E01A 3LAMA 3AA2A 4O5BA 5LJVA 2I5JA 4CJEA 4AAZA 1C0MA 4FM1A 3P5JA 4DLEA 2O8DA 1B3CA 5CE3A 3L3VA 1VHXA 3CJ9A 1OH7A 5FPMA 4JNEA 4OKEA 4BR9A 4OGEA 4KHSA 2FBXA 3VGKA 2GBZA 3RVCA 1Q9XA 1RBSA 1KFDA 3KC6A 1HJRA 4JV5K 2YHAA 4A2BA 1LWEA 4PL7A 4A61A 4ELVA 4CJPA 1J5EK 5EOYA 1RT4A 5BN9A 3AGKA 4DCHA 2WC9A 1BDGA 1NK0A 1GPSA 2HHXA 4XIUA 1XMOK 3VQ5A 4EHUA 3OYJA 1T8EA 5KK4A 5AQQA 1QQNA 4H0PA 2ZD1A 4FOIA 4H5TA 2CH6A 1JL1A 2HHWA 4BQLA 3QINA 3VEZA 4BRKA 2VGNA 3DXKB 3TAEA 2F9WA 1CXUA 4FWSA 2HHQA 2ASPA 4BE0A 3TANA 1QVFM 5J2QA 1XHZA 3FZLA 4JKGB 4K8ZA 3B8AX 4BC2A 4KBOA 3H1QA 4AM7A 3J7ZO 1RT3A 3DLEA 4B9VA 2FBYA 3ZX3A 1ATSA 3KLEA 1BQMA 5TKWA 3PIOL 2CGKA 4BACA 3MECA 4G1QA 1S9EA 3NBPA 4DHYA 2QK9A 3ATVA 3C0BA 3G4SN 5GINA 3P31A 4M63C 1KFSA 3SAFA 2LY5A 4KYPA 5AQUA 3CC2N 4CFAA 1BA0A 3IG1A 3TTCA 5E41A 3S3OA 3AA3A 4FWMA 2V7YA 2FF3B 5FDLA 1HYZA 4BVOA 1JCFA 2E8AA 3HSTB 1NJZA 3CF5L 3L3UA 2WFBA 1PE4A 3B6OA 2P5GA 2PFUA 1C1BA 3VGLA 2YILA 4O0IA 3ID8A 2G8IA 3OS1A 4FJKA 4Y1DA 5AQXA 2Z1JA 4C23A 3IS9A 3DOKA 4M45A 4JEPA 4BDPA 5HRPA 1XHXA 2XO7A 4DR7K 4DV4K 3BY5A 1N5YA 3EE9A 4ILHA 2P9UB 2A3ZA 4GKKK 5FRNA 4DLGA 1U47A 3L2RA 4BECA 1D9DA 2GELA 2YHBA 3LDNA 1U4BA 1X9WA 2OZMA 1U48A 4M3WA 1JLCA 3SBGA 5CY0A 5TKYA 4AF1A 1BRZA 3VF2A 1SN1A 5AQKA 1X3MA 4GMJB 1VQLN 5CY4A 3WNEA 4A57A 4Z4HA 3EY1A 3KD5E 1GLDG 5GIOA 4BRPA 1ITGA 4AHVA 4FK0A 2CGJA 1YI2N 4BRLA 1NK6A 1KD1O 4KB0A 2F4VK 3MN5A 3E1YA 3F73A 4NCAA 3VQCA 3I0SA 1Q82O 3DM2A 2DFEA 3O9QA 1HYVA 1TI5A 1DQ7A 2WOMA 4BG9A 1WWNA 1XNQK 1WNSA 3L2QA 3QEWA 3I0RA 1ZBSA 3T1YK 1KLMA 4F3TA 3CCJN 3I56N 3DRSA 1WAJA 4IZ9A 2HSTA 3DOLA 1NG9A 4YOYA 3VEWA 3ZEUB 3R8EA 4M3RA 3ZSRA 3D7EO 1NKCA 3HOTA 1ZBIA 4CHYA 5JLFA 3P83D 2W6KA 3VEOA 5FPNA 3MEEA 1WSEA 4EIAA 2YHYA 4N56A 2DFFA 1MWMA 5HRRA 1IKYA 2Z1IA 3THXA 4KPYA 2D56A 2BTFA 3HXMA 1TAQA 2W41A 3ZT4A 4B9NA 1Q7YO 3AAPA 3O3HA 1C0GA 3THWB 1NGCA 2OYQA 3QMLA 4JHDB 3RMAA 4UAEF 2A40A 5E84A 4HUGA 2BDPA 1EP4A 1NOZA 4ISFA 2ASCA 2P9NA 3VEVA 4JKDA 3VF4A 3CQYA 3AVFA 4I2QA 2HHTA 5MLCQ 3R6MA 4BRNA 5GADP 1P8ZA 1B92A 5J1EA 5CYMA 2ZJRL 3J80O 3OYNA 2YBRC 2LY6A 5KGWA 5J2NA 1ZBHA 2Q2RA 3EO3A 4FLVA 3AVMA 1WSIA 4FJMA 3CCVN 2JLEA 4QS9A 2GUPA 4FWOA 1XRSB 3VEXA 1KAXA 1IKWA 3KK2A 1K9MO 4PUOA 3H3NO 1X3NA 5AQZA 3U9DA 2G8VA 2YC1C 3S3MA 2OPRA 1O13A 1GLLO 5C10A 3TAPA 3DXMA 3VTIA 1FH3A 4BROA 1C6VA 5JENA 3QIPA 3LM9A 3SMPA 3LDSA 3RWUA 1DTTA 3OYEA 1L3TA 5AQSA 2G2KA 4GKJK 1T7AA 4CHNA 4Z4GA 4IFVA 3SQ4A 1ZVGA 4PA1A 3A5OC 3EYZA 2GEMA 2E2FA 2P9IA 3O3GA 1TK8A 1T0ZA 2D0CA 2VG7A 4B9QA 4M42A 5IWAK 4B1VA 3LP0A 2FXUA 4QS8A 3U9ZA 5M1OA 4CIEA 4UQGA 5I9EB 3O08A 1CXQA 5K14A 4ELTA 1HYSA 4B9UA 5CR4A 5HL7L 1QSSA 4PQUA 4CZFA 3OY9A 1JKHA 2WTUA 1P0AA 4HCCA 4KH5A 3L2WA 2B5JA 4DU4A 3AVHA 3K9JA 1TYQB 3D2EB 2P9PA 4WQ5A 4B3TK 3HT3A 2GV9A 4EZ9A 3WEEB 4ID1A 5AQRA 2HF4A 4HCBA 1DKGD 1GLJO 3I8DA 1C56A 4O8UA 3M8PA 3OHRA 4BR0A 5AQFA 3AY9A 3WXIA 1EETA 4DSLA 1XUPO 3AA4A 5DK5A 3SUOA 1W97L 1VQ6N 1VSIA 4X66K 1VQ8N 4H0XB 1JLQA 4FZXC 1FJGK 2H3GX 5EX5A 1LWCA 2YKMA 4ZHRA 4PY5A 2P9KB 1RDWX 3G0ZA 2QWQA 3CI5A 1VQPN 3HYFA 5BRFA 3L8BA 2KHOA 1SEGA 2UYTA 1U2VB 4WQ5C 3OW2M 3C6UA 3IFRA 2Q1NA 2E88A 4IDHA 5CZ1A 3BUZB 2X6NA 3O9UA 3BP8A 2GL1A 3HOSA 1KSPA 1TUYA 2QWLA 3V9XA 4LF7K 4BEBA 4IKFA 5KRSA 1NJWA 5J2PA 4W5NA 1HUXA 3ATUA 2HHVA 1D8YA 3UKRA 4DR4K 1W0HA 2Q0RA 5HRSA 1CZ9A 3DJCA 3V9UA 3BZCA 5C2FA 4M7XA 3M8RA 4FWKA 3GBTA 3ITHA 1ASUA 4XH5A 1KXPA 3SAHA 4FXDA 2YIPA 3SUQA 4CJFA 5AQGA 5GIPA 1YJNN 1RT2A 1RFQA 4UAFE 5AQJA 1JXBA 4N47A 3S9HA 3MN9A 3P4IA 4HTLA 1RBTA 3DLHA 4Z4EA 1H1VA 3L0QA 1S1WA 3MXJA 1BO5O 4LFAK 4NYNA 3VF6A 4KH6A 4YOTA 3OBWA 3B6PA 4CHPA 4DQSA 4CERA 4YHHK 4BRMA 2B4JA 4DV2K 4CZLA 5AZIA 1GLFO 4WCEL 3CCUN 1NH5A 1LW0A 4IEIA 1OVYA 4OKKA 1J53A 3TPQA 1TUUA 3K58A 3KLGA 3WXJA 1I6GA 3O1BA 3HPHA 2YNGA 3MCPA 4W5RA 1XI1A 3QBXA 5E26A 2FC0A 3G10A 4CQKA 2RKIA 4ICLA 4X65K 3SUNA 1MU2A 2HB5A 1GOAA 1UA1A 1BA1A 3MK6A 2RN2A 1GLAG 5LY3A 4RW6A 3J7AP 3QICA 4FW1A 1T7BA 4CHZA 1NK5A 3G6EN 5IT9O 3CQXA 3OYAA 3WXKA 4H5NA 1CLQA 1HNVA 4OPJA 2P9SA 3VEYA 1J5OA 4A59A 3QERA 2F96A 2W6LA 2YHXA 2QWRA 1NGBA 3RRHA 2ATQA 3EZWA 4E1MA 4FK4A 3A2FA 1IBMK 2LR3A 1K6YA 4BGBA 1I2UA 4BGAA 4Q5VA 2O8CA 3O4QA 4YOUA 3CMAN 3A5LC 1MYNA 4BVPA 4E1JA 3RSEA 4IWVA 1Q18A 3ASMA 4JLHA 3KOXA 5GAEP 2VWBA 2HMIA 3ULEA 3V6DA 4MO4A 3ZSWA 3CW4A 4CESA 3LALA 3F9KA 1GOCA 1QHAA 4JI8K 2RPIA 3KOWA 2C1GA 1GPTA 1BWFO 4FJ5A 3E7RL 4JK9A 4DR6K 4AHUA 5AR0A 4CFDA 2ZM6K 2HVIA 4BRQA 3HP6A 2A41A 4DU3A 1OZZA 1KRPA 4CJUA 1K8AO 3EN9A 2MN5A 4LH4A 3TSUA 2OPSA 3UB5A 4FLUA 5H1SQ 2B3CA 3F5TA 5KGXA 1UA0A 1A5XA 1NK7A 3L2VA 3CYMA 3WXMB 2Q3SA 3KHWA 3ZSVA 4JI4K 4QS7A 5AQIA 1LAWA 2KYQA 5LJWA 4ZTFA 5JVGL 2Q0UA 2A5XA 4KB1A 1QSYA 3LPUA 4BR5A 1NRAA 4FYDA 3VETA 4F8RA 1BIZA 2OTJN 3HJFA 3SJHA 4CJ7A 3LDPA 4CZGA 5EY4A 2G8KA 2IVPA 3E66A 4E0DA 1VSDA 3O4WA 4J8FA 3AVCA 1SV5A 4DTJA 4YDUC 4KHYA 3FZMA 3C6AA 2P9LA 4DB3A 3KHYA 4KFBA 1N36K 2SN3A 2YX6A 1JLBA 1K73O 2E1ZA 4CJRA 1TK0A 3T69A 3CHWA 1YJWN 4IO8A 2O8EA 4CD1A 2QKKA 2CGLA 2G8FA 3KWGA 1K8KA 4BR7A 1ATRA 3AA5X 1QVGM 2D0BA 4KHPK 2YI1A 4IFYA 3O8MA 4B1UB 4GVEA 4IFEA 1HNIA 4FLTA 3NGYA 4CJTA 4DFJA 4XH4A 2O8BB 2XY6A 3T1AA 4CEOA 3HSCA 5KQDA 2HOEA 3D2FB 1T03A 5CHIA 3R1XA 1YXQA 4FOEA 4CZMA 4C8NA 1U45A 1D9FA 3PIPL 1DGKN 3MAQA 2F8TA 3LM2A 4U7BA 3SQ1A 4AHCA 3EL2A 4CEDA 4DFKA 2NRZA 3E9OA 5FROA 1BK8A 3KLFA 2GWJA 4QOZB 3SAGA 4BY9C 1WB9A 1NLVA 5LL6Z 1KLNA 1NK4A 3SUPA 4DR1K 4OVLA 3VQDA 4DU1A 3LDOA 4DS4A 2FSKA 3NF6A 2IS3A 4U67L 4Z4CA 4CJKA 5FPDA 4NLBA 2NNWA 3T7ZA 1Y97A 4O44A 2Y1IA 4I6MA 3JYTA 3UIQA 1SL1A 1SAZA 4J2EA 3THVA 4LF8K 3M3ZA 1SL0A 3BK3C 5DM7L 3NH1A 3PSIA 3JAMO 1BI4A 4W5QA 4KHNA 5EVZA 3LWLA 3V9SA 5BPMA 2OANA 2X74A 3TAMA 3CJBA 5F1XA 3TSPA 2LSNA 3OYLA 1NE5A 3NH2A 1EXQA 2VY6A 3LANA 3MCAB 1LCUA 4NLCA 3CJAA 3O3FA 5M1NA 2WONA 4B9MA 1SQKA 4XH1A 2AA4A 3VQ7A 1U49A 3OTOK 1ZBFA 2IVOA 3DRPA 1HKBA 5AZJB 1I94K 2QKBA 4DV6K 1S5JA 4CK3A 1YVNA 4JKCA 1N33K 4DSKA 4FZYA 3F2KA 1WLJA 1NOYA 3H46O 4IO9L 2HBMA 4LSNA 3A0IX 4AEIA 3VENA 2GUIA 3SQ2A 4LY7A 2A1RA 2O4IA 4JRQA 1T44A 3QNOA 3AVKA 4IOCL 3LL3A 2Q97A 5KRTA 1IBKK 1HKCA 1NM1A 1TKXA 4CJ4A 4CCHA 1QQOA 1FXXA 3V4IA 3RR7A 3THYB 3T3FA 3QFPA 4I9LA 1M90O 2UUBK 5EXWA 2FF6A 4JKHA 1KAZA 2XY7A 1QE1A 3HM8A 2E4LA 2E2QA 4BRFA 3U8XA 4CZIA 4KREA 4YOVA 3P39A 3C7NA 4G9ZA 3MN7A 4B3OA 2OPQA 4CECA 3KP0A 3PO5A 3QB0A 4CK1A 1HQUA 3CCLN 3W0LA 2XY8A 3M5RA 3KVGA 3CIPA 4YFUA 2ASMA 1B9DA 1RNHA 3S5TA 1VSLA 1S1XA 1C55A 2P51A 1BCOA 2HBLA 4WYBA 2K35A 1Z26A 1VSMA 1PX9A 1HLUA 3K59A 2BGGA 4BE2A 3KKSA 2QI2A 2NY9X 4H0OA 4JAXA 3VQEA 4WQ4C 3KK7A 3QEXA 5M1KA 4JKGA 3ULDA 3OBYA 2YIOA 3AVGA 3HL8A 1SKWA 2BE2A 4RW9A 4C8OA 3ZSXA 3NDKA 1YJ9N 2DTUA 1POIA 1CZBA 4DQ8A 3QNNA 1G15A 3K2PA 1RTJA 4EP5A 4OLBA 2ITMA 5I42A 3TWHA 4CJSA 3Q7BA 1NGEA 1NMDA 2IIRA 4NO7A 3CFPA 4F4KA 2UXDK 3OYHA 1QZ6A 2WBNA 3DLRA 3VOVA 2UXBK 1J54A 1HR0K 5J2MA 1BUPA 1W9HA 1SUQA 1BU6O 3ZSZA 3MX5A 3OJSA 1S22A 1S1UA 3C6HA 3QEVA 3CXCM 5AQHA 3DLGA 4CJLA 2XRIA 4CE9A 3QEPA 3A8YA 4EAHD 4Z4IA 2YJEA 4OPAA 1REVA 4BRAA 3GKUA 1Z05A 2V7ZA 1T1TA 2YHWA 4FPBA 4F2RA 1KAYA 4DF8A 2BRZA 3DWLA 3NFAA 1NWKA 4E7KA 4MDAA 1SN4A 3OS2A 2P9UA 5BPNA 1NGIA 4JYAK 3SYZA 4F3OA 1BIUA 1BG3A 3TSQA 4K43A 3DI6A 3MMVA 3WUHA 4K41A 2QXFA 3CCSN 4GNIA 1GOBA 4DKWA 4CFCA 4JI3K 1IBLK 2E6LA 3O6WA 2EX3A 2MBKA 1MA9B 3VESA 3QESA 1HNWK 4BDYA 2ZF5O 3UKUA 1EWQA 2N69A 3ISNC 5CYQA 2NRVA 4FJIA 2C1IA 4V19S 3ID6A 4O8KA 2O8FB 4HWIA 2QWOA 1JLFA 