1DKGD

Crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
381
structure length
376
Chain Sequence
KIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKTGNRTIAVYDLGGGTFDISIIEIDEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIELLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOTIDE EXCHANGE FACTOR GRPE
publication title Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Complex (hsp24/hsp70)
total genus 96
structure length 376
sequence length 381
ec nomenclature
pdb deposition date 1997-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.30 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 1dkgD02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1dkgD03
3.90.640.10 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Actin; Chain A, domain 4 1dkgD04
2VYPA 3KHYA 3KZBA 3VENA 3UB5A 4A2AA 2QWRA 4BRHA 4CZKA 3RSEA 5KQ8A 3D2EA 3VGMA 3EKSA 1GLBG 4BG8A 1TYQB 3QBXA 2GWKA 1BU6O 5F2RA 2ASOA 4FWNA 3VESA 3QFPA 3BEXA 3AY9A 3G25A 2YJFA 3FZHA 3QICA 4O8KA 2I7PA 5AQHA 4BRPA 4JHDA 3ZEUB 3KVGA 5ADXA 4WQ4A 1E4GT 3OHRA 3AAPA 2OANA 2A5XA 4BC5A 2P9IB 5BPMA 5AR0A 2Q0UA 5AQUA 4BRLA 3VETA 5AQYA 4NO7A 3UKUA 4PKHA 1U2VB 3DXMB 1NGBA 3O1BA 3H1VX 4BGAA 4AM7A 2NZTA 3LL3A 1K8KA 4WQ5A 4C23A 4QS9A 3WXJA 3CJ9A 5AQWA 4B1XB 3J8AA 2E8AA 1GLJO 4H0YB 3B8AX 4JN4A 3R8EA 3UKRB 4KBOA 3LDQA 3FZLA 2AA4A 5F1XA 1T44A 2QWOA 4GY2B 5BRFA 1RFQA 5FPEA 2P9UB 1HKGA 3WXLA 4K43A 4BR5A 4FL9A 5AQTA 2YJEA 4CZHA 2BTFA 1QQMA 5AQNA 4PL7A 2P9LB 3CQXA 5EY4A 1OKJA 1ATRA 3CI5A 2P9KA 3WQTA 3QBWA 5AFUH 5BRHA 1X3NA 5AQIA 2GEMA 4O5FA 4XH5A 3A5OC 3CETA 4H5VA 3MN7A 3IMXA 1MDUB 4PKIA 1HKBA 2V52B 2J4RA 1E4FT 4BRNA 1SZ2A 3M6GA 3VGLA 1ZBSA 3CQYA 3L4IA 3H3OB 3QFUA 2PBDA 5EOYA 3ZETB 1Y64A 1QHAA 1BWFO 3AAQA 4ISEA 4PKGA 4B1VA 2Q36A 3GBTA 1YXQA 3DXKB 2P9NA 5AZIB 5ADXH 3RSEB 4J8FA 4BRKA 4CBUA 4BVOA 1MWKA 3TU5A 2QWNA 3VEYA 2P9SA 1GLLO 3MN5A 3A5NC 3O4WA 4RWTA 3L0QA 3C7NA 1XUPO 4DB3A 3FZMA 3GL1A 1NLVA 1WUAA 3FLCO 4EHUA 1NGIA 1YUWA 4BC3A 5AQSA 2WUSA 1YAGA 5KQDA 1H1VA 4K25A 2E1ZA 4BRFA 4FWQA 4BRCA 1HPMA 2QWPA 3LDLA 3FZFA 5EVZA 4BQZA 1WOQA 3LDNA 1EQYA 2IVOA 3A8YA 3ULEB 5JMVA 4FWRA 4WQ4C 4BRQA 2E88A 4QS8A 3UE5A 5BRDA 1DGKN 3A5MC 4CZIA 4XH4A 1V4SA 4IJAA 4CZJA 3H46O 2VWBA 3H1QA 4H5NA 5AQPA 3GOIA 1QQNA 2D0OA 4A62A 2HOEA 2A3ZA 2A6AA 1LCUA 1ZXOA 3DWLA 4WQ5C 1NGEA 2ZWHA 3FR0A 5LJVA 4IWVA 4DHYA 4A61A 4FWKA 4JD2A 3H6EA 1V4TA 2FSNA 5FPNA 2FSKA 1ATSA 4H5WA 2QM1A 4AM6A 3WEEA 3MN6A 4M7YA 4CI6A 3D2FA 3FE1A 3L6QA 5B8HA 1XC3A 4BR2A 4IO8A 3MCPA 2A42A 5AQXA 2Q97A 2NLXA 1LOTB 3ENHA 1NGDA 2EWSA 1BDGA 4CD3A 2QWLA 3CJ1A 3GE1A 4H0XB 3MMVA 1R59O 2HMPA 5KPTA 4FOEA 2ZGYA 1XQSC 4H5RA 4BC2A 3VEXA 1NMDA 5AQKA 2D0PA 4JAXA 1DKGD 5CE3A 1GLAG 5F0XA 3F9MA 2P9PB 5ELZA 1NGFA 3O1WA 1TYQA 1QZ5A 3EO3A 2QWMA 3EN9A 3WXKA 4I6MB 5BPLA 3HI0A 3BF3A 4HTLA 2IVPA 3LM2A 1HJOA 4YDUA 2HF4A 1HX1A 2P9NB 3ZEUA 4B1YB 