2ATBA 2KW4A 3BEXA 4FW2A 4M3ZA 1DJTA 5FRMA 4CD3A 4NXMK 3L6QA 1S6QA 3ZEUA 1A5WA 3KTQA 3GDQA 2HNDA 2ZGZA 2MZ0A 3VQQA 5JLHA 4A5AA 2KLAA 2ITGA 4BWMA 3TAGA 4TSXA 4JK8A 2YV0X 4OPKA 1HPZA 3LP2A 4RW7A 3KK3A 3LDLA 5AQPA 1IO2A 1ZYVA 4FL9A 4DTRA 1QTMA 2PY5A 3AVNA 4Y0WA 3MN6A 1I39A 4FJ8A 2QEXN 4DTOA 3CJ7A 3THWA 3FGUA 3C6TA 4BDZA 4XEIA 4X62K 3VQAA 1VQMN 4JHDA 4E3SA 3CJCA 3MDQA 5AZIB 3HPOA 3TTFA 4JI5K 1WN7A 4DV0K 3SCXA 4H5VA 2A1SA 4CGJA 2OA8A 4KKOA 2FBTA 3KZBA 3ENBA 3GG4A 3MWTA 2I61A 1JXCA 4Z0UA 1HJOA 4YNQA 4HVJA 3NHGA 4FZZA 1P00A 1N8RO 1RDDA 1M1KO 1K8BA 3M8SA 5GAHP 1ZBUA 2VGMA 2OCEA 5D3GA 4F2SA 3TABA 4FJLA 3DYAA 2KKZA 4A62A 1VNBA 5B8HA 2X6SA 4KV8A 3J81O 4PKIA 2P9SB 2LN8A 1RDUA 3ZETB 4DV5K 4DFMA 2OZSA 4DV7K 3KLIA 2YNFA 3H3OB 4RCHA 3ZT2A 3DLLL 4OLAA 4E7LA 1S72N 4GW6A 3RMBA 2G8UA 2DY4A 1JL2A 1NKEA 4HHFA 4H8KA 1KVBA 5M1FA 3ZT3A 1HPMA 2KSKA 1XWLA 3AAQA 3S41A 1E4FT 5DM6L 4E89A 3QI7A 1UGLA 1L3SA 2JWLA 4KTZA 2A7TA 1IKVA 4CW7B 3ZYYX 1WBDA 1T7PA 4IDKA 3TR8A 1GLCG 1U6ZA 4E7IA 3KK1A 4DTPA 5BRDA 3S3NA 1SKSA 4BC3A 1SKRA 3SLCA 3AVJA 4WFBL 3SQ0A 2KGQA 1YVUA 1LQHA 3SMSA 5GAGP 1L3UA 4B9LA 1YT3A 1OH5A 4MDBA 1TYQA 3D2EA 1T6CA 2EHGA 1AYJA 5T7BA 3MXIA 1A5VA 4JN4A 4JS4A 3WEEA 3GOIA 3IRXA 5C2DA 2NRHA 3H6EA 4R5PA 4L8RB 5M1PA 1E4GT 1F21A 4J2BA 3KOZA 1RGIA 1FK9A 4FK2A 1RTDA 3AVBA 3K57A 4DS5A 1MR4A 3U6FA 4WFNL 4NCBA 4BR4A 1VQON 3BZKA 1NGJA 3SZ2A 5FPEA 2P9KA 4IOXA 1W2BM 1KV0A 3ALYA 4KO0A 4B3SK 3I55N 3L2UA 3N4PA 4ISGA 4CK2A 2N2RA 3AO4A 3CFOA 1JLGA 2E3GA 1S1VA 4JKAA 4BE7B 1U2VA 4KAZA 1VQ5N 3CFRA 3VQ4A 4FLWA 1NK9A 3OVNA 4JD2B 3O80A 2O8EB 2IVNA 2NY8X 4AH9A 4CBUA 1IV0A 3HBTA 3K0SA 2F8SA 1HRHA 2E6MA 3D6RA 4ELUA 1NGAA 2OPPA 3VQBA 2HNYA 2W00A 4CJWA 1JCEA 3VGMA 3VA0A 4H5RA 3OYKA 4FM0A 4K25A 4FSVA 4JI6K 1BMRA 3QFUA 1I6FA 1RBRA 4H4OA 1L3VA 1JZBA 4BREA 4CZKA 2QXLA 4N5SA 4WF9L 4GV9A 4PWDA 2Z1GA 1E3MA 3NGZA 1SNBA 3ZSOA 4B08A 1BGXT 3CM5A 4KI6A 2O8DB 4O55A 4YDUA 2LKBA 4C8MA 1X9MA 4EP4A 1VRTA 1NGDA 4WE1A 1BOTO 5JS2A 3RTVA 4FWQA 1UOCA 1C0TA 4FWPA 4GVMA 2X78A 2N66A 4CIFA 3H08A 2Z1HA 3CCEN 4E72A 1KQSM 2YEOA 5C25A 1YITN 3FE1A 2E2NA 4UJ0A 1CN2A 1OH8A 3DLKA 1ASWA 1RCHA 3WNFA 5ADXH 3L4IA 2YKNA 3R9PA 4CF0A 1KC8O 4OPHA 4BC4A 4LF5K 1MDUB 4DR2K 3M8QA 3V81A 1NJYA 4AILC 1WOQA 3M6GA 2DFHA 1CHZA 3LZIA 5KTQA 1NGHA 3C95A 4YORA 1IH7A 4ID5A 2HHUA 1V4TA 2RF2A 1Q81O 2PYJA 2NRRA 1BL3A 4DUZK 4ISEA 4JI7K 3AVIA 3LP3A 4KHQA 4YY3K 2BUPA 3SBTA 1YUWA 1TVRA 4MO5A 2F9TA 4DSFA 3SI6A 3EEQA 4PL8A 1YIJN 2XHBA 4B1YB 1Q86O 4B1XB 4CEBA 4DSIA 1GLEG 4JK7A 1ILYA 1VSJA 2HBKA 3FFIA 3T1HK 5SWMA 2A6AA 4K0KK 2HVHA 2FSJA 3FR0A 2JWKA 3C65A 4UY8O 3PUFA 1RBVA 4JKEA 2I7NA 1RDBA 3GL1A 5F0XA 1VSEA 2QM1A 4LC9B 3ZT1A 1NKBA 4RW8A 4I2PA 1BQNA 1YTAA 4MQ3A 2IAJA 3O9TA 4DQQA 1JXEA 4RG8A 4FJGA 4MLEA 3BDPA 3OYBA 3VA3A 3VMFB 4OO1J 1S9GA 5BR9A 4JKBA 1DEJA 4DR5K 3MEGA 4FJ7A 1BISA 1R59O 3PLAA 3PX4A 3C7NB 3TAQA 5AJ3K 4E1NA 2VYPA 3NCIA 3NMUA 2KJAA 3SJJA 3K5LA 3M1FA 3W3DA 2KFNA 4YOWA 4H0VB 4QCLA 1TL3A 2XY5A 5C15A 1EX4A 1RT5A 4E7HA 3PSMA 5C24A 4BWJA 1ICAA 3SV3A 2VWKA 3CERA 3PY8A 4CF8A 4FCYA 3HI0A 4MLHA 4CF1A 3V1RA 3TI0A 4C8LA 4L3QA 3PSFA 4PKGA 1C1AA 1IG9A 4FJJA 4M7YA 3WXLA 4DG1A 1RBUA 1HNXK 4X64K 3BGRA 3FLCO 1WSGA 4WFAL 4LF6K 1L5UA 3D45A 4XJXA 4B9SA 4E19A 4CHOA 3CMEN 2QTDA 4KTWA 1NRBA 3BF3A 5HOOA 1NGFA 4KTQA 2CH5A 5EU7A 4DTSA 2D5RA 4O5FA 3RR8A 1J6ZA 3OYCA 3A5MC 3KD1E 4HHTA 2O8BA 4KH4A 4OJRA 1IJJA 1OH6A 2F7TA 1WAFA 1T3VA 2D4WA 3RRGA 3D2FA 4FVMA 1JCGA 4CGIA 3THXB 5AFUH 4R79A 2J4RA 3ZSQA 5BN8A 2KBJA 5KPTA 4WQ4A 2GTDA 2IOCA 4B1ZA 1BCGA 4CZJA 2IC3A 1WSFA 5JVHL 3H45C 1BCMA 4PKHA 4AHTA 4BRIA 3PX0A 1T6DA 2I7PA 2BH1A 3JS6A 1Q9YA 4BRDA 3LAKA 1VQKN 3MX2A 2P9NB 1G99A 5KPRA 2Q31A 3TARA 3U3GA 4GV3A 4ILGB 4PHTX 1RILA 4RWTA 1TL1A 3CPEA 2W40A 3AO3A 3P38A 4Q0BA 3KIOA 3KP1A 4FPAA 4FJHA 4ILJA 5KI6A 3LWMA 4KHWA 4AB0A 2D1KA 1TKZA 3MWPA 3VERA 3D0PA 4CI6A 3R2VA 5FLXO 1R0AA 3DXKA 3QO9A 2E0HA 3FZHA 3TU5A 4JI0K 3UE5A 4DF4A 5AQMA 4OKJA 1NJIO 3HPGA 1TK5A 1DTQA 4MFBA 4Y1CA 3FZKA 3OA9A 3DXMB 3AARA 5JS1A 3FZFA 1ZC6A 3JXUA 2B6AA 1EKEA 3CJ1A 2NUBA 2VQFK 3QETA 3UKUB 2LI7A 2ZWHA 4DMNA 1TKTA 1WUAA 3U3YA 4BRGA 2KZMA 4DUYK 2HBJA 3V9WA 1NPIA 5HLFA 5AQYA 4HUEA 1N34K 1CZAN 2P9IB 2PYLA 3NH0A 5AQWA 5BRHA 3ZLJA 1SZ2A 2UUCK 3HM9A 5AZJA 3CCMN 2QWMA 2AJQA 1N32K 3VPZA 4HUFA 1VQNN 3CQ8A 3SV4A 3QDKA 4N76A 2Y1JA 2JDQD 2RE2A 3ZX2A 2RHKA 3CG7A 2VG5A 4CFBA 2VWJA 2FLOA 2HHHK 4B3RK 3ZT0A 2ETJA 1MWKA 2QWNA 2E20A 4CF2A 1J9AA 1X9JA 5JICA 3HO1A 1NU0A 4LH5A 1C1CA 2ASOA 2UXCK 3WT0A 3QEIA 2E2PA 4DTMA 1KTQA 2QWPA 2P5OA 1Z6RA 2YCHA 4RW4A 1W7AA 4GV6A 4DSEA 5I3UA 3THYA 1HNZK 1RTIA 3KWIA 3KOYA 1DLOA 3OYIA 1NJXA 2P9PB 4IOAL 3IAYA 4B8AB 3O9SA 1XNRK 4LF9K 5JMVA 4FJNA 4JI2K 4CHQA 3NE6A 4JKFA 3O4NA 1UAXA 1FKOA 5BPLA 2E3FA 4HTUA 4I9QA 3TAFA 5ADXA 1S6PA 3LDQA 1KVAA 4BQZA 4EHTA 1NNEA 1WSHA 4K42A 4BRHA 4CF9A 4LFBK 4JI1K 3V1OA 3AO2A 3VQ9A 4UADE 1S3XA 4CJQA 1ZU3A 3NAEA 1V4SA 3PX6A 2Q36A 2E2OA 2HHSA 1LQIA 3HVTA 4JRPA 2JGUA 3CPWM 1WBBA 4A5BA 3EZ5A 3CCRN 3DMJA 4A2AA 3OYGA 1JJ2M 1L4VA 4QAGA 1RDCA 2V51B 3EKSA 4FLYA 4FO0A 4EZ6A 3NF7A 3LPTA 3SNNA 3PO4A 1YF5L 2UUAK 1TV6A 2ZGYA 2N2QA 1I3AA 3DAWA 2HF3A 3UKRB 4W5OA 1OMYA 2D0AA 3NVMA 1I2VA 3SK3A 1DT9A 3N4QA 3VN5A 3DLBA 1JLAA 4KHUA 3MEDA 3VQ8A 2VG6A 4YOXA 4C1NI 1T05A 2UU9K 1LAVA 4CEZA 4IG0A 2PBDA 4IXCA 1KCFA 2DPNA 3IMXA 4EFHA 2KBHA 4DTNA 2AP1A 4DQPA 2ZE2A 1OKJA 3ENHA 5AQNA 1D4XA 4IJAA 3E9PA 4CJVA 4DQIA 3NVKA 4ZTJA 3GE1A 4CEQA 4DV3K 3DRRA 5BREA 1XC3A 4M3YA 4DTUA 4J2AA 4H0YB 1LQQA 3I8BA 3CETA 3G71N 1WSJA 1AHOA 3O5BA 1XC9A 3HTVA 4M3TA 3WQTA 4DR3K 5C12A 3OYMA 1QS4A 2ZJPL 4KI4A 4NB4A 5A2QO 1XMQK 1VQ7N 3HRGA 1TGOA 2LJMA 3VTHA 4FLZA 1QQCA 1WT7A 3WNHA 4FJ9A 4I7FA 1ZVEA 3IKMA 1S1TA 1LOTB 4FWNA 2NRXA 5AQVA 5SZTA 3RMDA 3KKRA 3OYDA 1Y64A 1VSFA 4LFCK 2P1JA 4CBXA 3QBWA 2E1YA 1HMVA 1ZYWA 1X1PA 1ASVA 1VK0A 2FSNA 3V1QA 2HW3A 1D5AA 1VAZA 2QA4N 1HKGA 2O8CB 3AV9A 4H4MA 3CC7N 1C0FA 2VQEK 4HE7A 2O8FA 3RSEB 5C42A 4E7JA 3T19A 2QW9A 4CGFA 2KBKA 3ULEB 4Z4FA 1O1WA 1JZAA 1VSKA 3QLHA 3SPZA 4CEAA 4H5WA 4NYFA 1RT1A 4H03B 5DMRA 4M41A 3CC4N 1ZXOA 4CBWA 2W42A 1QSLA 4B9TA 3AO1A 4AHSA 3O9RA 2BANA 3AO5A 2G8WA 2M8BB 4BC5A 1QQMA 3HZ6A 5AFUA 5HP1A 1NK8A 3TTDA 3IDHA 3FFKB 1RT7A 1BHLA 2G8HA 3BF1A 2FBVA 3VQ6A 1ATNA 3H1VX 4CJ5A 3HP9A 1Z25A 1SS6A 3MXMA 3AGRA 5M1QA 5F2RA 2KFZA 2HNZA 3R3LA 4CEEA 2LT8A 3KLHA 5C0YA 4CZEA 3CYGA 1NBWA 4CJ3A 1JLEA 4N41A 1VNAA 3O1WA 3I33A 3OYFA 4Z94A 3J7YP 4W5TA 1ZUTA 2NLXA 1RTHA 1U04A 4J2DA 4OX9K 2LJ7A 1N4NA 1VRUA 4DFPA 3QIOA
chains in the Genus database with same CATH topology
5F0XA 1HLUA 2QM1A 4LC9B 5I9EB 2P9LB 3O08A 3G25A 2QI2A 4BR2A 2NRTA 4H0OA 2D0OA 4JAXA 4WQ4C 5CR4A 5HL7L 3O9TA 4CZFA 3IUCA 3KK7A 5M1KA 5ELZA 4B1WB 4JKGA 4KH5A 3OBYA 4RTFD 1NGGA 4MLEA 1K8KB 2YIOA 3F9MA 3K9JA 3VMFB 1TYQB 3D2EB 4FWLA 2P9PA 4WQ5A 1YJ9N 4OO1J 3ZETA 4JKBA 2GX9A 5BR9A 2NZTA 1DEJA 1POIA 2WUSA 4IJNA 4DQ8A 3WEEB 1EQYA 2GMOA 5AQRA 3SF4D 2HF4A 3ZX0A 1DKGD 1YHQN 4FWRA 1GLJO 1R59O 3PLAA 3C7NB 1VQ4N 4O8UA 3OHRA 5AQTA 2VCPA 5AQFA 2VYPA 2ITMA 4BR0A 3NMUA 3AY9A 3Q7BA 3WXIA 1NGEA 1NMDA 1XQSC 2IIRA 4NO7A 4BG8A 1XUPO 3M1FA 3W3DA 1W97L 1VQ6N 3L56A 1QZ6A 4H0VB 4YOWA 5AQLA 1VQ8N 2WBNA 4GY2B 5C15A 3VOVA 4H0XB 2D0PA 4C1NK 2H3GX 5EX5A 3CERA 1VQ9N 1BUPA 3HI0A 4MLHA 2PAVA 1BU6O 1RDWX 2P9KB 3MX5A 4L3QA 2QWQA 1S22A 3CI5A 2HMPA 4PKGA 3C6HA 1VQPN 5BRFA 3CXCM 5AQHA 2KHOA 4M7YA 3WXLA 2UYTA 1U2VB 3A8YA 1EO1A 3Q7CA 4WQ5C 3OW2M 3IFRA 4EAHD 2Q1NA 2E88A 4IDHA 2YJEA 3FLCO 1HX1A 4OPAA 4F9OA 2OTLN 3BUZB 2EWSA 4BRAA 3O9UA 4WFAL 1QZ5A 1Z05A 2V7ZA 3BP8A 3HOSA 4XJXA 2YHWA 4FPBA 1KAYA 1TUYA 2QWLA 3A5NC 3J8AA 5KPZA 1ESVA 2QTDA 3CMEN 4BEBA 3DWLA 4I6MB 1NWKA 4MDAA 1HUXA 3BF3A 5HOOA 1NGFA 3ATUA 2CH5A 2P9UA 5BPNA 1NGIA 3UKRA 4O5FA 2ZJQL 2Q0RA 3EE8A 1J6ZA 3DJCA 3L4QA 4H0TB 3A5MC 1BG3A 2V52B 4KH4A 4K43A 1IJJA 1YAGA 4M7XA 2F7TA 3GBTA 1IG8A 3ENOA 4FWKA 3MMVA 1KXPA 4XH5A 3SAHA 3CD6N 1T3VA 2D4WA 3WUHA 2YIPA 3D2FA 4K41A 3CCSN 4GNIA 4BRCA 3K9KA 1JCGA 2A42A 5AQGA 4DKWA 5GIPA 1YJNN 4FVUA 1RFQA 2YJFA 5AFUH 4UAFE 5AQJA 3O6WA 1GLBG 4R79A 2J4RA 3E9LA 3MN9A 3P4IA 2MBKA 5BN8A 4HTLA 1MA9B 1H1VA 3VESA 5KPTA 3L0QA 4WQ4A 2GTDA 4B1ZA 4CZJA 1BO5O 3H45C 1P90A 5JVHL 3VF6A 4KH6A 4YOTA 3OBWA 4PKHA 2ZF5O 2NRWA 4BRIA 4BRMA 1T6DA 3UKUA 2I7PA 4IEEA 2BH1A 3JS6A 4CZLA 4BRDA 1VQKN 3MX2A 2P9NB 5AZIA 1GLFO 1G99A 4WCEL 2NRVA 2Q31A 5KPRA 3WQUA 2C1IA 4AM6A 3CCUN 4GV3A 4IEIA 4ILGB 5KQ8A 4JD2A 3ID6A 1OVYA 4PHTX 4RWTA 4O8KA 4HWIA 2QWOA 1TUUA 3CPEA 3EKUA 3TPQA 5AQOA 2W40A 3WXJA 3P38A 3U4LA 3O1BA 3BEXA 2GWKA 4FPAA 4ILJA 4CZHA 2D1KA 3MCPA 3MWPA 3VERA 3QBXA 5E26A 4CD3A 3CCQN 4CI6A 3R2VA 3L6QA 3ZEUA 5LJVA 1BA1A 3GDQA 3MK6A 2ZGZA 3DXKA 1GLAG 3TU5A 3FZHA 5JLHA 3UE5A 4A5AA 5LY3A 3GL1A 2KLAA 5AQMA 3QICA 1NJIO 4JK8A 3G6EN 3CQXA 5CE3A 3WXKA 3FZKA 3OA9A 3LDLA 5AQPA 4H5NA 3DXMB 4FL9A 3CJ9A 3AARA 4Y0WA 5FPMA 3MN6A 4JNEA 2P9SA 4BR9A 3FZFA 3VEYA 1ZC6A 2QEXN 3VGKA 3JXUA 3CJ7A 3RVCA 3CJ1A 3FGUA 4A59A 3KC6A 3UKUB 4XEIA 2YHXA 2QWRA 2ZWHA 1NGBA 4JHDA 1VQMN 3CJCA 1WUAA 4A2BA 3MDQA 5AZIB 3EZWA 4PL7A 4BRGA 4A61A 3TTFA 2HBJA 4H5VA 4BGBA 5AQYA 1CZAN 2P9IB 3KZBA 3ENBA 3GG4A 4BGAA 3MWTA 5EOYA 3AGKA 5BN9A 4YOUA 4DCHA 5AQWA 5BRHA 3CMAN 1SZ2A 2WC9A 1BDGA 3A5LC 4BVPA 4E1JA 1HJOA 5AZJA 3CCMN 2QWMA 4IWVA 3RSEA 1Q18A 4EHUA 3VPZA 5AQQA 1QQNA 5GAEP 1VQNN 2VWBA 3QDKA 4H0PA 4FOIA 3ULEA 4H5TA 2CH6A 1N8RO 4MO4A 2JDQD 2RE2A 3ZX2A 3CW4A 2RHKA 4BQLA 2FLOA 3VEZA 4BRKA 1M1KO 1MWKA 2QWNA 1QHAA 2E20A 2VGNA 1X9JA 3DXKB 5JICA 5GAHP 2VGMA 2C1GA 2F9WA 1BWFO 2ASOA 3WT0A 4JK9A 4FWSA 2ASPA 2E2PA 2KKZA 5AR0A 4A62A 1QVFM 5B8HA 4BRQA 2QWPA 3FZLA 2A41A 4JKGB 1Z6RA 2YCHA 4KBOA 3B8AX 4BC2A 4GV6A 3H1QA 4AM7A 4PKIA 1K8AO 3KWIA 3J7ZO 2P9SB 3EN9A 2MN5A 3ZX3A 3TSUA 2P9PB 1ATSA 2LN8A 1RDUA 3UB5A 4IOAL 5TKWA 5H1SQ 2CGKA 3O9SA 3F5TA 3ZETB 3PIOL 4DHYA 5JMVA 3H3OB 3DLLL 4RCHA 3ATVA 3C0BA 3G4SN 4JKFA 5GINA 3P31A 1S72N 3WXMB 4M63C 3KHWA 5BPLA 3SAFA 4QS7A 5AQIA 5LJWA 5ADXA 5JVGL 2Q0UA 2A5XA 3LDQA 5AQUA 3CC2N 5M1FA 4BR5A 1HPMA 1BA0A 3VETA 3AAQA 3TTCA 3S41A 2OTJN 3SJHA 1E4FT 4CJ7A 5DM6L 3LDPA 4CZGA 5EY4A 3QI7A 2IVPA 3E66A 4BQZA 4FWMA 2V7YA 4EHTA 2JWLA 3O4WA 4K42A 4BRHA 2FF3B 4J8FA 3ZYYX 4BVOA 1JCFA 2E8AA 4YDUC 4UADE 1S3XA 3FZMA 1GLCG 3C6AA 3CF5L 1U6ZA 1V4SA 2P9LA 2Q36A 4DB3A 3KHYA 2WFBA 2E2OA 2PFUA 5BRDA 2YX6A 3VGLA 2YILA 3CPWM 4BC3A 3ID8A 4A5BA 1K73O 3CCRN 2E1ZA 3SLCA 3T69A 4WFBL 3CHWA 1YJWN 4A2AA 1JJ2M 5AQXA 4IO8A 4C23A 3SMSA 4CD1A 4JEPA 2V51B 3EKSA 5GAGP 2CGLA 4FO0A 3KWGA 1K8KA 4BR7A 4MDBA 1ATRA 3D2EA 1TYQA 1QVGM 1T6CA 1YF5L 4JN4A 3EE9A 2YI1A 2ZGYA 3O8MA 4ILHA 3WEEA 3DAWA 4B1UB 2P9UB 3GOIA 4GVEA 4IFEA 2A3ZA 2HF3A 3UKRB 5C2DA 2NRHA 3H6EA 4BECA 3NVMA 2GELA 4XH4A 3SK3A 3LDNA 5M1PA 3HSCA 1DT9A 1E4GT 3N4QA 5KQDA 3SBGA 2HOEA 3D2FB 1RGIA 5TKYA 4AF1A 5CHIA 3R1XA 1YXQA 4FOEA 4CZMA 4YOXA 4C1NI 3VF2A 5AQKA 1X3MA 2PBDA 4IXCA 2DPNA 1VQLN 3IMXA 1DGKN 4A57A 3PIPL 4EFHA 1GLDG 3LM2A 4U7BA 2AP1A 4WFNL 3EL2A 5GIOA 2NRZA 4BR4A 3E9OA 1OKJA 4BRPA 1VQON 1NGJA 5FPEA 2GWJA 2P9KA 4IOXA 1W2BM 3SAGA 2CGJA 4BY9C 3ENHA 1YI2N 5AQNA 3I55N 1D4XA 4BRLA 1KD1O 1NLVA 3N4PA 3E9PA 4IJAA 4ISGA 3NVKA 3MN5A 3E1YA 4JKAA 4BE7B 3GE1A 1U2VA 1VQ5N 3LDOA 2FSKA 4JD2B 1XC3A 3O80A 5BREA 1Q82O 4U67L 2IVNA 3O9QA 4H0YB 3I8BA 4CBUA 4BG9A 3HBTA 3CETA 3G71N 1ZBSA 5FPDA 3O5BA 4NLBA 3HTVA 2NNWA 3D6RA 3WQTA 1NGAA 3CCJN 3T7ZA 5C12A 2W00A 3I56N 1JCEA 4I6MA 2ZJPL 4IZ9A 3VGMA 2HSTA 1SAZA 4NB4A 4H5RA 4YOYA 3M3ZA 4K25A 4FSVA 3BK3C 3QFUA 3R8EA 3VEWA 3ZEUB 5DM7L 3D7EO 1VQ7N 4BREA 4CZKA 2QXLA 3HRGA 3HOTA 5JLFA 3VEOA 4WF9L 4GV9A 3VTHA 5FPNA 5EVZA 5BPMA 4EIAA 2YHYA 2OANA 3CJBA 5F1XA 4YDUA 3TSPA 1MWMA 1NGDA 2VY6A 2D56A 2BTFA 3MCAB 2W41A 3IKMA 1LCUA 1BOTO 1LOTB 4FWNA 1Q7YO 2NRXA 5AQVA 3AAPA 4FWQA 4FWPA 4NLCA 1C0GA 3CJAA 1NGCA 1Y64A 3QMLA 3CCEN 5M1NA 4JHDB 1KQSM 4CBXA 4UAEF 2A40A 2E1YA 3QBWA 5E84A 1SQKA 1YITN 3FE1A 2E2NA 4XH1A 2AA4A 2FSNA 4ISFA 2P9NA 5C2FA 3VEVA 1VAZA 2QA4N 4JKDA 1HKGA 3VF4A 5ADXH 2IVOA 3CQYA 3CC7N 1C0FA 3L4IA 5MLCQ 3R6MA 1HKBA 5AZJB 1P8ZA 4BRNA 3R9PA 3RSEB 5GADP 2ZJRL 2QW9A 1KC8O 4OPHA 4BC4A 3ULEB 1YVNA 2Q2RA 3EO3A 1MDUB 4JKCA 4H5WA 3F2KA 1WOQA 3H46O 4H03B 4IO9L 3M6GA 3CC4N 2HBMA 3CCVN 1ZXOA 4CBWA 4QS9A 3VENA 2GUPA 3A0IX 3O9RA 4FWOA 3VEXA 1KAXA 1K9MO 1NGHA 4YORA 1T44A 3H3NO 1X3NA 5AQZA 3U9DA 4BC5A 1V4TA 4IOCL 3LL3A 1QQMA 2Q97A 3HZ6A 1HKCA 1NM1A 5AFUA 1Q81O 1QQOA 2NRRA 3TTDA 1O13A 3IDHA 3QFPA 3FFKB 1GLLO 5C10A 1M90O 3DXMA 3VTIA 4BROA 5EXWA 3BF1A 3LM9A 1ATNA 4ISEA 2FF6A 3H1VX 4JKHA 1KAZA 3SMPA 1SS6A 2BUPA 3AGRA 5M1QA 3SBTA 3HM8A 1YUWA 5F2RA 5AQSA 2E2QA 4MO5A 4BRFA 3U8XA 4CZIA 3R3LA 2F9TA 1YIJN 4PL8A 4YOVA 5C0YA 4CZEA 3P39A 4B1YB 1Q86O 3C7NA 1NBWA 3MN7A 4B1XB 4G9ZA 1GLEG 3A5OC 3O1WA 4JK7A 1ILYA 2GEMA 2E2FA 2HBKA 3I33A 2P9IA 4Z94A 3QB0A 2A6AA 4B9QA 2FSJA 3FR0A 3CCLN 2JWKA 3C65A 3W0LA 3M5RA 3KVGA 4B1VA 4UY8O 2FXUA 2NLXA 4QS8A 3CIPA 3U9ZA 5M1OA 2ASMA 3TSQA 4JKEA 4WYBA 2HBLA 2I7NA 2K35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0X A;  1HLU A;  2QM1 A;  4LC9 B;  5I9E B;  2P9L B;  3O08 A;  3G25 A;  4BR2 A;  4H0O A;  2D0O A;  4JAX A;  4WQ4 C;  4CZF A;  3IUC A;  5ELZ A;  4B1W B;  4RTF D;  1NGG A;  4MLE A;  1K8K B;  3F9M A;  1TYQ B;  3D2E B;  4FWL A;  2P9P A;  4WQ5 A;  3ZET A;  5BR9 A;  2NZT A;  1DEJ A;  4IJN A;  2WUS A;  4DQ8 A;  3WEE B;  1EQY A;  3ZX0 A;  5AQR A;  2HF4 A;  1DKG D;  4FWR A;  1GLJ O;  1R59 O;  3C7N B;  3OHR A;  5AQT A;  2VCP A;  5AQF A;  2VYP A;  2ITM A;  4BR0 A;  3AY9 A;  3WXI A;  1NGE A;  1NMD A;  1XQS C;  2IIR A;  4NO7 A;  4BG8 A;  1XUP O;  3M1F A;  3W3D A;  1QZ6 A;  4H0V B;  5AQL A;  4GY2 B;  3VOV A;  4H0X B;  2D0P A;  2H3G X;  5EX5 A;  3CER A;  1BUP A;  3HI0 A;  4MLH A;  2PAV A;  1BU6 O;  1RDW X;  2P9K B;  4L3Q A;  2QWQ A;  1S22 A;  3CI5 A;  2HMP A;  4PKG A;  5BRF A;  5AQH A;  2KHO A;  4M7Y A;  3WXL A;  2UYT A;  1U2V B;  3A8Y A;  4WQ5 C;  3IFR A;  4EAH D;  2Q1N A;  2E88 A;  2YJE A;  3FLC O;  1HX1 A;  4F9O A;  3BUZ B;  2EWS A;  4BRA A;  1QZ5 A;  1Z05 A;  2V7Z A;  3BP8 A;  2YHW A;  4FPB A;  1KAY A;  1TUY A;  2QWL A;  3A5N C;  3J8A A;  5KPZ A;  1ESV A;  3DWL A;  4I6M B;  1NWK A;  1HUX A;  3BF3 A;  1NGF A;  3ATU A;  2CH5 A;  2P9U A;  5BPN A;  1NGI A;  3UKR A;  4O5F A;  2Q0R A;  1J6Z A;  3DJC A;  4H0T B;  3A5M C;  1BG3 A;  2V52 B;  4K43 A;  1IJJ A;  1YAG A;  4M7X A;  4FWK A;  3GBT A;  1IG8 A;  3ENO A;  3MMV A;  1KXP A;  4XH5 A;  3WUH A;  2D4W A;  3D2F A;  4K41 A;  4GNI A;  4BRC A;  1JCG A;  2A42 A;  5AQG A;  1RFQ A;  2YJF A;  5AFU H;  5AQJ A;  3O6W A;  1GLB G;  2J4R A;  3MN9 A;  3P4I A;  4HTL A;  5BN8 A;  1MA9 B;  1H1V A;  3VES A;  5KPT A;  3L0Q A;  4WQ4 A;  2GTD A;  4B1Z A;  4CZJ A;  1BO5 O;  3H45 C;  3VF6 A;  4PKH A;  2ZF5 O;  4BRI A;  4BRM A;  1T6D A;  3UKU A;  2I7P A;  3JS6 A;  4CZL A;  4BRD A;  5AZI A;  2P9N B;  1GLF O;  1G99 A;  5KPR A;  2Q31 