3BUZB 3SK3A 2YI1A 4H0VB 4BRMA 3QB0A 5LY3A 3GDQA 2CGJA 4DCHA 2P9IA 3O6WA 5AQMA 1TUUA 1U6ZA 4FPAA 2QWQA 1U2VA 2A41A 3DXMA 3O80A 2E2PA 3HSCA 1C0GA 4M63C 2YHXA 3WXIA 3LDOA 2W41A 3QDKA 5AQGA 3SLCA 3CIPA 4BC4A 5JICA 2ZF5O 3U9DA 2PAVA 3CJ7A 5E84A 4JHDB 3UKRA 2GTDA 2DPNA 4K42A 1IG8A 3VEWA 2FF3B 5AQFA 1IJJA 1BUPA 2YHWA 3D2EB 2CGKA 2E2NA 2A40A 3CJCA 3O5BA 1KAYA 5BR9A 2P9UA 5EXWA 3HM8A 4BGBA 1GLDG 1TUYA 4JNEA 1NWKA 1NGCA 1QQOA 3JS6A 3FGUA 3MDQA 1BO5O 2QW9A 4RCHA 4CZEA 3HTVA 4K41A 2P9LA 4IZ9A 1GLFO 2V7YA 3ID8A 5JLHA 4PL8A 5AQRA 4Y0WA 3VF6A 4FWSA 3BP8A 1T6DA 5BN8A 5LJWA 3HBTA 4FWLA 3VEZA 5AZJA 4BG9A 4JD2B 3WUHA 1KAXA 3UKUB 4BRDA 3FFKB 1T6CA 4B9QA 5FPDA 2ASMA 2CH6A 2F9TA 1NGHA 3D2FB 3QMLA 1K8KB 3CJBA 4M7XA 4H0PA 3CERA 1JCGA 3AARA 3ZETA 3I33A 5AQZA 3HZ6A 5BPNA 1X9JA 4BROA 3CJAA 5EX5A 2E20A 1G99A 1X3MA 1ESVA 2F9WA 1KXPA 3EL2A 1ATNA 4CZMA 3DXKA 4BR9A 2FSJA 2ZGZA 3R9PA 3VPZA 5AZIA 4LC9B 4BR4A 4DQ8A 4H5TA 3CHWA 3VF2A 3ZX0A 2YHYA 2IVNA 5AQJA 3FZKA 2NRHA 2E1YA 5JLFA 4A2BA 2ITMA 1MA9B 5AQVA 4MLHA 2Q2RA 3O08A 1JCFA 5AQLA 4BQLA 1NM1A 4H03B 2P9KB 4CZLA 2I7NA 3ENOA 3WT0A 5FPMA 2E2QA 3C0BA 1DEJA 2V51B 3VERA 3VOVA 5E26A 5BREA 2FF6A 4Z94A 2D1KA 4B1WB 4F9OA 1J6ZA 3MK6A 4H0TB 2GWJA 4YDUC 5AQQA 2Q1NA 1BA0A 5AQOA 4CBWA 1HKCA 3ULEA 4FWOA 4CZFA 3EKUA 2FLOA 4BR7A 2Q0RA 3ATVA 4CBXA 3U9ZA 1SAZA 1Q18A 4BR0A 3H45C 2BUPA 4MO5A 1CZAN 4E1JA 3LDPA 3M3ZA 4XH1A 4WYBA 4CZGA 1P8ZA 4ISGA 4BRAA 4RTFD 4FPBA 5KPZA 4IXCA 3D7EO 5TKYA 3U4LA 4HWIA 4FWMA 4CD1A 2P9SB 1GLEG 3A0IX 3A5LC 3IDHA 1MWMA 3VEVA 3W3DA 3S41A 3ZX2A 4MLEA 3C7NB 1YVNA 4EIAA 3M1FA 4FSVA 3DAWA 2CGLA 3U8XA 3VEOA 1KAZA 1HUXA 1S22A 3MN9A 4XEIA 1NGJA 3P4IA 5KPRA 1BG3A 4H0OA 3ZX3A 4B1UB 3H3NO 1JCEA 1Z6RA 1RDWX 4ISFA 5AZJB 2UYTA 3R6MA 4FO0A 1RGIA 2YCHA 3GG4A 4BREA 1D4XA 3LM9A 3VGKA 2D4WA 2P9PA 4B1ZA 4EAHD 2GUPA 5I9EB 4L3QA 1HLUA 1QZ6A 2FXUA 2GELA 2VCPA 5BN9A 4I6MA 4EHTA 3SJHA 3TPQA 1ZC6A 3IFRA 1C0FA 4BVPA 1NGAA 3JXUA 2IIRA 3SMPA 4CJ7A 4MO4A 1Z05A 2Q31A 1BOTO 4FOIA 1NBWA 3ATUA 3IUCA 4EFHA 1GLCG 3WEEB 2CH5A 3VF4A 4BRGA 3I8BA 4QS7A 4FWPA 3O8MA 1BA1A 2V7ZA 3EZWA 4BRIA 3W0LA 2AP1A 5AFUA 2ASPA 2QXLA 4IJNA 4GNIA 2W40A 3DJCA 2E2OA 3WQUA 1NGGA 2KHOA 3BF1A 4NB4A 2H3GX 1S3XA 3SMSA 2HF3A 1SQKA
chains in the Genus database with same CATH superfamily
3P1GA 3PSIA 3UB5A 1D5AA 1N5YA 2QXFA 3RSEA 3D2EA 1WSHA 4HUGA 4HCCA 1T3VA 2I61A 1J5EK 1N32K 4IOCL 1TYQB 3QBXA 3WNFA 4FK0A 1BU6O 5F2RA 4JEPA 2G8FA 4M3RA 4CE9A 3BEXA 4M3YA 1J54A 2O8CB 3O3HA 3NBPA 4DR1K 4LFBK 3ZEUB 4AB0A 3AO1A 4KHQA 3WNHA 3AAPA 2HSTA 2A5XA 1C0MA 3VQQA 1SNBA 4BC5A 2P9IB 3DLBA 1J9AA 4DTNA 2ASCA 2VQFK 5AQYA 1GOAA 3CM6A 3H1VX 4KV8A 3PX4A 3PLAA 2YNHA 2UU9K 2NZTA 4CJ5A 4Z0UA 4C23A 3OYKA 4FK4A 1I2VA 4X66K 4MDAA 4NLCA 1S9GA 3OYEA 2P51A 4DQPA 5F1XA 3O4QA 3PX6A 2OZMA 3QI7A 2QA4N 4NYFA 2YEOA 3IRXA 4FLVA 3WXLA 1HNIA 4C1NK 5J2NA 4FZZA 5JS2A 4BR5A 1NJZA 2YJEA 