A;  3WQU A;  4AM6 A;  5KQ8 A;  4JD2 A;  4RWT A;  4O8K A;  4HWI A;  2QWO A;  1TUU A;  3EKU A;  3TPQ A;  5AQO A;  2W40 A;  3WXJ A;  3U4L A;  3O1B A;  3BEX A;  2GWK A;  4FPA A;  4CZH A;  2D1K A;  3MCP A;  3VER A;  3QBX A;  5E26 A;  4CD3 A;  4CI6 A;  3L6Q A;  3ZEU A;  5LJV A;  1BA1 A;  3GDQ A;  3MK6 A;  2ZGZ A;  3DXK A;  1GLA G;  3TU5 A;  3FZH A;  5JLH A;  3UE5 A;  5LY3 A;  3QIC A;  5AQM A;  3CQX A;  5CE3 A;  3WXK A;  3FZK A;  3LDL A;  5AQP A;  4H5N A;  3DXM B;  4FL9 A;  3CJ9 A;  3AAR A;  4Y0W A;  5FPM A;  3MN6 A;  4JNE A;  2P9S A;  4BR9 A;  3FZF A;  3VEY A;  1ZC6 A;  3VGK A;  3JXU A;  3CJ7 A;  3CJ1 A;  3FGU A;  3UKU B;  4XEI A;  2YHX A;  2QWR A;  2ZWH A;  1NGB A;  4JHD A;  3CJC A;  1WUA A;  4A2B A;  3MDQ A;  5AZI B;  3EZW A;  4PL7 A;  4BRG A;  4A61 A;  4H5V A;  4BGB A;  5AQY A;  1CZA N;  2P9I B;  3KZB A;  3GG4 A;  4BGA A;  5EOY A;  5BN9 A;  4DCH A;  5AQW A;  5BRH A;  1SZ2 A;  3A5L C;  1BDG A;  4BVP A;  4E1J A;  1HJO A;  5AZJ A;  2QWM A;  4IWV A;  3RSE A;  1Q18 A;  4EHU A;  3VPZ A;  5AQQ A;  1QQN A;  2VWB A;  3QDK A;  4H0P A;  4FOI A;  3ULE A;  4H5T A;  2CH6 A;  4MO4 A;  3ZX2 A;  4BQL A;  2FLO A;  3VEZ A;  4BRK A;  1MWK A;  2QWN A;  1QHA A;  2E20 A;  5JIC A;  1X9J A;  3DXK B;  2F9W A;  1BWF O;  2ASO A;  3WT0 A;  4FWS A;  2ASP A;  2E2P A;  4A62 A;  5AR0 A;  5B8H A;  4BRQ A;  2QWP A;  3FZL A;  2A41 A;  1Z6R A;  2YCH A;  4KBO A;  3B8A X;  4BC2 A;  3H1Q A;  4AM7 A;  4PKI A;  2P9S B;  3EN9 A;  3ZX3 A;  2P9P B;  1ATS A;  3UB5 A;  2CGK A;  3ZET B;  4DHY A;  5JMV A;  3H3O B;  4RCH A;  3ATV A;  3C0B A;  4M63 C;  5BPL A;  4QS7 A;  5AQI A;  5LJW A;  5ADX A;  2Q0U A;  2A5X A;  3LDQ A;  5AQU A;  4BR5 A;  1HPM A;  1BA0 A;  3VET A;  3AAQ A;  3S41 A;  3SJH A;  1E4F T;  4CJ7 A;  3LDP A;  4CZG A;  5EY4 A;  2IVP A;  4BQZ A;  4FWM A;  2V7Y A;  4EHT A;  3O4W A;  4K42 A;  4BRH A;  2FF3 B;  4J8F A;  4BVO A;  1JCF A;  2E8A A;  4YDU C;  1S3X A;  3FZM A;  1GLC G;  1U6Z A;  1V4S A;  2P9L A;  2Q36 A;  4DB3 A;  3KHY A;  2E2O A;  5BRD A;  3VGL A;  4BC3 A;  3ID8 A;  2E1Z A;  3SLC A;  3CHW A;  4A2A A;  5AQX A;  4IO8 A;  4C23 A;  3SMS A;  4CD1 A;  2V51 B;  3EKS A;  2CGL A;  4FO0 A;  1K8K A;  4BR7 A;  1ATR A;  3D2E A;  1TYQ A;  1T6C A;  4JN4 A;  2YI1 A;  2ZGY A;  3O8M A;  3WEE A;  3DAW A;  4B1U B;  2P9U B;  3GOI A;  2A3Z A;  2HF3 A;  3UKR B;  2NRH A;  3H6E A;  2GEL A;  4XH4 A;  3SK3 A;  3LDN A;  3HSC A;  1E4G T;  5KQD A;  2HOE A;  3D2F B;  1RGI A;  5TKY A;  1YXQ A;  4FOE A;  4CZM A;  3VF2 A;  5AQK A;  1X3M A;  2PBD A;  4IXC A;  2DPN A;  3IMX A;  1DGK N;  4EFH A;  1GLD G;  3LM2 A;  2AP1 A;  3EL2 A;  4BR4 A;  1OKJ A;  4BRP A;  1NGJ A;  5FPE A;  2GWJ A;  2P9K A;  2CGJ A;  3ENH A;  5AQN A;  1D4X A;  4BRL A;  1NLV A;  4IJA A;  4ISG A;  3MN5 A;  3GE1 A;  1U2V A;  3LDO A;  2FSK A;  4JD2 B;  1XC3 A;  3O80 A;  5BRE A;  2IVN A;  4H0Y B;  3I8B A;  4CBU A;  4BG9 A;  3HBT A;  3CET A;  1ZBS A;  5FPD A;  3O5B A;  3HTV A;  3WQT A;  1NGA A;  1JCE A;  4I6M A;  4IZ9 A;  3VGM A;  1SAZ A;  4NB4 A;  4H5R A;  3M3Z A;  4K25 A;  4FSV A;  3VEW A;  3QFU A;  3R8E A;  3ZEU B;  3D7E O;  4BRE A;  4CZK A;  2QXL A;  5JLF A;  3VEO A;  5FPN A;  5EVZ A;  5BPM A;  4EIA A;  2YHY A;  2OAN A;  3CJB A;  5F1X A;  4YDU A;  1MWM A;  1NGD A;  2BTF A;  2W41 A;  4FWN A;  1LCU A;  1BOT O;  1LOT B;  5AQV A;  3AAP A;  4FWQ A;  4FWP A;  1C0G A;  3CJA A;  1NGC A;  1Y64 A;  3QML A;  4JHD B;  4CBX A;  3QBW A;  2A40 A;  2E1Y A;  5E84 A;  1SQK A;  3FE1 A;  2E2N A;  4XH1 A;  2AA4 A;  2FSN A;  4ISF A;  2P9N A;  3VEV A;  1HKG A;  3VF4 A;  5ADX H;  2IVO A;  3CQY A;  1C0F A;  3L4I A;  3R6M A;  1HKB A;  5AZJ B;  1P8Z A;  4BRN A;  3R9P A;  3RSE B;  2QW9 A;  4BC4 A;  3ULE B;  1YVN A;  2Q2R A;  3EO3 A;  1MDU B;  4H5W A;  1WOQ A;  3H46 O;  4H03 B;  3M6G A;  1ZXO A;  4CBW A;  4QS9 A;  3VEN A;  2GUP A;  3A0I X;  4FWO A;  3VEX A;  1KAX A;  1NGH A;  1T44 A;  3H3N O;  1X3N A;  5AQZ A;  3U9D A;  4BC5 A;  1V4T A;  3LL3 A;  1QQM A;  2Q97 A;  3HZ6 A;  1HKC A;  1NM1 A;  5AFU A;  1QQO A;  3IDH A;  3QFP A;  3FFK B;  1GLL O;  3DXM A;  4BRO A;  5EXW A;  3BF1 A;  3LM9 A;  1ATN A;  4ISE A;  2FF6 A;  3H1V X;  1KAZ A;  3SMP A;  2BUP A;  3HM8 A;  1YUW A;  5F2R A;  5AQS A;  2E2Q A;  4MO5 A;  4BRF A;  3U8X A;  4CZI A;  2F9T A;  4PL8 A;  4CZE A;  4B1Y B;  3C7N A;  1NBW A;  3MN7 A;  4B1X B;  1GLE G;  3A5O C;  3O1W A;  2GEM A;  3I33 A;  2P9I A;  4Z94 A;  3QB0 A;  2A6A A;  4B9Q A;  2FSJ A;  3FR0 A;  3W0L A;  3KVG A;  4B1V A;  2FXU A;  2NLX A;  4QS8 A;  3CIP A;  3U9Z A;  2ASM A;  4WYB A;  2I7N A;  3GL1 A; 
#chains in the Genus database with same CATH topology
 4CGD A;  2O4G A;  2P9L B;  3HK2 A;  3G25 A;  4BR2 A;  3NF8 A;  1Q8I A;  2NRT A;  2D0O A;  4DTX A;  3IUC A;  4V1D C;  2HHI A;  5ELZ A;  4B1W B;  3K5N A;  3P1G A;  4RTF D;  1NGG A;  1TAU A;  1K8K B;  2YNI A;  3C94 A;  3F9M A;  3SPY A;  4FWL A;  1C0U A;  3ZET A;  4JS5 A;  2GX9 A;  1TKD A;  2NZT A;  4NXN K;  4IJN A;  2WUS A;  1ZYQ A;  1EQY A;  3AVA A;  2GMO A;  3ZX0 A;  3SF4 D;  3OS0 A;  1YHQ N;  3LZJ A;  4O4G A;  4FWR A;  3PV8 A;  2KPY A;  1VQ4 N;  2KQ2 A;  3JSM A;  5AQT A;  2VCP A;  4FM2 A;  3WNG A;  4AHR A;  1FKP A;  1XQS C;  1PTX A;  4BG8 A;  4LSL A;  1B7D A;  3AVL A;  4IBN A;  1YTU A;  1KVC A;  4AQY K;  3L56 A;  4CIG A;  5AQL A;  4DQR A;  4GY2 B;  1ZBL A;  1QHT A;  4DSJ A;  3K5M A;  4O0J A;  4CGH A;  2D0P A;  4C1N K;  1RDA A;  3V9Z A;  4CEF A;  4BE1 A;  1VQ9 N;  4KRF A;  4LD0 A;  2PAV A;  3VQP A;  2HMP A;  5HBM A;  4B3M K;  2YNH A;  4M3U A;  1EO1 A;  1ZFU A;  3Q7C A;  4DV1 K;  3K5O A;  1LV5 A;  1HX1 A;  4F9O A;  2OTL N;  2EWS A;  2R7Y A;  1QZ5 A;  1NMN A;  4OGC A;  3A5N C;  3J8A A;  5KPZ A;  1ESV A;  3ZCM A;  1HQE A;  3LP1 A;  4I6M B;  1X9S A;  4M3X A;  1JKZ A;  3NF9 A;  3HVR A;  2ZJQ L;  1BI4 B;  3EE8 A;  3L4Q A;  4H0T B;  5BR8 K;  2V52 B;  1B9F A;  2PZS A;  4K8X A;  1YAG A;  3ZSY A;  1IG8 A;  3ENO A;  3CM6 A;  3CD6 N;  1LWF A;  4FJX A;  2ZQB A;  4BRC A;  3K9K A;  2A42 A;  2KTQ A;  3NGI A;  4CGG A;  2IGI A;  5HRN A;  2YJF A;  4CVN E;  4FVU A;  1GLB G;  2E5L K;  3E9L A;  1OVQ A;  1EWR A;  4LF4 K;  2KZZ A;  3E7U X;  3OJU A;  3RMC A;  1P90 A;  3KJV A;  2NRW A;  5LMU K;  4IEE A;  1LW2 A;  1VSH A;  4DWI A;  1N6Q A;  3WQU A;  4AM6 A;  1UWB A;  5HRO A;  1IKX A;  4IG3 A;  5KQ8 A;  4JD2 A;  1T7E A;  4FLX A;  1WMT A;  1FW6 A;  3EKU A;  2IDO A;  5AQO A;  1SL2 A;  2B68 A;  3U4L A;  4C8K A;  2GWK A;  4CZH A;  4B8C A;  1RT6 A;  5LMN K;  3CCQ N;  5CZ2 A;  4NCG A;  3E01 A;  3LAM A;  3AA2 A;  4O5B A;  5LJV A;  2I5J A;  4CJE A;  4AAZ A;  1C0M A;  4FM1 A;  3P5J A;  4DLE A;  2O8D A;  1B3C A;  5CE3 A;  3L3V A;  1VHX A;  3CJ9 A;  1OH7 A;  5FPM A;  4JNE A;  4OKE A;  4BR9 A;  4OGE A;  4KHS A;  2FBX A;  3VGK A;  2GBZ A;  3RVC A;  1Q9X A;  1RBS A;  1KFD A;  3KC6 A;  1HJR A;  4JV5 K;  2YHA A;  4A2B A;  1LWE A;  4PL7 A;  4A61 A;  4ELV A;  4CJP A;  1J5E K;  5EOY A;  1RT4 A;  5BN9 A;  3AGK A;  4DCH A;  2WC9 A;  1BDG A;  1NK0 A;  1GPS A;  2HHX A;  4XIU A;  1XMO K;  3VQ5 A;  4EHU A;  3OYJ A;  1T8E A;  5KK4 A;  5AQQ A;  1QQN A;  4H0P A;  2ZD1 A;  4FOI A;  4H5T A;  2CH6 A;  1JL1 A;  2HHW A;  4BQL A;  3QIN A;  3VEZ A;  4BRK A;  2VGN A;  3DXK B;  3TAE A;  2F9W A;  1CXU A;  4FWS A;  2HHQ A;  2ASP A;  4BE0 A;  3TAN A;  1QVF M;  5J2Q A;  1XHZ A;  3FZL A;  4JKG B;  4K8Z A;  3B8A X;  4BC2 A;  4KBO A;  3H1Q A;  4AM7 A;  3J7Z O;  1RT3 A;  3DLE A;  4B9V A;  2FBY A;  3ZX3 A;  1ATS A;  3KLE A;  1BQM A;  5TKW A;  3PIO L;  2CGK A;  4BAC A;  3MEC A;  4G1Q A;  1S9E A;  3NBP A;  4DHY A;  2QK9 A;  3ATV A;  3C0B A;  3G4S N;  5GIN A;  3P31 A;  4M63 C;  1KFS A;  3SAF A;  2LY5 A;  4KYP A;  5AQU A;  3CC2 N;  4CFA A;  1BA0 A;  3IG1 A;  3TTC A;  5E41 A;  3S3O A;  3AA3 A;  4FWM A;  2V7Y A;  2FF3 B;  5FDL A;  1HYZ A;  4BVO A;  1JCF A;  2E8A A;  3HST B;  1NJZ A;  3CF5 L;  3L3U A;  2WFB A;  1PE4 A;  3B6O A;  2P5G A;  2PFU A;  1C1B A;  3VGL A;  2YIL A;  4O0I A;  3ID8 A;  2G8I A;  3OS1 A;  4FJK A;  4Y1D A;  5AQX A;  2Z1J A;  4C23 A;  3IS9 A;  3DOK A;  4M45 A;  4JEP A;  4BDP A;  5HRP A;  1XHX A;  2XO7 A;  4DR7 K;  4DV4 K;  3BY5 A;  1N5Y A;  3EE9 A;  4ILH A;  2P9U B;  2A3Z A;  4GKK K;  5FRN A;  4DLG A;  1U47 A;  3L2R A;  4BEC A;  1D9D A;  2GEL A;  2YHB A;  3LDN A;  1U4B A;  1X9W A;  2OZM A;  1U48 A;  4M3W A;  1JLC A;  3SBG A;  5CY0 A;  5TKY A;  4AF1 A;  1BRZ A;  3VF2 A;  1SN1 A;  5AQK A;  1X3M A;  4GMJ B;  1VQL N;  5CY4 A;  3WNE A;  4A57 A;  4Z4H A;  3EY1 A;  3KD5 E;  1GLD G;  5GIO A;  4BRP A;  1ITG A;  4AHV A;  4FK0 A;  2CGJ A;  1YI2 N;  4BRL A;  1NK6 A;  1KD1 O;  4KB0 A;  2F4V K;  3MN5 A;  3E1Y A;  3F73 A;  4NCA A;  3VQC A;  3I0S A;  1Q82 O;  3DM2 A;  2DFE A;  3O9Q A;  1HYV A;  1TI5 A;  1DQ7 A;  2WOM A;  4BG9 A;  1WWN A;  1XNQ K;  1WNS A;  3L2Q A;  3QEW A;  3I0R A;  1ZBS A;  3T1Y K;  1KLM A;  4F3T A;  3CCJ N;  3I56 N;  3DRS A;  1WAJ A;  4IZ9 A;  2HST A;  3DOL A;  1NG9 A;  4YOY A;  3VEW A;  3ZEU B;  3R8E A;  4M3R A;  3ZSR A;  3D7E O;  1NKC A;  3HOT A;  1ZBI A;  4CHY A;  5JLF A;  3P83 D;  2W6K A;  3VEO A;  5FPN A;  3MEE A;  1WSE A;  4EIA A;  2YHY A;  4N56 A;  2DFF A;  1MWM A;  5HRR A;  1IKY A;  2Z1I A;  3THX A;  4KPY A;  2D56 A;  2BTF A;  3HXM A;  1TAQ A;  2W41 A;  3ZT4 A;  4B9N A;  1Q7Y O;  3AAP A;  3O3H A;  1C0G A;  3THW B;  1NGC A;  2OYQ A;  3QML A;  4JHD B;  3RMA A;  4UAE F;  2A40 A;  5E84 A;  4HUG A;  2BDP A;  1EP4 A;  1NOZ A;  4ISF A;  2ASC A;  2P9N A;  3VEV A;  4JKD A;  3VF4 A;  3CQY A;  3AVF A;  4I2Q A;  2HHT A;  5MLC Q;  3R6M A;  4BRN A;  5GAD P;  1P8Z A;  1B92 A;  5J1E A;  5CYM A;  2ZJR L;  3J80 O;  3OYN A;  2YBR C;  2LY6 A;  5KGW A;  5J2N A;  1ZBH A;  2Q2R A;  3EO3 A;  4FLV A;  3AVM A;  1WSI A;  4FJM A;  3CCV N;  2JLE A;  4QS9 A;  2GUP A;  4FWO A;  1XRS B;  3VEX A;  1KAX A;  1IKW A;  3KK2 A;  1K9M O;  4PUO A;  3H3N O;  1X3N A;  5AQZ A;  3U9D A;  2G8V A;  2YC1 C;  3S3M A;  2OPR A;  1O13 A;  1GLL O;  5C10 A;  3TAP A;  3DXM A;  3VTI A;  1FH3 A;  4BRO A;  1C6V A;  5JEN A;  3QIP A;  3LM9 A;  3SMP A;  3LDS A;  3RWU A;  1DTT A;  3OYE A;  1L3T A;  5AQS A;  2G2K A;  4GKJ K;  1T7A A;  4CHN A;  4Z4G A;  4IFV A;  3SQ4 A;  1ZVG A;  4PA1 A;  3A5O C;  3EYZ A;  2GEM A;  2E2F A;  2P9I A;  3O3G A;  1TK8 A;  1T0Z A;  2D0C A;  2VG7 A;  4B9Q A;  4M42 A;  5IWA K;  4B1V A;  3LP0 A;  2FXU A;  4QS8 A;  3U9Z A;  5M1O A;  4CIE A;  4UQG A;  5I9E B;  3O08 A;  1CXQ A;  5K14 A;  4ELT A;  1HYS A;  4B9U A;  5CR4 A;  5HL7 L;  1QSS A;  4PQU A;  4CZF A;  3OY9 A;  1JKH A;  2WTU A;  1P0A A;  4HCC A;  4KH5 A;  3L2W A;  2B5J A;  4DU4 A;  3AVH A;  3K9J A;  1TYQ B;  3D2E B;  2P9P A;  4WQ5 A;  4B3T K;  3HT3 A;  2GV9 A;  4EZ9 A;  3WEE B;  4ID1 A;  5AQR A;  2HF4 A;  4HCB A;  1DKG D;  1GLJ O;  3I8D A;  1C56 A;  4O8U A;  3M8P A;  3OHR A;  4BR0 A;  5AQF A;  3AY9 A;  3WXI A;  1EET A;  4DSL A;  1XUP O;  3AA4 A;  5DK5 A;  3SUO A;  1W97 L;  1VQ6 N;  1VSI A;  4X66 K;  1VQ8 N;  4H0X B;  1JLQ A;  4FZX C;  1FJG K;  2H3G X;  5EX5 A;  1LWC A;  2YKM A;  4ZHR A;  4PY5 A;  2P9K B;  1RDW X;  3G0Z A;  2QWQ A;  3CI5 A;  1VQP N;  3HYF A;  5BRF A;  3L8B A;  2KHO A;  1SEG A;  2UYT A;  1U2V B;  4WQ5 C;  3OW2 M;  3C6U A;  3IFR A;  2Q1N A;  2E88 A;  4IDH A;  5CZ1 A;  3BUZ B;  2X6N A;  3O9U A;  3BP8 A;  2GL1 A;  3HOS A;  1KSP A;  1TUY A;  2QWL A;  3V9X A;  4LF7 K;  4BEB A;  4IKF A;  5KRS A;  1NJW A;  5J2P A;  4W5N A;  1HUX A;  3ATU A;  2HHV A;  1D8Y A;  3UKR A;  4DR4 K;  1W0H A;  2Q0R A;  5HRS A;  1CZ9 A;  3DJC A;  3V9U A;  3BZC A;  5C2F A;  4M7X A;  3M8R A;  4FWK A;  3GBT A;  3ITH A;  1ASU A;  4XH5 A;  1KXP A;  3SAH A;  4FXD A;  2YIP A;  3SUQ A;  4CJF A;  5AQG A;  5GIP A;  1YJN N;  1RT2 A;  1RFQ A;  4UAF E;  5AQJ A;  1JXB A;  4N47 A;  3S9H A;  3MN9 A;  3P4I A;  4HTL A;  1RBT A;  3DLH A;  4Z4E A;  1H1V A;  3L0Q A;  1S1W A;  3MXJ A;  1BO5 O;  4LFA K;  4NYN A;  3VF6 A;  4KH6 A;  4YOT A;  3OBW A;  3B6P A;  4CHP A;  4DQS A;  4CER A;  4YHH K;  4BRM A;  2B4J A;  4DV2 K;  4CZL A;  5AZI A;  1GLF O;  4WCE L;  3CCU N;  1NH5 A;  1LW0 A;  4IEI A;  1OVY A;  4OKK A;  1J53 A;  3TPQ A;  1TUU A;  3K58 A;  3KLG A;  3WXJ A;  1I6G A;  3O1B A;  3HPH A;  2YNG A;  3MCP A;  4W5R A;  1XI1 A;  3QBX A;  5E26 A;  2FC0 A;  3G10 A;  4CQK A;  2RKI A;  4ICL A;  4X65 K;  3SUN A;  1MU2 A;  2HB5 A;  1GOA A;  1UA1 A;  1BA1 A;  3MK6 A;  2RN2 A;  1GLA G;  5LY3 A;  4RW6 A;  3J7A P;  3QIC A;  4FW1 A;  1T7B A;  4CHZ A;  1NK5 A;  3G6E N;  5IT9 O;  3CQX A;  3OYA A;  3WXK A;  4H5N A;  1CLQ A;  1HNV A;  4OPJ A;  2P9S A;  3VEY A;  1J5O A;  4A59 A;  3QER A;  2F96 A;  2W6L A;  2YHX A;  2QWR A;  1NGB A;  3RRH A;  2ATQ A;  3EZW A;  4E1M A;  4FK4 A;  3A2F A;  1IBM K;  2LR3 A;  1K6Y A;  4BGB A;  1I2U A;  4BGA A;  4Q5V A;  2O8C A;  3O4Q A;  4YOU A;  3CMA N;  3A5L C;  1MYN A;  4BVP A;  4E1J A;  3RSE A;  4IWV A;  1Q18 A;  3ASM A;  4JLH A;  3KOX A;  5GAE P;  2VWB A;  2HMI A;  3ULE A;  3V6D A;  4MO4 A;  3ZSW A;  3CW4 A;  4CES A;  3LAL A;  3F9K A;  1GOC A;  1QHA A;  4JI8 K;  2RPI A;  3KOW A;  2C1G A;  1GPT A;  1BWF O;  4FJ5 A;  3E7R L;  4JK9 A;  4DR6 K;  4AHU A;  5AR0 A;  4CFD A;  2ZM6 K;  2HVI A;  4BRQ A;  3HP6 A;  2A41 A;  4DU3 A;  1OZZ A;  1KRP A;  4CJU A;  1K8A O;  3EN9 A;  2MN5 A;  4LH4 A;  3TSU A;  2OPS A;  3UB5 A;  4FLU A;  5H1S Q;  2B3C A;  3F5T A;  5KGX A;  1UA0 A;  1A5X A;  1NK7 A;  3L2V A;  3CYM A;  3WXM B;  2Q3S A;  3KHW A;  3ZSV A;  4JI4 K;  4QS7 A;  5AQI A;  1LAW A;  2KYQ A;  5LJW A;  4ZTF A;  5JVG L;  2Q0U A;  2A5X A;  4KB1 A;  1QSY A;  3LPU A;  4BR5 A;  1NRA A;  4FYD A;  3VET A;  4F8R A;  1BIZ A;  2OTJ N;  3HJF A;  3SJH A;  4CJ7 A;  3LDP A;  4CZG A;  5EY4 A;  2G8K A;  2IVP A;  3E66 A;  4E0D A;  1VSD A;  3O4W A;  4J8F A;  3AVC A;  1SV5 A;  4DTJ A;  4YDU C;  4KHY A;  3FZM A;  3C6A A;  2P9L A;  4DB3 A;  3KHY A;  4KFB A;  1N36 K;  2SN3 A;  2YX6 A;  1JLB A;  1K73 O;  2E1Z A;  4CJR A;  1TK0 A;  3T69 A;  3CHW A;  1YJW N;  4IO8 A;  2O8E A;  4CD1 A;  2QKK A;  2CGL A;  2G8F A;  3KWG A;  1K8K A;  4BR7 A;  1ATR A;  3AA5 X;  1QVG M;  2D0B A;  4KHP K;  2YI1 A;  4IFY A;  3O8M A;  4B1U B;  4GVE A;  4IFE A;  1HNI A;  4FLT A;  3NGY A;  4CJT A;  4DFJ A;  4XH4 A;  2O8B B;  2XY6 A;  3T1A A;  4CEO A;  3HSC A;  5KQD A;  2HOE A;  3D2F B;  1T03 A;  5CHI A;  3R1X A;  1YXQ A;  4FOE A;  4CZM A;  4C8N A;  1U45 A;  1D9F A;  3PIP L;  1DGK N;  3MAQ A;  2F8T A;  3LM2 A;  4U7B A;  3SQ1 A;  4AHC A;  3EL2 A;  4CED A;  4DFK A;  2NRZ A;  3E9O A;  5FRO A;  1BK8 A;  3KLF A;  2GWJ A;  4QOZ B;  3SAG A;  4BY9 C;  1WB9 A;  1NLV A;  5LL6 Z;  1KLN A;  1NK4 A;  3SUP A;  4DR1 K;  4OVL A;  3VQD A;  4DU1 A;  3LDO A;  4DS4 A;  2FSK A;  3NF6 A;  2IS3 A;  4U67 L;  4Z4C A;  4CJK A;  5FPD A;  4NLB A;  2NNW A;  3T7Z A;  1Y97 A;  