1L3UA 1QQMA 1SV5A 2C1IA 4PL7A 3QESA 5C2FA 1HPZA 2P9KA 3AVFA 3HPGA 4DR5K 3VTHA 1LV5A 2IGIA 2GEMA 3WNGA 4KFBA 4JI3K 1D8YA 3A5OC 4CVNE 1B92A 3MN7A 3IMXA 4GW6A 1HKBA 3OVNA 1U04A 1E4FT 1BL3A 1OVQA 4F3OA 1PTXA 3VGLA 1NG9A 2KBHA 1ZBSA 3L4IA 3H3OB 4GV9A 4PWDA 5TKWA 2MBKA 1Y64A 5HP1A 2GX9A 1HRHA 4GV3A 3DLEA 4B1VA 2D5RA 3OYFA 3DXKB 4NCAA 3RVCA 4DUZK 2HNZA 4FJJA 3SJJA 4BVOA 4JI5K 4LY7A 5LL6Z 1W0HA 1RT6A 4JKGB 3VEYA 2N2RA 2P9SA 4OGEA 4ELVA 1G15A 5IWAK 4LF5K 3L0QA 2OPRA 5GAEP 3GL1A 1WUAA 4G1QA 1IV0A 1C1AA 3RMAA 4YOWA 5HL7L 2HNDA 4I9QA 4DSEA 4IDHA 4LF8K 1ZBIA 4JS5A 4C8MA 3DLHA 4ZTJA 3CFPA 2XHBA 3PSMA 1JKZA 4WQ4C 5EU7A 1R0AA 1Q7YO 3A5MC 4XH4A 3HVTA 4KHPK 3MXIA 4DV4K 3H46O 2VWBA 2LN8A 1VQ6N 4H5NA 3GOIA 1SN1A 4FJ9A 1NU0A 3SAGA 3AV9A 4OPKA 3TARA 3NVKA 2B5JA 4JI0K 2GUIA 1LCUA 1ZXOA 3OTOK 3K5MA 1NE5A 4QOZB 3KLFA 2ZWHA 3FR0A 2G2KA 1N33K 4GKJK 4FWKA 3H6EA 1V4TA 2FSNA 3E7UX 4AM6A 1GOCA 3WEEA 3JSMA 4CI6A 1RDAA 3MCPA 4OVLA 3U3YA 3E01A 1NGDA 2EWSA 1BDGA 3ULDA 1SKRA 3GE1A 2W6KA 1NJXA 4OX9K 3G71N 5HROA 4DR6K 1ZBLA 1NMDA 5AQKA 4JAXA 1GLAG 1KSPA 4KI6A 1GPTA 2W00A 2OTJN 1TYQA 1QSSA 2ETJA 2B68A 1QZ5A 3THXB 3EN9A 4I6MB 1D9FA 3SUPA 2KKZA 1RT3A 2HNYA 2O8CA 3HL8A 3TTDA 4EP5A 1HX1A 5HRRA 3ZEUA 2ZJRL 1JXBA 4TSXA 2Z1HA 5K14A 5LY3A 1TL3A 2RKIA 3K5LA 4K8ZA 2P9IA 3R3LA 1YJWN 4CFBA 3DLRA 4H4MA 4DFJA 3OJSA 4V19S 3AVHA 4JKFA 3CYMA 2KBJA 4M63C 1O13A 4AILC 1XNQK 4DR4K 3LDOA 2W41A 2RE2A 3QDKA 3LAKA 3MWTA 3ZT2A 1FKPA 1CXQA 3CIPA 5J1EA 3MEGA 5KTQA 4J2EA 1QS4A 5E84A 3VA3A 4DV1K 3VEWA 1IG8A 1YJ9N 3T1HK 1IJJA 3AGKA 1T7BA 1RBTA 4FLZA 1RTHA 3T69A 3HPOA 2A40A 1KAYA 4YY3K 5CY0A 2XY8A 2BE2A 1EX4A 4A57A 4ELTA 4BE2A 4OLAA 4W5TA 2JWKA 3TAQA 5J2PA 3FGUA 2DFEA 4DF4A 1RBRA 3DLKA 4DSLA 1BO5O 1J5OA 1I94K 4IZ9A 1GLFO 4DSJA 3AO4A 4PL8A 5KI6A 1JJ2M 4B3SK 4B3OA 4Q5VA 4CESA 1RTIA 3AVMA 1MYNA 3DYAA 5GAGP 4M3XA 4AHRA 3PX0A 3UKUB 3K58A 4BRDA 2JLEA 1QHTA 4B9QA 4EP4A 5FPDA 2ASMA 4LF6K 1S1VA 3K0SA 3F73A 3PO5A 3M5RA 3RR7A 3QMLA 3VQ7A 3L3UA 4HCBA 4KKOA 4EZ6A 4LFAK 2AJQA 4LF7K 1JXCA 5BPNA 5DM6L 3CJAA 5EX5A 1FH3A 3ZCMA 1PE4A 1RT5A 2YILA 4B9MA 4DQIA 4DSKA 1ATNA 3AO5A 3DXKA 2ZGZA 2E4LA 3P31A 1YF5L 4BR4A 4OO1J 5SZTA 2QKKA 3ZX0A 4FJGA 2YHYA 3QERA 2RN2A 2YNFA 2NRHA 4JKGA 2UXCK 2XO7A 2ITMA 1MA9B 4BDZA 2R7YA 3T3FA 3O08A 2QEXN 1JZBA 4H03B 1NK4A 4KTQA 4KHYA 3O9UA 3ENOA 4CJKA 3NH0A 4HHFA 2GBZA 4FJNA 3MEEA 3SNNA 3PV8A 1W7AA 3ZSWA 3D6RA 2ITGA 4LH5A 3MK6A 4F8RA 2GWJA 4C1NI 2MN5A 5M1NA 4Z4GA 3RTVA 4CJTA 3VA0A 1JL2A 2FLOA 2Q0RA 3WXMB 4RW4A 3KK3A 1Q18A 1NK7A 3VMFB 4FK2A 5JENA 3NDKA 4IEEA 4E7KA 4AHUA 4Q0BA 4ISGA 4CJFA 3D7EO 1REVA 4HWIA 2NRZA 2RPIA 2A7TA 1WSGA 1S6QA 1GOBA 4Z4HA 2LY6A 3IDHA 3A2FA 3VEVA 1XNRK 3ZX2A 2GV9A 1SKWA 4B9LA 3G4SN 3C7NB 1YVNA 1IBLK 1K8BA 3QINA 3DAWA 1EWRA 3HRGA 2ATQA 2HHSA 1EWQA 1S22A 1HUXA 5KGWA 1VSKA 1NGJA 1BG3A 1VSHA 3ZSVA 1JCEA 1Z6RA 5LMNK 4ISFA 4KHWA 5DM7L 3RR8A 1NRBA 