4O44 A;  2Y1I A;  4I6M A;  3JYT A;  3UIQ A;  1SL1 A;  1SAZ A;  4J2E A;  3THV A;  4LF8 K;  3M3Z A;  1SL0 A;  3BK3 C;  5DM7 L;  3NH1 A;  3PSI A;  3JAM O;  1BI4 A;  4W5Q A;  4KHN A;  5EVZ A;  3LWL A;  3V9S A;  5BPM A;  2OAN A;  2X74 A;  3TAM A;  3CJB A;  5F1X A;  3TSP A;  2LSN A;  3OYL A;  1NE5 A;  3NH2 A;  1EXQ A;  2VY6 A;  3LAN A;  3MCA B;  1LCU A;  4NLC A;  3CJA A;  3O3F A;  5M1N A;  2WON A;  4B9M A;  1SQK A;  4XH1 A;  2AA4 A;  3VQ7 A;  1U49 A;  3OTO K;  1ZBF A;  2IVO A;  3DRP A;  1HKB A;  5AZJ B;  1I94 K;  2QKB A;  4DV6 K;  1S5J A;  4CK3 A;  1YVN A;  4JKC A;  1N33 K;  4DSK A;  4FZY A;  3F2K A;  1WLJ A;  1NOY A;  3H46 O;  4IO9 L;  2HBM A;  4LSN A;  3A0I X;  4AEI A;  3VEN A;  2GUI A;  3SQ2 A;  4LY7 A;  2A1R A;  2O4I A;  4JRQ A;  1T44 A;  3QNO A;  3AVK A;  4IOC L;  3LL3 A;  2Q97 A;  5KRT A;  1IBK K;  1HKC A;  1NM1 A;  1TKX A;  4CJ4 A;  4CCH A;  1QQO A;  1FXX A;  3V4I A;  3RR7 A;  3THY B;  3T3F A;  3QFP A;  4I9L A;  1M90 O;  2UUB K;  5EXW A;  2FF6 A;  4JKH A;  1KAZ A;  2XY7 A;  1QE1 A;  3HM8 A;  2E4L A;  2E2Q A;  4BRF A;  3U8X A;  4CZI A;  4KRE A;  4YOV A;  3P39 A;  3C7N A;  4G9Z A;  3MN7 A;  4B3O A;  2OPQ A;  4CEC A;  3KP0 A;  3PO5 A;  3QB0 A;  4CK1 A;  1HQU A;  3CCL N;  3W0L A;  2XY8 A;  3M5R A;  3KVG A;  3CIP A;  4YFU A;  2ASM A;  1B9D A;  1RNH A;  3S5T A;  1VSL A;  1S1X A;  1C55 A;  2P51 A;  1BCO A;  2HBL A;  4WYB A;  2K35 A;  1Z26 A;  1VSM A;  1PX9 A;  1HLU A;  3K59 A;  2BGG A;  4BE2 A;  3KKS A;  2QI2 A;  2NY9 X;  4H0O A;  4JAX A;  3VQE A;  4WQ4 C;  3KK7 A;  3QEX A;  5M1K A;  4JKG A;  3ULD A;  3OBY A;  2YIO A;  3AVG A;  3HL8 A;  1SKW A;  2BE2 A;  4RW9 A;  4C8O A;  3ZSX A;  3NDK A;  1YJ9 N;  2DTU A;  1POI A;  1CZB A;  4DQ8 A;  3QNN A;  1G15 A;  3K2P A;  1RTJ A;  4EP5 A;  4OLB A;  2ITM A;  5I42 A;  3TWH A;  4CJS A;  3Q7B A;  1NGE A;  1NMD A;  2IIR A;  4NO7 A;  3CFP A;  4F4K A;  2UXD K;  3OYH A;  1QZ6 A;  2WBN A;  3DLR A;  3VOV A;  2UXB K;  1J54 A;  1HR0 K;  5J2M A;  1BUP A;  1W9H A;  1SUQ A;  1BU6 O;  3ZSZ A;  3MX5 A;  3OJS A;  1S22 A;  1S1U A;  3C6H A;  3QEV A;  3CXC M;  5AQH A;  3DLG A;  4CJL A;  2XRI A;  4CE9 A;  3QEP A;  3A8Y A;  4EAH D;  4Z4I A;  2YJE A;  4OPA A;  1REV A;  4BRA A;  3GKU A;  1Z05 A;  2V7Z A;  1T1T A;  2YHW A;  4FPB A;  4F2R A;  1KAY A;  4DF8 A;  2BRZ A;  3DWL A;  3NFA A;  1NWK A;  4E7K A;  4MDA A;  1SN4 A;  3OS2 A;  2P9U A;  5BPN A;  1NGI A;  4JYA K;  3SYZ A;  4F3O A;  1BIU A;  1BG3 A;  3TSQ A;  4K43 A;  3DI6 A;  3MMV A;  3WUH A;  4K41 A;  2QXF A;  3CCS N;  4GNI A;  1GOB A;  4DKW A;  4CFC A;  4JI3 K;  1IBL K;  2E6L A;  3O6W A;  2EX3 A;  2MBK A;  1MA9 B;  3VES A;  3QES A;  1HNW K;  4BDY A;  2ZF5 O;  3UKU A;  1EWQ A;  2N69 A;  3ISN C;  5CYQ A;  2NRV A;  4FJI A;  2C1I A;  4V19 S;  3ID6 A;  4O8K A;  2O8F B;  4HWI A;  2QWO A;  1JLF A;  2ATB A;  2KW4 A;  3BEX A;  4FW2 A;  4M3Z A;  1DJT A;  5FRM A;  4CD3 A;  4NXM K;  3L6Q A;  1S6Q A;  3ZEU A;  1A5W A;  3KTQ A;  3GDQ A;  2HND A;  2ZGZ A;  2MZ0 A;  3VQQ A;  5JLH A;  4A5A A;  2KLA A;  2ITG A;  4BWM A;  3TAG A;  4TSX A;  4JK8 A;  2YV0 X;  4OPK A;  1HPZ A;  3LP2 A;  4RW7 A;  3KK3 A;  3LDL A;  5AQP A;  1IO2 A;  1ZYV A;  4FL9 A;  4DTR A;  1QTM A;  2PY5 A;  3AVN A;  4Y0W A;  3MN6 A;  1I39 A;  4FJ8 A;  2QEX N;  4DTO A;  3CJ7 A;  3THW A;  3FGU A;  3C6T A;  4BDZ A;  4XEI A;  4X62 K;  3VQA A;  1VQM N;  4JHD A;  4E3S A;  3CJC A;  3MDQ A;  5AZI B;  3HPO A;  3TTF A;  4JI5 K;  1WN7 A;  4DV0 K;  3SCX A;  4H5V A;  2A1S A;  4CGJ A;  2OA8 A;  4KKO A;  2FBT A;  3KZB A;  3ENB A;  3GG4 A;  3MWT A;  2I61 A;  1JXC A;  4Z0U A;  1HJO A;  4YNQ A;  4HVJ A;  3NHG A;  4FZZ A;  1P00 A;  1N8R O;  1RDD A;  1M1K O;  1K8B A;  3M8S A;  5GAH P;  1ZBU A;  2VGM A;  2OCE A;  5D3G A;  4F2S A;  3TAB A;  4FJL A;  3DYA A;  2KKZ A;  4A62 A;  1VNB A;  5B8H A;  2X6S A;  4KV8 A;  3J81 O;  4PKI A;  2P9S B;  2LN8 A;  1RDU A;  3ZET B;  4DV5 K;  4DFM A;  2OZS A;  4DV7 K;  3KLI A;  2YNF A;  3H3O B;  4RCH A;  3ZT2 A;  3DLL L;  4OLA A;  4E7L A;  1S72 N;  4GW6 A;  3RMB A;  2G8U A;  2DY4 A;  1JL2 A;  1NKE A;  4HHF A;  4H8K A;  1KVB A;  5M1F A;  3ZT3 A;  1HPM A;  2KSK A;  1XWL A;  3AAQ A;  3S41 A;  1E4F T;  5DM6 L;  4E89 A;  3QI7 A;  1UGL A;  1L3S A;  2JWL A;  4KTZ A;  2A7T A;  1IKV A;  4CW7 B;  3ZYY X;  1WBD A;  1T7P A;  4IDK A;  3TR8 A;  1GLC G;  1U6Z A;  4E7I A;  3KK1 A;  4DTP A;  5BRD A;  3S3N A;  1SKS A;  4BC3 A;  1SKR A;  3SLC A;  3AVJ A;  4WFB L;  3SQ0 A;  2KGQ A;  1YVU A;  1LQH A;  3SMS A;  5GAG P;  1L3U A;  4B9L A;  1YT3 A;  1OH5 A;  4MDB A;  1TYQ A;  3D2E A;  1T6C A;  2EHG A;  1AYJ A;  5T7B A;  3MXI A;  1A5V A;  4JN4 A;  4JS4 A;  3WEE A;  3GOI A;  3IRX A;  5C2D A;  2NRH A;  3H6E A;  4R5P A;  4L8R B;  5M1P A;  1E4G T;  1F21 A;  4J2B A;  3KOZ A;  1RGI A;  1FK9 A;  4FK2 A;  1RTD A;  3AVB A;  3K57 A;  4DS5 A;  1MR4 A;  3U6F A;  4WFN L;  4NCB A;  4BR4 A;  1VQO N;  3BZK A;  1NGJ A;  3SZ2 A;  5FPE A;  2P9K A;  4IOX A;  1W2B M;  1KV0 A;  3ALY A;  4KO0 A;  4B3S K;  3I55 N;  3L2U A;  3N4P A;  4ISG A;  4CK2 A;  2N2R A;  3AO4 A;  3CFO A;  1JLG A;  2E3G A;  1S1V A;  4JKA A;  4BE7 B;  1U2V A;  4KAZ A;  1VQ5 N;  3CFR A;  3VQ4 A;  4FLW A;  1NK9 A;  3OVN A;  4JD2 B;  3O80 A;  2O8E B;  2IVN A;  2NY8 X;  4AH9 A;  4CBU A;  1IV0 A;  3HBT A;  3K0S A;  2F8S A;  1HRH A;  2E6M A;  3D6R A;  4ELU A;  1NGA A;  2OPP A;  3VQB A;  2HNY A;  2W00 A;  4CJW A;  1JCE A;  3VGM A;  3VA0 A;  4H5R A;  3OYK A;  4FM0 A;  4K25 A;  4FSV A;  4JI6 K;  1BMR A;  3QFU A;  1I6F A;  1RBR A;  4H4O A;  1L3V A;  1JZB A;  4BRE A;  4CZK A;  2QXL A;  4N5S A;  4WF9 L;  4GV9 A;  4PWD A;  2Z1G A;  1E3M A;  3NGZ A;  1SNB A;  3ZSO A;  4B08 A;  1BGX T;  3CM5 A;  4KI6 A;  2O8D B;  4O55 A;  4YDU A;  2LKB A;  4C8M A;  1X9M A;  4EP4 A;  1VRT A;  1NGD A;  4WE1 A;  1BOT O;  5JS2 A;  3RTV A;  4FWQ A;  1UOC A;  1C0T A;  4FWP A;  4GVM A;  2X78 A;  2N66 A;  4CIF A;  3H08 A;  2Z1H A;  3CCE N;  4E72 A;  1KQS M;  2YEO A;  5C25 A;  1YIT N;  3FE1 A;  2E2N A;  4UJ0 A;  1CN2 A;  1OH8 A;  3DLK A;  1ASW A;  1RCH A;  3WNF A;  5ADX H;  3L4I A;  2YKN A;  3R9P A;  4CF0 A;  1KC8 O;  4OPH A;  4BC4 A;  4LF5 K;  1MDU B;  4DR2 K;  3M8Q A;  3V81 A;  1NJY A;  4AIL C;  1WOQ A;  3M6G A;  2DFH A;  1CHZ A;  3LZI A;  5KTQ A;  1NGH A;  3C95 A;  4YOR A;  1IH7 A;  4ID5 A;  2HHU A;  1V4T A;  2RF2 A;  1Q81 O;  2PYJ A;  2NRR A;  1BL3 A;  4DUZ K;  4ISE A;  4JI7 K;  3AVI A;  3LP3 A;  4KHQ A;  4YY3 K;  2BUP A;  3SBT A;  1YUW A;  1TVR A;  4MO5 A;  2F9T A;  4DSF A;  3SI6 A;  3EEQ A;  4PL8 A;  1YIJ N;  2XHB A;  4B1Y B;  1Q86 O;  4B1X B;  4CEB A;  4DSI A;  1GLE G;  4JK7 A;  1ILY A;  1VSJ A;  2HBK A;  3FFI A;  3T1H K;  5SWM A;  2A6A A;  4K0K K;  2HVH A;  2FSJ A;  3FR0 A;  2JWK A;  3C65 A;  4UY8 O;  3PUF A;  1RBV A;  4JKE A;  2I7N A;  1RDB A;  3GL1 A;  5F0X A;  1VSE A;  2QM1 A;  4LC9 B;  3ZT1 A;  1NKB A;  4RW8 A;  4I2P A;  1BQN A;  1YTA A;  4MQ3 A;  2IAJ A;  3O9T A;  4DQQ A;  1JXE A;  4RG8 A;  4FJG A;  4MLE A;  3BDP A;  3OYB A;  3VA3 A;  3VMF B;  4OO1 J;  1S9G A;  5BR9 A;  4JKB A;  1DEJ A;  4DR5 K;  3MEG A;  4FJ7 A;  1BIS A;  1R59 O;  3PLA A;  3PX4 A;  3C7N B;  3TAQ A;  5AJ3 K;  4E1N A;  2VYP A;  3NCI A;  3NMU A;  2KJA A;  3SJJ A;  3K5L A;  3M1F A;  3W3D A;  2KFN A;  4YOW A;  4H0V B;  4QCL A;  1TL3 A;  2XY5 A;  5C15 A;  1EX4 A;  1RT5 A;  4E7H A;  3PSM A;  5C24 A;  4BWJ A;  1ICA A;  3SV3 A;  2VWK A;  3CER A;  3PY8 A;  4CF8 A;  4FCY A;  3HI0 A;  4MLH A;  4CF1 A;  3V1R A;  3TI0 A;  4C8L A;  4L3Q A;  3PSF A;  4PKG A;  1C1A A;  1IG9 A;  4FJJ A;  4M7Y A;  3WXL A;  4DG1 A;  1RBU A;  1HNX K;  4X64 K;  3BGR A;  3FLC O;  1WSG A;  4WFA L;  4LF6 K;  1L5U A;  3D45 A;  4XJX A;  4B9S A;  4E19 A;  4CHO A;  3CME N;  2QTD A;  4KTW A;  1NRB A;  3BF3 A;  5HOO A;  1NGF A;  4KTQ A;  2CH5 A;  5EU7 A;  4DTS A;  2D5R A;  4O5F A;  3RR8 A;  1J6Z A;  3OYC A;  3A5M C;  3KD1 E;  4HHT A;  2O8B A;  4KH4 A;  4OJR A;  1IJJ A;  1OH6 A;  2F7T A;  1WAF A;  1T3V A;  2D4W A;  3RRG A;  3D2F A;  4FVM A;  1JCG A;  4CGI A;  3THX B;  5AFU H;  4R79 A;  2J4R A;  3ZSQ A;  5BN8 A;  2KBJ A;  5KPT A;  4WQ4 A;  2GTD A;  2IOC A;  4B1Z A;  1BCG A;  4CZJ A;  2IC3 A;  1WSF A;  5JVH L;  3H45 C;  1BCM A;  4PKH A;  4AHT A;  4BRI A;  3PX0 A;  1T6D A;  2I7P A;  2BH1 A;  3JS6 A;  1Q9Y A;  4BRD A;  3LAK A;  1VQK N;  3MX2 A;  2P9N B;  1G99 A;  5KPR A;  2Q31 A;  3TAR A;  3U3G A;  4GV3 A;  4ILG B;  4PHT X;  1RIL A;  4RWT A;  1TL1 A;  3CPE A;  2W40 A;  3AO3 A;  3P38 A;  4Q0B A;  3KIO A;  3KP1 A;  4FPA A;  4FJH A;  4ILJ A;  5KI6 A;  3LWM A;  4KHW A;  4AB0 A;  2D1K A;  1TKZ A;  3MWP A;  3VER A;  3D0P A;  4CI6 A;  3R2V A;  5FLX O;  1R0A A;  3DXK A;  3QO9 A;  2E0H A;  3FZH A;  3TU5 A;  4JI0 K;  3UE5 A;  4DF4 A;  5AQM A;  4OKJ A;  1NJI O;  3HPG A;  1TK5 A;  1DTQ A;  4MFB A;  4Y1C A;  3FZK A;  3OA9 A;  3DXM B;  3AAR A;  5JS1 A;  3FZF A;  1ZC6 A;  3JXU A;  2B6A A;  1EKE A;  3CJ1 A;  2NUB A;  2VQF K;  3QET A;  3UKU B;  2LI7 A;  2ZWH A;  4DMN A;  1TKT A;  1WUA A;  3U3Y A;  4BRG A;  2KZM A;  4DUY K;  2HBJ A;  3V9W A;  1NPI A;  5HLF A;  5AQY A;  4HUE A;  1N34 K;  1CZA N;  2P9I B;  2PYL A;  3NH0 A;  5AQW A;  5BRH A;  3ZLJ A;  1SZ2 A;  2UUC K;  3HM9 A;  5AZJ A;  3CCM N;  2QWM A;  2AJQ A;  1N32 K;  3VPZ A;  4HUF A;  1VQN N;  3CQ8 A;  3SV4 A;  3QDK A;  4N76 A;  2Y1J A;  2JDQ D;  2RE2 A;  3ZX2 A;  2RHK A;  3CG7 A;  2VG5 A;  4CFB A;  2VWJ A;  2FLO A;  2HHH K;  4B3R K;  3ZT0 A;  2ETJ A;  1MWK A;  2QWN A;  2E20 A;  4CF2 A;  1J9A A;  1X9J A;  5JIC A;  3HO1 A;  1NU0 A;  4LH5 A;  1C1C A;  2ASO A;  2UXC K;  3WT0 A;  3QEI A;  2E2P A;  4DTM A;  1KTQ A;  2QWP A;  2P5O A;  1Z6R A;  2YCH A;  4RW4 A;  1W7A A;  4GV6 A;  4DSE A;  5I3U A;  3THY A;  1HNZ K;  1RTI A;  3KWI A;  3KOY A;  1DLO A;  3OYI A;  1NJX A;  2P9P B;  4IOA L;  3IAY A;  4B8A B;  3O9S A;  1XNR K;  4LF9 K;  5JMV A;  4FJN A;  4JI2 K;  4CHQ A;  3NE6 A;  4JKF A;  3O4N A;  1UAX A;  1FKO A;  5BPL A;  2E3F A;  4HTU A;  4I9Q A;  3TAF A;  5ADX A;  1S6P A;  3LDQ A;  1KVA A;  4BQZ A;  4EHT A;  1NNE A;  1WSH A;  4K42 A;  4BRH A;  4CF9 A;  4LFB K;  4JI1 K;  3V1O A;  3AO2 A;  3VQ9 A;  4UAD E;  1S3X A;  4CJQ A;  1ZU3 A;  3NAE A;  1V4S A;  3PX6 A;  2Q36 A;  2E2O A;  2HHS A;  1LQI A;  3HVT A;  4JRP A;  2JGU A;  3CPW M;  1WBB A;  4A5B A;  3EZ5 A;  3CCR N;  3DMJ A;  4A2A A;  3OYG A;  1JJ2 M;  1L4V A;  4QAG A;  1RDC A;  2V51 B;  3EKS A;  4FLY A;  4FO0 A;  4EZ6 A;  3NF7 A;  3LPT A;  3SNN A;  3PO4 A;  1YF5 L;  2UUA K;  1TV6 A;  2ZGY A;  2N2Q A;  1I3A A;  3DAW A;  2HF3 A;  3UKR B;  4W5O A;  1OMY A;  2D0A A;  3NVM A;  1I2V A;  3SK3 A;  1DT9 A;  3N4Q A;  3VN5 A;  3DLB A;  1JLA A;  4KHU A;  3MED A;  3VQ8 A;  2VG6 A;  4YOX A;  4C1N I;  1T05 A;  2UU9 K;  1LAV A;  4CEZ A;  4IG0 A;  2PBD A;  4IXC A;  1KCF A;  2DPN A;  3IMX A;  4EFH A;  2KBH A;  4DTN A;  2AP1 A;  4DQP A;  2ZE2 A;  1OKJ A;  3ENH A;  5AQN A;  1D4X A;  4IJA A;  3E9P A;  4CJV A;  4DQI A;  3NVK A;  4ZTJ A;  3GE1 A;  4CEQ A;  4DV3 K;  3DRR A;  5BRE A;  1XC3 A;  4M3Y A;  4DTU A;  4J2A A;  4H0Y B;  1LQQ A;  3I8B A;  3CET A;  3G71 N;  1WSJ A;  1AHO A;  3O5B A;  1XC9 A;  3HTV A;  4M3T A;  3WQT A;  4DR3 K;  5C12 A;  3OYM A;  1QS4 A;  2ZJP L;  4KI4 A;  4NB4 A;  5A2Q O;  1XMQ K;  1VQ7 N;  3HRG A;  1TGO A;  2LJM A;  3VTH A;  4FLZ A;  1QQC A;  1WT7 A;  3WNH A;  4FJ9 A;  4I7F A;  1ZVE A;  3IKM A;  1S1T A;  1LOT B;  4FWN A;  2NRX A;  5AQV A;  5SZT A;  3RMD A;  3KKR A;  3OYD A;  1Y64 A;  1VSF A;  4LFC K;  2P1J A;  4CBX A;  3QBW A;  2E1Y A;  1HMV A;  1ZYW A;  1X1P A;  1ASV A;  1VK0 A;  2FSN A;  3V1Q A;  2HW3 A;  1D5A A;  1VAZ A;  2QA4 N;  1HKG A;  2O8C B;  3AV9 A;  4H4M A;  3CC7 N;  1C0F A;  2VQE K;  4HE7 A;  2O8F A;  3RSE B;  5C42 A;  4E7J A;  3T19 A;  2QW9 A;  4CGF A;  2KBK A;  3ULE B;  4Z4F A;  1O1W A;  1JZA A;  1VSK A;  3QLH A;  3SPZ A;  4CEA A;  4H5W A;  4NYF A;  1RT1 A;  4H03 B;  5DMR A;  4M41 A;  3CC4 N;  1ZXO A;  4CBW A;  2W42 A;  1QSL A;  4B9T A;  3AO1 A;  4AHS A;  3O9R A;  2BAN A;  3AO5 A;  2G8W A;  2M8B B;  4BC5 A;  1QQM A;  3HZ6 A;  5AFU A;  5HP1 A;  1NK8 A;  3TTD A;  3IDH A;  3FFK B;  1RT7 A;  1BHL A;  2G8H A;  3BF1 A;  2FBV A;  3VQ6 A;  1ATN A;  3H1V X;  4CJ5 A;  3HP9 A;  1Z25 A;  1SS6 A;  3MXM A;  3AGR A;  5M1Q A;  5F2R A;  2KFZ A;  2HNZ A;  3R3L A;  4CEE A;  2LT8 A;  3KLH A;  5C0Y A;  4CZE A;  3CYG A;  1NBW A;  4CJ3 A;  1JLE A;  4N41 A;  1VNA A;  3O1W A;  3I33 A;  3OYF A;  4Z94 A;  3J7Y P;  4W5T A;  1ZUT A;  2NLX A;  1RTH A;  1U04 A;  4J2D A;  4OX9 K;  2LJ7 A;  1N4N A;  1VRU A;  4DFP A;  3QIO A; 
#chains in the Genus database with same CATH homology
 5F0X A;  1HLU A;  2QM1 A;  4LC9 B;  5I9E B;  2P9L B;  3O08 A;  3G25 A;  2QI2 A;  4BR2 A;  2NRT A;  4H0O A;  2D0O A;  4JAX A;  4WQ4 C;  5CR4 A;  5HL7 L;  3O9T A;  4CZF A;  3IUC A;  3KK7 A;  5M1K A;  5ELZ A;  4B1W B;  4JKG A;  4KH5 A;  3OBY A;  4RTF D;  1NGG A;  4MLE A;  1K8K B;  2YIO A;  3F9M A;  3K9J A;  3VMF B;  1TYQ B;  3D2E B;  4FWL A;  2P9P A;  4WQ5 A;  1YJ9 N;  4OO1 J;  3ZET A;  4JKB A;  2GX9 A;  5BR9 A;  2NZT A;  1DEJ A;  1POI A;  2WUS A;  4IJN A;  4DQ8 A;  3WEE B;  1EQY A;  2GMO A;  5AQR A;  3SF4 D;  2HF4 A;  3ZX0 A;  1DKG D;  1YHQ N;  4FWR A;  1GLJ O;  1R59 O;  3PLA A;  3C7N B;  1VQ4 N;  4O8U A;  3OHR A;  5AQT A;  2VCP A;  5AQF A;  2VYP A;  2ITM A;  4BR0 A;  3NMU A;  3AY9 A;  3Q7B A;  3WXI A;  1NGE A;  1NMD A;  1XQS C;  2IIR A;  4NO7 A;  4BG8 A;  1XUP O;  3M1F A;  3W3D A;  1W97 L;  1VQ6 N;  3L56 A;  1QZ6 A;  4H0V B;  4YOW A;  5AQL A;  1VQ8 N;  2WBN A;  4GY2 B;  5C15 A;  3VOV A;  4H0X B;  2D0P A;  4C1N K;  2H3G X;  5EX5 A;  3CER A;  1VQ9 N;  1BUP A;  3HI0 A;  4MLH A;  2PAV A;  1BU6 O;  1RDW X;  2P9K B;  3MX5 A;  4L3Q A;  2QWQ A;  1S22 A;  3CI5 A;  2HMP A;  4PKG A;  3C6H A;  1VQP N;  5BRF A;  3CXC M;  5AQH A;  2KHO A;  4M7Y A;  3WXL A;  2UYT A;  1U2V B;  3A8Y A;  1EO1 A;  3Q7C A;  4WQ5 C;  3OW2 M;  3IFR A;  4EAH D;  2Q1N A;  2E88 A;  4IDH A;  2YJE A;  3FLC O;  1HX1 A;  4OPA A;  4F9O A;  2OTL N;  3BUZ B;  2EWS A;  4BRA A;  3O9U A;  4WFA L;  1QZ5 A;  1Z05 A;  2V7Z A;  3BP8 A;  3HOS A;  4XJX A;  2YHW A;  4FPB A;  1KAY A;  1TUY A;  2QWL A;  3A5N C;  3J8A A;  5KPZ A;  1ESV A;  2QTD A;  3CME N;  4BEB A;  3DWL A;  4I6M B;  1NWK A;  4MDA A;  1HUX A;  3BF3 A;  5HOO A;  1NGF A;  3ATU A;  2CH5 A;  2P9U A;  5BPN A;  1NGI A;  3UKR A;  4O5F A;  2ZJQ L;  2Q0R A;  3EE8 A;  1J6Z A;  3DJC A;  3L4Q A;  4H0T B;  3A5M C;  1BG3 A;  2V52 B;  4KH4 A;  4K43 A;  1IJJ A;  1YAG A;  4M7X A;  2F7T A;  3GBT A;  1IG8 A;  3ENO A;  4FWK A;  3MMV A;  1KXP A;  4XH5 A;  3SAH A;  3CD6 N;  1T3V A;  2D4W A;  3WUH A;  2YIP A;  3D2F A;  4K41 A;  3CCS N;  4GNI A;  4BRC A;  3K9K A;  1JCG A;  2A42 A;  5AQG A;  4DKW A;  5GIP A;  