1YT3A 2UYTA 1Z26A 3P83D 3K9JA 3K59A 4CCHA 3TTFA 2ZQBA 2E6MA 4ID5A 4RW9A 1K9MO 4E7IA 1OH7A 2N66A 4B1ZA 4ILGB 2KBKA 3IG1A 4EAHD 4M3ZA 4FJLA 3THXA 1NOZA 1QZ6A 4CJ4A 2VCPA 4I6MA 2XY6A 3TPQA 3IS9A 4X62K 3RMBA 4MO4A 3NVMA 2Q31A 1VRTA 3AVNA 2F96A 1TKZA 3GKUA 4GVMA 1GLCG 2XRIA 4BY9C 2CH5A 4B9NA 2KFNA 2DTUA 3KOWA 4MFBA 2Q3SA 4JK8A 3NAEA 1BA1A 2NY9X 2P5OA 4FJ7A 1DT9A 4BRIA 3W0LA 1BISA 2AP1A 5AFUA 3K9KA 4IJNA 4GNIA 2W40A 3DJCA 2E2OA 1NJIO 1I2UA 2LI7A 1NGGA 3CMAN 3KLHA 3BF1A 2H3GX 1S3XA 3PO4A 2FBXA 3V9ZA 1VQ9N 2VYPA 3LP3A 3VENA 4FM1A 3Q7BA 3VQAA 4A2AA 1QTMA 4FJ5A 4CEBA 1FK9A 5KQ8A 3VGMA 1GLBG 4BG8A 2IC3A 4DMNA 4CJWA 4DTJA 3VESA 4HTUA 4CHZA 4ZTFA 3AY9A 4KHSA 2YIPA 1M90O 3ID6A 1RNHA 4YOUA 1T7EA 5ADXA 1JL1A 4JI7K 4KB0A 4CJ3A 1KVBA 2PYLA 1JLQA 1WB9A 4CGGA 5AR0A 2BDPA 3NH1A 5AQUA 4BRLA 1HQEA 3VQ6A 3UKUA 1BQMA 1U2VB 3LANA 2YHBA 4JRQA 1U48A 4DTXA 4UAFE 4V1DC 4AHCA 2ZD1A 3L56A 4WQ5A 4DU1A 4CFAA 4QS9A 3CJ9A 4IDKA 1EETA 5AQWA 4Z4IA 3J8AA 4JN4A 4Z4CA 3R8EA 1FKOA 1LWCA 1VSIA 3UKRB 3VQ8A 4CHOA 3FZLA 3LALA 3NGZA 3C95A 4UADE 1T44A 2X6SA 3OYDA 4DV5K 5FPEA 2P9UB 4YHHK 3M8PA 1BQNA 3HK2A 1HKGA 4J2AA 1U47A 5FDLA 1IBMK 1RT4A 5AQNA 4I7FA 3BK3C 1TL1A 3CQXA 3NMUA 4M3TA 3WQTA 3VQ4A 3EY1A 5AFUH 5BRHA 1M1KO 1IH7A 1X3NA 4I2QA 3OJUA 4PUOA 2HHUA 4X64K 4XH5A 3CETA 3CCUN 4H5VA 3ASMA 3LPTA 3KOYA 1Q9YA 3M8QA 1KLMA 3CYGA 1KTQA 3VQBA 4OKEA 3RRHA 3QFUA 4FJIA 2KSKA 5EOYA 1ZU3A 1QHAA 3KOXA 2EHGA 1BWFO 4A5BA 3QEWA 2G8VA 3BGRA 4CJVA 4DU3A 4ISEA 4PKGA 2NRRA 1Q9XA 1BGXT 4YOVA 3GBTA 1VQON 1EP4A 5FLXO 5AZIB 5ADXH 3DM2A 1TKTA 1N4NA 2Z1IA 4CBUA 3MX5A 2QWNA 3MXMA 1XMOK 3MN5A 5FRNA 4HE7A 4CQKA 4JKDA 2Y1JA 3A5NC 3AVLA 4RWTA 3RRGA 3C7NA 4DB3A 1PX9A 4FJXA 2WOMA 1YUWA 1W9HA 1YAGA 5CZ1A 5C12A 4BRFA 4FWQA 4BWJA 2G8UA 2BANA 1HNVA 1LAWA 2X78A 4JK9A 4BQZA 3OYJA 5CYQA 3LDNA 1IG9A 1EQYA 3IAYA 2HHIA 2E88A 1YTUA 4DQSA 1DGKN 2HBMA 1V4SA 3U6FA 1VHXA 1ZBHA 1JZAA 5AQPA 1KVAA 2VG5A 3KWIA 1ILYA 3HJFA 2KW4A 2NUBA 2A3ZA 3U3GA 4OPAA 3L2VA 1DJTA 1CZ9A 1RDCA 3DWLA 1VSEA 3ZT3A 4IWVA 4A61A 3OYNA 4AF1A 5FPNA 1ATSA 2QM1A 3PUFA 1WLJA 3L6QA 5B8HA 4BR2A 4IO8A 3SPZA 2A42A 1Q81O 1EKEA 4JV5K 4JKCA 3ENHA 4M42A 1WWNA 1KD1O 4IEIA 2QWLA 3CJ1A 2F7TA 5KPTA 4FYDA 3VQ5A 4KH6A 2G8HA 4CEFA 2D0AA 4DQRA 3F9MA 2P9PB 3EEQA 4O0IA 3KLEA 2DFFA 3NF8A 2OPQA 3AVBA 2QWMA 3PSFA 1TK0A 4DS4A 1S1TA 3MWPA 1HJOA 4YDUA 2HF4A 2P9NB 3KD5E 3S9HA 4B1YB 3BUZB 3SK3A 1RDDA 3PY8A 4BRMA 4KHNA 3GDQA 2CGJA 5M1KA 1TUUA 3CCVN 2P5GA 1U6ZA 3EZ5A 4DSFA 4E3SA 4UY8O 1U2VA 4U7BA 2A41A 1HMVA 2E2PA 1SL1A 4FZYA 4LF9K 4BEBA 2VGMA 4F3TA 3ZT0A 4BC4A 2D56A 3DMJA 3U9DA 4JHDB 3UKRA 3OW2M 4FCYA 3C6AA 3CCLN 4FLUA 2CGKA 4CJPA 3ZSOA 5FRMA 3K2PA 2P9UA 1T8EA 1EO1A 3HM8A 4BGBA 3CCJN 1GLDG 1TUYA 2FC0A 4JNEA 1NGCA 1QQOA 4FM0A 2QKBA 1L3SA 3R2VA 2LT8A 4AHTA 4RCHA 1UOCA 4CJQA 3HTVA 1W2BM 5HRSA 2V7YA 5JLHA 5AQRA 1B9DA 4Y0WA 4J2BA 4O44A 3AA5X 3KC6A 3V1RA 1FXXA 4LD0A 5LJWA 4FWLA 2G8KA 3HOTA 4B9VA 3KK2A 2VGNA 5DMRA 4BG9A 4JD2B 3CF5L 3J7ZO 1KAXA 3FFKB 3D0PA 3DRPA 4N47A 4CEOA 4E7JA 2CH6A 4DLEA 2F9TA 4R79A 2M8BB 1RBSA 3KKRA 3D2FB 3L2WA 3AVKA 1T0ZA 4DSIA 1SKSA 1NK8A 5CY4A 2C1GA 3HZ6A 2OCEA 1X9JA 1HJRA 1G99A 2F9WA 1KXPA 3IKMA 2ZE2A 4CEEA 1VQPN 1JLGA 3R9PA 3VPZA 5AZIA 4YORA 1L3VA 5T7BA 4H5TA 1BMRA 1S5JA 5I3UA 5HRNA 3UIQA 3DOKA 4JRPA 4OGCA 5AQVA 4KH5A 3T7ZA 3KTQA 1JCFA 4DR7K 5HLFA 1AHOA 2LSNA 4Z4EA 4CZLA 1Q82O 1ZBUA 5FPMA 1FW6A 1DEJA 1VNBA 5E26A 5BREA 2FF6A 5KGXA 3OYIA 2D1KA 3V9XA 2NRXA 3CQ8A 4F9OA 1U49A 3LZIA 3T1AA 1VSLA 4F4KA 1QVGM 1BA0A 5AQOA 3ALYA 3I56N 5A2QO 4FM2A 4GVEA 4MO5A 3TANA 4BE0A 4YOYA 4WYBA 4CZGA 4CHQA 1BRZA 1GPSA 3LWMA 3V9UA 2LKBA 4IG3A 4OPJA 4RTFD 1YIJN 1X1PA 1TKDA 5KPZA 5TKYA 4O5BA 4CHPA 3M8RA 3O3FA 1NKBA 3CMEN 3TSUA 3C65A 3A5LC 4DV0K 4FXDA 4FW1A 2Z1JA 4FSVA 4CEDA 2ZJQL 3MN9A 3QEPA 1NPIA 4DTSA 4KTWA 4XEIA 2IS3A 2HVHA 3QLHA 3H3NO 1K73O 5AZJB 1RDWX 5I42A 4XJXA 4IO9L 3NF6A 3V81A 3ENBA 2KYQA 4FO0A 4DFKA 2YCHA 4DFPA 2UUCK 3VGKA 2D4WA 2P9PA 2D0BA 1BHLA 2GUPA 2KZZA 5I9EB 1KVCA 2NRVA 3TI0A 4NCBA 1TGOA 4LH4A 2FBYA 3SJHA 4B08A 4CF8A 4E72A 4CK3A 1NGAA 4H8KA 2RHKA 2IIRA 3KP1A 4WFAL 4CF2A 3PIPL 4CF1A 4FJMA 1NBWA 3HXMA 3OYGA 3NGIA 3OYAA 4IFEA 4CJUA 4PA1A 1KCFA 2JGUA 3PIOL 3I8BA 4QS7A 3O8MA 3T1YK 4AQYK 2N2QA 4JKAA 4B3TK 1S72N 2PY5A 4DV3K 2B4JA 4NB4A 3SMSA 4CK1A 3TABA 4B9SA 4JHDA 4NXNK 4UAEF 4JKHA 3KZBA 1VQ4N 3EE8A 4BRHA 1RT2A 4JS4A 4CZKA 1TK5A 4KPYA 2K35A 2YC1C 4JI4K 1NK6A 2QK9A 3SAFA 2ZM6K 1ZVGA 1VQ8N 1P00A 1B9FA 1HYSA 4OKJA 4W5NA 5D3GA 2O4IA 3QIPA 4DWIA 1LQIA 1VK0A 1JLAA 2GMOA 5AQHA 4BRPA 3KVGA 4QCLA 4WQ4A 4IOAL 2IAJA 2OANA 1IKXA 3LPUA 5BPMA 2WC9A 1XWLA 3F9KA 3VETA 4ICLA 4NO7A 3I0SA 5C15A 4DLGA 4PKHA 4B9TA 1B7DA 1NGBA 2B3CA 4BGAA 3R1XA 4AM7A 3L4QA 4CEAA 3ZSQA 3LL3A 4KTZA 1BK8A 1Z25A 3HPHA 4FVUA 3WXJA 2NRTA 4DR3K 2E8AA 1ICAA 2UXDK 3NE6A 4KBOA 3LDQA 4X65K 1UA1A 2O8BB 1LQQA 2KPYA 2HHHK 4GY2B 5BRFA 5JVGL 1IBKK 4K43A 1IKWA 3ZSZA 4FL9A 5AQTA 3RWUA 4ZHRA 3ISNC 4CZHA 5H1SQ 1BCGA 1NK5A 3CPEA 3HYFA 2HB5A 1ATRA 3CI5A 3KK7A 1SS6A 3QBWA 1NNEA 4JK7A 2YNGA 4QAGA 4DV2K 3P5JA 4O5FA 1BIZA 3CD6N 3C94A 3LZJA 1WBDA 2J4RA 1SZ2A 2XY5A 1UAXA 4GKKK 3OYCA 3TR8A 5C25A 4H4OA 3KP0A 2LJ7A 2KJAA 3CQYA 3HOSA 2D0CA 4JYAK 2OPPA 4NCGA 2PBDA 3SUOA 3DLGA 3AAQA 4JKBA 5GIOA 2JDQD 5JS1A 2Q36A 2Z1GA 1YXQA 4C8NA 3L2QA 3E9LA 4DTOA 4CK2A 3V1OA 1D9DA 3RSEB 3QEVA 1MWKA 1LWEA 2OPSA 2VY6A 3VN5A 5KRTA 4HHTA 4CERA 4KRFA 3DOLA 1NJWA 3CW4A 1TAQA 1I6FA 3C6UA 2PZSA 3FZMA 1NLVA 1NGIA 4BC3A 5AQSA 2WUSA 4IBNA 4CECA 2Y1IA 4I2PA 4BRCA 1HPMA 1U45A 5FROA 2IVOA 1HNWK 3ULEB 4FWRA 4QS8A 4UJ0A 5BRDA 3THYB 3OY9A 4IJAA 2KTQA 4M45A 3MX2A 2HBJA 3VQ9A 1YHQN 2D0OA 4A62A 3LP0A 2HOEA 4OKKA 4GV6A 2A6AA 1N6QA 4C8KA 3BZKA 3E1YA 4DHYA 1TI5A 2FSKA 4AH9A 4H5WA 1NOYA 3AGRA 3MN6A 4M7YA 4CW7B 2VWJA 4WCEL 2Q97A 2HHWA 2NLXA 4CD3A 5M1PA 