1YJN N;  4FVU A;  1RFQ A;  2YJF A;  5AFU H;  4UAF E;  5AQJ A;  3O6W A;  1GLB G;  4R79 A;  2J4R A;  3E9L A;  3MN9 A;  3P4I A;  2MBK A;  5BN8 A;  4HTL A;  1MA9 B;  1H1V A;  3VES A;  5KPT A;  3L0Q A;  4WQ4 A;  2GTD A;  4B1Z A;  4CZJ A;  1BO5 O;  3H45 C;  1P90 A;  5JVH L;  3VF6 A;  4KH6 A;  4YOT A;  3OBW A;  4PKH A;  2ZF5 O;  2NRW A;  4BRI A;  4BRM A;  1T6D A;  3UKU A;  2I7P A;  4IEE A;  2BH1 A;  3JS6 A;  4CZL A;  4BRD A;  1VQK N;  3MX2 A;  2P9N B;  5AZI A;  1GLF O;  1G99 A;  4WCE L;  2NRV A;  2Q31 A;  5KPR A;  3WQU A;  2C1I A;  4AM6 A;  3CCU N;  4GV3 A;  4IEI A;  4ILG B;  5KQ8 A;  4JD2 A;  3ID6 A;  1OVY A;  4PHT X;  4RWT A;  4O8K A;  4HWI A;  2QWO A;  1TUU A;  3CPE A;  3EKU A;  3TPQ A;  5AQO A;  2W40 A;  3WXJ A;  3P38 A;  3U4L A;  3O1B A;  3BEX A;  2GWK A;  4FPA A;  4ILJ A;  4CZH A;  2D1K A;  3MCP A;  3MWP A;  3VER A;  3QBX A;  5E26 A;  4CD3 A;  3CCQ N;  4CI6 A;  3R2V A;  3L6Q A;  3ZEU A;  5LJV A;  1BA1 A;  3GDQ A;  3MK6 A;  2ZGZ A;  3DXK A;  1GLA G;  3TU5 A;  3FZH A;  5JLH A;  3UE5 A;  4A5A A;  5LY3 A;  3GL1 A;  2KLA A;  5AQM A;  3QIC A;  1NJI O;  4JK8 A;  3G6E N;  3CQX A;  5CE3 A;  3WXK A;  3FZK A;  3OA9 A;  3LDL A;  5AQP A;  4H5N A;  3DXM B;  4FL9 A;  3CJ9 A;  3AAR A;  4Y0W A;  5FPM A;  3MN6 A;  4JNE A;  2P9S A;  4BR9 A;  3FZF A;  3VEY A;  1ZC6 A;  2QEX N;  3VGK A;  3JXU A;  3CJ7 A;  3RVC A;  3CJ1 A;  3FGU A;  4A59 A;  3KC6 A;  3UKU B;  4XEI A;  2YHX A;  2QWR A;  2ZWH A;  1NGB A;  4JHD A;  1VQM N;  3CJC A;  1WUA A;  4A2B A;  3MDQ A;  5AZI B;  3EZW A;  4PL7 A;  4BRG A;  4A61 A;  3TTF A;  2HBJ A;  4H5V A;  4BGB A;  5AQY A;  1CZA N;  2P9I B;  3KZB A;  3ENB A;  3GG4 A;  4BGA A;  3MWT A;  5EOY A;  3AGK A;  5BN9 A;  4YOU A;  4DCH A;  5AQW A;  5BRH A;  3CMA N;  1SZ2 A;  2WC9 A;  1BDG A;  3A5L C;  4BVP A;  4E1J A;  1HJO A;  5AZJ A;  3CCM N;  2QWM A;  4IWV A;  3RSE A;  1Q18 A;  4EHU A;  3VPZ A;  5AQQ A;  1QQN A;  5GAE P;  1VQN N;  2VWB A;  3QDK A;  4H0P A;  4FOI A;  3ULE A;  4H5T A;  2CH6 A;  1N8R O;  4MO4 A;  2JDQ D;  2RE2 A;  3ZX2 A;  3CW4 A;  2RHK A;  4BQL A;  2FLO A;  3VEZ A;  4BRK A;  1M1K O;  1MWK A;  2QWN A;  1QHA A;  2E20 A;  2VGN A;  1X9J A;  3DXK B;  5JIC A;  5GAH P;  2VGM A;  2C1G A;  2F9W A;  1BWF O;  2ASO A;  3WT0 A;  4JK9 A;  4FWS A;  2ASP A;  2E2P A;  2KKZ A;  5AR0 A;  4A62 A;  1QVF M;  5B8H A;  4BRQ A;  2QWP A;  3FZL A;  2A41 A;  4JKG B;  1Z6R A;  2YCH A;  4KBO A;  3B8A X;  4BC2 A;  4GV6 A;  3H1Q A;  4AM7 A;  4PKI A;  1K8A O;  3KWI A;  3J7Z O;  2P9S B;  3EN9 A;  2MN5 A;  3ZX3 A;  3TSU A;  2P9P B;  1ATS A;  2LN8 A;  1RDU A;  3UB5 A;  4IOA L;  5TKW A;  5H1S Q;  2CGK A;  3O9S A;  3F5T A;  3ZET B;  3PIO L;  4DHY A;  5JMV A;  3H3O B;  3DLL L;  4RCH A;  3ATV A;  3C0B A;  3G4S N;  4JKF A;  5GIN A;  3P31 A;  1S72 N;  3WXM B;  4M63 C;  3KHW A;  5BPL A;  3SAF A;  4QS7 A;  5AQI A;  5LJW A;  5ADX A;  5JVG L;  2Q0U A;  2A5X A;  3LDQ A;  5AQU A;  3CC2 N;  5M1F A;  4BR5 A;  1HPM A;  1BA0 A;  3VET A;  3AAQ A;  3TTC A;  3S41 A;  2OTJ N;  3SJH A;  1E4F T;  4CJ7 A;  5DM6 L;  3LDP A;  4CZG A;  5EY4 A;  3QI7 A;  2IVP A;  3E66 A;  4BQZ A;  4FWM A;  2V7Y A;  4EHT A;  2JWL A;  3O4W A;  4K42 A;  4BRH A;  2FF3 B;  4J8F A;  3ZYY X;  4BVO A;  1JCF A;  2E8A A;  4YDU C;  4UAD E;  1S3X A;  3FZM A;  1GLC G;  3C6A A;  3CF5 L;  1U6Z A;  1V4S A;  2P9L A;  2Q36 A;  4DB3 A;  3KHY A;  2WFB A;  2E2O A;  2PFU A;  5BRD A;  2YX6 A;  3VGL A;  2YIL A;  3CPW M;  4BC3 A;  3ID8 A;  4A5B A;  1K73 O;  3CCR N;  2E1Z A;  3SLC A;  3T69 A;  4WFB L;  3CHW A;  1YJW N;  4A2A A;  1JJ2 M;  5AQX A;  4IO8 A;  4C23 A;  3SMS A;  4CD1 A;  4JEP A;  2V51 B;  3EKS A;  5GAG P;  2CGL A;  4FO0 A;  3KWG A;  1K8K A;  4BR7 A;  4MDB A;  1ATR A;  3D2E A;  1TYQ A;  1QVG M;  1T6C A;  1YF5 L;  4JN4 A;  3EE9 A;  2YI1 A;  2ZGY A;  3O8M A;  4ILH A;  3WEE A;  3DAW A;  4B1U B;  2P9U B;  3GOI A;  4GVE A;  4IFE A;  2A3Z A;  2HF3 A;  3UKR B;  5C2D A;  2NRH A;  3H6E A;  4BEC A;  3NVM A;  2GEL A;  4XH4 A;  3SK3 A;  3LDN A;  5M1P A;  3HSC A;  1DT9 A;  1E4G T;  3N4Q A;  5KQD A;  3SBG A;  2HOE A;  3D2F B;  1RGI A;  5TKY A;  4AF1 A;  5CHI A;  3R1X A;  1YXQ A;  4FOE A;  4CZM A;  4YOX A;  4C1N I;  3VF2 A;  5AQK A;  1X3M A;  2PBD A;  4IXC A;  2DPN A;  1VQL N;  3IMX A;  1DGK N;  4A57 A;  3PIP L;  4EFH A;  1GLD G;  3LM2 A;  4U7B A;  2AP1 A;  4WFN L;  3EL2 A;  5GIO A;  2NRZ A;  4BR4 A;  3E9O A;  1OKJ A;  4BRP A;  1VQO N;  1NGJ A;  5FPE A;  2GWJ A;  2P9K A;  4IOX A;  1W2B M;  3SAG A;  2CGJ A;  4BY9 C;  3ENH A;  1YI2 N;  5AQN A;  3I55 N;  1D4X A;  4BRL A;  1KD1 O;  1NLV A;  3N4P A;  3E9P A;  4IJA A;  4ISG A;  3NVK A;  3MN5 A;  3E1Y A;  4JKA A;  4BE7 B;  3GE1 A;  1U2V A;  1VQ5 N;  3LDO A;  2FSK A;  4JD2 B;  1XC3 A;  3O80 A;  5BRE A;  1Q82 O;  4U67 L;  2IVN A;  3O9Q A;  4H0Y B;  3I8B A;  4CBU A;  4BG9 A;  3HBT A;  3CET A;  3G71 N;  1ZBS A;  5FPD A;  3O5B A;  4NLB A;  3HTV A;  2NNW A;  3D6R A;  3WQT A;  1NGA A;  3CCJ N;  3T7Z A;  5C12 A;  2W00 A;  3I56 N;  1JCE A;  4I6M A;  2ZJP L;  4IZ9 A;  3VGM A;  2HST A;  1SAZ A;  4NB4 A;  4H5R A;  4YOY A;  3M3Z A;  4K25 A;  4FSV A;  3BK3 C;  3QFU A;  3R8E A;  3VEW A;  3ZEU B;  5DM7 L;  3D7E O;  1VQ7 N;  4BRE A;  4CZK A;  2QXL A;  3HRG A;  3HOT A;  5JLF A;  3VEO A;  4WF9 L;  4GV9 A;  3VTH A;  5FPN A;  5EVZ A;  5BPM A;  4EIA A;  2YHY A;  2OAN A;  3CJB A;  5F1X A;  4YDU A;  3TSP A;  1MWM A;  1NGD A;  2VY6 A;  2D56 A;  2BTF A;  3MCA B;  2W41 A;  3IKM A;  1LCU A;  1BOT O;  1LOT B;  4FWN A;  1Q7Y O;  2NRX A;  5AQV A;  3AAP A;  4FWQ A;  4FWP A;  4NLC A;  1C0G A;  3CJA A;  1NGC A;  1Y64 A;  3QML A;  3CCE N;  5M1N A;  4JHD B;  1KQS M;  4CBX A;  4UAE F;  2A40 A;  2E1Y A;  3QBW A;  5E84 A;  1SQK A;  1YIT N;  3FE1 A;  2E2N A;  4XH1 A;  2AA4 A;  2FSN A;  4ISF A;  2P9N A;  5C2F A;  3VEV A;  1VAZ A;  2QA4 N;  4JKD A;  1HKG A;  3VF4 A;  5ADX H;  2IVO A;  3CQY A;  3CC7 N;  1C0F A;  3L4I A;  5MLC Q;  3R6M A;  1HKB A;  5AZJ B;  1P8Z A;  4BRN A;  3R9P A;  3RSE B;  5GAD P;  2ZJR L;  2QW9 A;  1KC8 O;  4OPH A;  4BC4 A;  3ULE B;  1YVN A;  2Q2R A;  3EO3 A;  1MDU B;  4JKC A;  4H5W A;  3F2K A;  1WOQ A;  3H46 O;  4H03 B;  4IO9 L;  3M6G A;  3CC4 N;  2HBM A;  3CCV N;  1ZXO A;  4CBW A;  4QS9 A;  3VEN A;  2GUP A;  3A0I X;  3O9R A;  4FWO A;  3VEX A;  1KAX A;  1K9M O;  1NGH A;  4YOR A;  1T44 A;  3H3N O;  1X3N A;  5AQZ A;  3U9D A;  4BC5 A;  1V4T A;  4IOC L;  3LL3 A;  1QQM A;  2Q97 A;  3HZ6 A;  1HKC A;  1NM1 A;  5AFU A;  1Q81 O;  1QQO A;  2NRR A;  3TTD A;  1O13 A;  3IDH A;  3QFP A;  3FFK B;  1GLL O;  5C10 A;  1M90 O;  3DXM A;  3VTI A;  4BRO A;  5EXW A;  3BF1 A;  3LM9 A;  1ATN A;  4ISE A;  2FF6 A;  3H1V X;  4JKH A;  1KAZ A;  3SMP A;  1SS6 A;  2BUP A;  3AGR A;  5M1Q A;  3SBT A;  3HM8 A;  1YUW A;  5F2R A;  5AQS A;  2E2Q A;  4MO5 A;  4BRF A;  3U8X A;  4CZI A;  3R3L A;  2F9T A;  1YIJ N;  4PL8 A;  4YOV A;  5C0Y A;  4CZE A;  3P39 A;  4B1Y B;  1Q86 O;  3C7N A;  1NBW A;  3MN7 A;  4B1X B;  4G9Z A;  1GLE G;  3A5O C;  3O1W A;  4JK7 A;  1ILY A;  2GEM A;  2E2F A;  2HBK A;  3I33 A;  2P9I A;  4Z94 A;  3QB0 A;  2A6A A;  4B9Q A;  2FSJ A;  3FR0 A;  3CCL N;  2JWK A;  3C65 A;  3W0L A;  3M5R A;  3KVG A;  4B1V A;  4UY8 O;  2FXU A;  2NLX A;  4QS8 A;  3CIP A;  3U9Z A;  5M1O A;  2ASM A;  3TSQ A;  4JKE A;  4WYB A;  2HBL A;  2I7N A;  2K35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...