3QNNA 2JWLA 2W6LA 3CFRA 3MMVA 1R59O 4GMJB 1HNZK 2A1SA 4BC2A 5KRSA 2D0PA 3LAMA 4DQQA 3HSTB 4DS5A 4E1NA 5F0XA 4KREA 4E19A 1KQSM 1NGFA 3O1WA 1T05A 1C56A 3AA4A 3G10A 3DRSA 3EO3A 1NH5A 4DF8A 4JLHA 4LSLA 4E0DA 4FVMA 5BPLA 3F5TA 3P38A 4CF9A 3ZSYA 3BF3A 4HTLA 2IDOA 1C1CA 3TSQA 2IVPA 4CGIA 4DV6K 3TAGA 3RMDA 3G6EN 1T7AA 1QSLA 4KI4A 1Y97A 1X9MA 2YI1A 4H0VB 2KFZA 3SF4D 2RF2A 3O3GA 3O6WA 5AQMA 2QWQA 3H08A 1ZFUA 1KV0A 2KQ2A 3O9RA 2G8WA 3O80A 1LWFA 3HSCA 2YHXA 4BDYA 3WXIA 3LWLA 3O4NA 2O8DB 1ASUA 5AQGA 2F4VK 2QTDA 4WFBL 4CHYA 1HNXK 2PAVA 1A5WA 3B6OA 2GTDA 2W42A 2O8BA 2DPNA 2FF3B 1RDBA 5AQFA 2VWKA 1BUPA 2YHWA 3EE9A 3TWHA 3QEXA 4R5PA 5EXWA 4JI1K 1YTAA 3JS6A 4LSNA 3MDQA 3HT3A 1WAJA 1EXQA 5CZ2A 4K41A 1DLOA 2BGGA 3I0RA 4K8XA 2O4GA 4FWSA 3BP8A 1XC9A 3O9SA 1YJNN 5BN8A 5CR4A 4A59A 4N76A 2BH1A 1JLFA 3OS0A 2WONA 1OVYA 1T6CA 1W97L 2YHAA 4ID1A 2OYQA 1NGHA 4N5SA 4PHTX 5HRPA 3DLLL 1NKCA 3LP1A 1K8KB 3CJBA 1VQLN 3MXJA 3CERA 3CXCM 4BROA 2E20A 1RTJA 1POIA 1X3MA 1ESVA 2HHTA 3QIOA 3LP2A 4N56A 4DU4A 4W5RA 4CZMA 3HVRA 2FSJA 4Y1DA 3CHWA 3VF2A 3C6HA 3CC2N 1X9WA 2IVNA 1LQHA 3FZKA 1DQ7A 1S6PA 4YOXA 5JLFA 4A2BA 3J81O 1QSYA 1YITN 4MLHA 5GAHP 5AQLA 4BQLA 4DUYK 2I7NA 3WT0A 1S1WA 3C0BA 2E2QA 2E6LA 3VERA 4HVJA 4Z94A 4HUEA 1IKYA 4H0TB 1YVUA 4FJ8A 4FJKA 5AQQA 2Q1NA 4CBWA 2UXBK 3ULEA 2NNWA 4FWOA 4CZFA 5J2QA 4KYPA 2E3FA 4BE7B 3EKUA 3THYA 2HW3A 3ATVA 4WE1A 3K5NA 4BR0A 1ITGA 2KLAA 3H45C 1LW2A 2VG7A 3KLIA 4E1JA 3CC4N 3LDPA 3SQ2A 1VSFA 4Y1CA 3KLGA 1P8ZA 2PFUA 5SWMA 1Q8IA 4FPBA 4C8LA 4IXCA 2YV0X 3I55N 3OA9A 4OPHA 1ZBFA 4FWMA 2X6NA 1TAUA 1GLEG 5C0YA 3A0IX 3W3DA 1TV6A 4MLEA 5M1QA 1VRUA 3SV3A 3VQCA 1HR0K 3U8XA 3VEOA 4PY5A 2SN3A 4O0JA 1BI4B 5C42A 1ZVEA 4E1MA 3N4PA 5MLCQ 4LFCK 4JKEA 4HUFA 2OZSA 4CJRA 1RGIA 3GG4A 4BREA 1XHZA 4FW2A 4DTPA 1ASWA 1OZZA 3L2RA 3HP6A 2HBLA 4B3MK 3KIOA 1HLUA 4CIEA 1VSDA 1N36K 4EHTA 3BZCA 2HBKA 3IFRA 2F8SA 1C0FA 4BVPA 3BDPA 3F2KA 3SMPA 3L3VA 4CJ7A 4WFNL 2VG6A 1Z05A 2B6AA 2LR3A 1BOTO 1SEGA 3ATUA 3NCIA 1QVFM 3NH2A 4EFHA 3OYBA 4F2RA 3VF4A 4BRGA 4LF4K 4FWPA 4W5OA 3AVAA 2QXLA 3I8DA 4DTRA 3S3MA 1KRPA 4B3RK 2O8DA 2EX3A 4CF0A 1VQNN 1VSMA 4FLWA 4RG8A 1WSIA 3KHYA 2QWRA 4O55A 3AVCA 2UUAK 3EKSA 4YNQA 4DFMA 1RBVA 3O9QA 1B3CA 2YIOA 5LMUK 2GWKA 2ASOA 1JLEA 4FWNA 3QFPA 1C1BA 3NF7A 3G25A 2YJFA 3FZHA 1WSFA 3QICA 4O8KA 2I7PA 1HQUA 1T7PA 1E4GT 3OHRA 1RTDA 1VSJA 4K0KK 1IO2A 2Q0UA 4W5QA 3QEIA 3DXMB 1VNAA 3O1BA 1TK8A 1SL2A 2ATBA 4U67L 1K8KA 3SV4A 4B1XB 4BWMA 1GLJO 4H0YB 3G0ZA 3ITHA 1TKXA 2P1JA 3B8AX 4YFUA 3VTIA 1JKHA 1KFDA 1OH6A 2AA4A 3E9OA 3SZ2A 2QWOA 4E7HA 1RFQA 1ASVA 4CGJA 1AYJA 3E9PA 3MAQA 1UGLA 2BTFA 2P9LB 1XMQK 3AA3A 3C6TA 5M1FA 5EY4A 1OKJA 5C24A 3ZSXA 4CFCA 3TAFA 5AQIA 5C10A 3LDSA 1MDUB 1S9EA 4PKIA 2V52B 3L8BA 4BRNA 3M6GA 4E89A 2UUBK 3CCEN 3KD1E 4RW8A 2YKNA 5CHIA 1VQKN 3SQ0A 4WF9L 3ZETB 4FJHA 4KH4A 1F21A 3V4IA 1DTQA 4PQUA 4AHVA 1RILA 1A5VA 3DRRA 5IT9O 4BE1A 2P9NA 1K8AO 2YNIA 4KHUA 1SN4A 3TAMA 4J8FA 4BRKA 1NKEA 2OA8A 3SUNA 1UA0A 2LJMA 3TU5A 3KHWA 3J7AP 5C2DA 1O1WA 1SL0A 1GLLO 3MCAB 4I9LA 3NHGA 3KKSA 1NJYA 3NF9A 3JAMO 1XI1A 3O4WA 1XUPO 2VQEK 3CCMN 1CXUA 1WSJA 1ZYWA 3FLCO 2YKMA 4EHUA 5KQDA 1H1VA 3KK1A 4K25A 4FLYA 2E1ZA 1BI4A 3AVIA 1WMTA 2QWPA 3LDLA 3FZFA 5EVZA 1WOQA 4MDBA 4AHSA 1E3MA 3MECA 3A8YA 1YI2N 5JMVA 1VQMN 3OBWA 4BRQA 2F8TA 4DKWA 3UE5A 3CFOA 1UWBA 4CZIA 3OYHA 5JVHL 3SPYA 3B6PA 4CZJA 3V9WA 1N8RO 3S5TA 4C8OA 3H1QA 1QQNA 4O8UA 2PYJA 4JI6K 4FLTA 1IKVA 3ZLJA 1S1XA 4O4GA 4WQ5C 1NGEA 3FFIA 3E7RL 4RW7A 5LJVA 4EZ9A 1KLNA 2DY4A 5M1OA 4JD2A 1QE1A 1T03A 2WBNA 3ZYYX 3SQ1A 3D2FA 3FE1A 3TTCA 1XC3A 5KK4A 5AQXA 4JI2K 3L2UA 2O8EB 4DG1A 3CG7A 1LOTB 1SUQA 4CGDA 3HO1A 4H0XB 3VQDA 2HMPA 1FJGK 4FOEA 2ZGYA 1XQSC 1BCOA 4H5RA 4ILJA 3VEXA 1DKGD 2ZJPL 5CE3A 4B8AB 1WBBA 4FLXA 1C0TA 3SBTA 5ELZA 2A1RA 3J7YP 1RCHA 3NGYA 3E66A 4IFYA 3WXKA 3V6DA 5BR8K 3HI0A 3SAHA 1TVRA 2WTUA 4MQ3A 3LM2A 1HYZA 2X74A 2IOCA 1NMNA 1WN7A 3N4QA 3QB0A 1LW0A 3S3OA 4DCHA 5HBMA 4DTMA 1S1UA 4FPAA 1CHZA 1MR4A 1JLBA 3DXMA 1JXEA 1VQ7N 4KAZA 2KGQA 3CCQN 3SBGA 1C0GA 2FBVA 4NLBA 3KWGA 2O8FB 4M41A 3CCSN 1OH8A 3SLCA 3AA2A 1X9SA 5JICA 2ZF5O 4BDPA 3J80O 1C55A 3SYZA 3THWB 3CJ7A 4NXMK 3MEDA 1NRAA 4K42A 3EYZA 4B9UA 1I6GA 3OYLA 4IG0A 1RBUA 1BCMA 3D2EB 3AO3A 3SUQA 4UQGA 2E2NA 3CJCA 3O5BA 3VQEA 5BR9A 3ZSRA 5GADP 4AAZA 1KC8O 4ILHA 1NWKA 3VQPA 2KZMA 3V1QA 1T1TA 4DTUA 4E7LA 2QW9A 2GL1A 4CZEA 4A5AA 2P9LA 1XRSB 3ID8A 2DFHA 3TAEA 3VF6A 3NFAA 5E41A 1NK0A 2LY5A 4M3UA 1T6DA 1C6VA 1U4BA 1RT1A 3HBTA 1NK9A 3SCXA 3D45A 3CPWM 1DTTA 3VEZA 5AZJA 3HM9A 2YX6A 3WUHA 3BY5A 1JLCA 3QNOA 3JYTA 2YBRC 1WAFA 2HHVA 3TSPA 3K5OA 4CHNA 4M7XA 4H0PA 1JCGA 3AARA 3ZETA 3I33A 5AQZA 3ZT4A 2I5JA 3OS1A 4M3WA 3QETA 2QI2A 3EL2A 2OTLN 3M8SA 4KB1A 4BR9A 3SI6A 4DQ8A 4LC9B 2G8IA 1L4VA 4YOTA 5HOOA 5AQJA 2E1YA 4BECA 1MU2A 3RMCA 3THVA 3KJVA 2Q2RA 2E2FA 1WSEA 1NM1A 3AVGA 3DI6A 2E5LK 2P9KB 4BACA 3Q7CA 1A5XA 4L8RB 2BRZA 1J53A 2V51B 3QO9A 3VOVA 1CZBA 1VAZA 4IKFA 4CEZA 4ELUA 1Q86O 4B1WB 3WNEA 4RW6A 4CIGA 1OH5A 4JI8K 1C0UA 4CJLA 1J6ZA 2E3GA 1N34K 5CYMA 4YDUC 1P0AA 1HKCA 4N41A 4OLBA 4F2SA 3O9TA 3S3NA 3CM5A 4BR7A 4CBXA 3U9ZA 1BIUA 3ZT1A 1LAVA 1SAZA 1ZYQA 3T19A 4DV7K 2BUPA 5GINA 1CN2A 1CZAN 1HYVA 2N69A 3M3ZA 4NYNA 5DK5A 4XH1A 4CJEA 4J2DA 4G9ZA 2HVIA 3AO2A 3OYMA 4BRAA 1CLQA 2XY7A 3U4LA 1ZUTA 3TAPA 1ZYVA 2WFBA 4CD1A 3V9SA 2P9SB 1MWMA 3S41A 1OMYA 3OBYA 1VQ5N 3CC7N 4EIAA 3M1FA 4CGHA 3K57A 2CGLA 1RDUA 4CEQA 1KAZA 4Z4FA 2O8EA 4CJSA 2NRWA 3P4IA 5KPRA 4H0OA 3ZX3A 4B1UB 2HHXA 2E0HA 4FZXC 2HHQA 3HP9A 3R6MA 4B8CA 1D4XA 3LM9A 1I39A 1WNSA 4L3QA 2NY8X 3CCRN 2FXUA 2GELA 3AVJA 5BN9A 1ZC6A 4XIUA 4IOXA 3OS2A 1RT7A 3JXUA 4DR2K 1L3TA 4OJRA 4FOIA 1KFSA 1QQCA 2HMIA 3IUCA 4CGFA 2FBTA 5AJ3K 4CIFA 1WT7A 1P90A 4CFDA 5GIPA 3P39A 3WEEB 4AEIA 1L5UA 5J2MA 1I3AA 2V7ZA 3SQ4A 3EZWA 2ASPA 4IFVA 2O8FA 3WQUA 4KO0A 2KHOA 2MZ0A 3THWA 2HF3A 3KOZA 1SQKA 1XHXA 1K6YA
chains in the Genus database with same CATH topology
4UAEF 2VYPA 3KHYA 4JKHA 3KZBA 3VENA 1VQ4N 3Q7BA 3UB5A 4A2AA 3EE8A 2QWRA 4BRHA 4CZKA 3RSEA 5KQ8A 3D2EA 2K35A 1T3VA 3VGMA 3EKSA 1GLBG 4BG8A 3SAFA 3O9QA 4IOCL 2YIOA 1TYQB 3QBXA 2GWKA 1BU6O 5F2RA 2ASOA 4JEPA 4FWNA 3VESA 3QFPA 1VQ8N 3BEXA 3AY9A 3G25A 2YIPA 1M90O 2YJFA 3ID6A 3FZHA 4YOUA 3QICA 4O8KA 2GMOA 2I7PA 5AQHA 4BRPA 4JHDA 3ZEUB 3KVGA 5ADXA 4WQ4A 1E4GT 3OHRA 3AAPA 4IOAL 2HSTA 2OANA 2A5XA 4BC5A 2P9IB 5BPMA 5AR0A 2WC9A 2Q0UA 5AQUA 4BRLA 3VETA 5AQYA 4NO7A 5C15A 3UKUA 4PKHA 1U2VB 3DXMB 1NGBA 3O1BA 3H1VX 4BGAA 3R1XA 4AM7A 3PLAA 4UAFE 2NZTA 3L4QA 3LL3A 4U67L 3L56A 1K8KA 4WQ5A 4C23A 4FVUA 4QS9A 3WXJA 3CJ9A 2NRTA 5AQWA 4B1XB 3J8AA 2E8AA 4MDAA 1GLJO 4H0YB 4NLCA 3B8AX 4JN4A 3R8EA 3VTIA 3UKRB 4KBOA 3LDQA 3FZLA 2AA4A 3E9OA 4UADE 5F1XA 1T44A 2QWOA 4GY2B 3QI7A 5BRFA 2QA4N 1RFQA 5FPEA 2P9UB 3E9PA 5JVGL 1HKGA 3WXLA 4C1NK 4K43A 4BR5A 4FL9A 5AQTA 2YJEA 4CZHA 2BTFA 1QQMA 5AQNA 5H1SQ 4PL7A 2C1IA 3BK3C 2P9LB 3CQXA 3CPEA 5M1FA 5EY4A 1OKJA 1ATRA 3NMUA 3CI5A 2P9KA 5C2FA 3KK7A 1SS6A 3WQTA 3QBWA 4JK7A 5AFUH 3VTHA 5BRHA 1M1KO 1X3NA 5AQIA 2GEMA 5C10A 4O5FA 4XH5A 3A5OC 3CETA 3CCUN 4H5VA 3MN7A 3CD6N 3IMXA 1MDUB 4PKIA 1HKBA 2V52B 2J4RA 1E4FT 4BRNA 1SZ2A 3M6GA 3VGLA 3CCEN 1ZBSA 3CQYA 3HOSA 3L4IA 3H3OB 4GV9A 3QFUA 5TKWA 5CHIA 2PBDA 5EOYA 1VQKN 4WF9L 3ZETB 2MBKA 1Y64A 1QHAA 2GX9A 1BWFO 3AAQA 4KH4A 4JKBA 4A5BA 4GV3A 4ISEA 5GIOA 4PKGA 2JDQD 2NRRA 4B1VA 4YOVA 2Q36A 3GBTA 1YXQA 1VQON 3DXKB 3E9LA 2P9NA 3RVCA 1K8AO 5AZIB 5ADXH 3RSEB 4J8FA 4BRKA 4CBUA 4BVOA 1MWKA 3TU5A 3KHWA 3MX5A 5C2DA 2VY6A 2QWNA 4JKGB 3VEYA 2P9SA 1GLLO 3MN5A 3MCAB 4JKDA 3CW4A 3A5NC 3O4WA 4RWTA 3L0QA 3C7NA 1XUPO 4DB3A 5GAEP 3CCMN 3FZMA 3GL1A 1NLVA 1WUAA 3FLCO 4EHUA 1NGIA 1YUWA 4BC3A 5AQSA 2WUSA 1YAGA 5KQDA 1H1VA 4YOWA 5HL7L 4K25A 5C12A 2E1ZA 4IDHA 4BRFA 4FWQA 4BRCA 1HPMA 2QWPA 3LDLA 3FZFA 5EVZA 4JK9A 4BQZA 1WOQA 4MDBA 3LDNA 1EQYA 2IVOA 3A8YA 3ULEB 1YI2N 5JMVA 4FWRA 3OBWA 4WQ4C 4BRQA 1VQMN 2E88A 4QS8A 4DKWA 3UE5A 5BRDA 1DGKN 2HBMA 3A5MC 4CZIA 4XH4A 1Q7YO 1V4SA 5JVHL 4IJAA 3MX2A 4CZJA 2HBJA 1N8RO 3H46O 2VWBA 2LN8A 3H1QA 1VQ6N 4H5NA 5AQPA 3GOIA 1QQNA 3SAGA 2D0OA 3KWIA 4A62A 1YHQN 1ILYA 2HOEA 4O8UA 2A3ZA 3NVKA 4GV6A 4OPAA 2A6AA 1LCUA 1ZXOA 3DWLA 4WQ5C 1NGEA 2ZWHA 3FR0A 5LJVA 4IWVA 3E1YA 4A61A 4DHYA 5M1OA 4FWKA 4JD2A 3H6EA 1V4TA 2FSNA 2WBNA 5FPNA 2FSKA 1ATSA 4H5WA 2QM1A 4AF1A 3ZYYX 3AGRA 3WEEA 4AM6A 3MN6A 4M7YA 4CI6A 3D2FA 3FE1A 3L6QA 3TTCA 5B8HA 1XC3A 4BR2A 4IO8A 3MCPA 2A42A 5AQXA 1Q81O 4WCEL 2Q97A 2NLXA 4JKCA 1LOTB 3ENHA 1NGDA 2EWSA 1BDGA 1KD1O 4IEIA 5M1PA 4CD3A 2JWLA 2QWLA 3CJ1A 3GE1A 4H0XB 3MMVA 1R59O 2F7TA 2HMPA 5KPTA 4FOEA 2ZGYA 1XQSC 3G71N 4H5RA 4BC2A 4ILJA 3VEXA 1NMDA 5AQKA 2D0PA 4JAXA 4KH6A 1DKGD 2ZJPL 5CE3A 1GLAG 5F0XA 3F9MA 3SBTA 2P9PB 5ELZA 1NGFA 1KQSM 3O1WA 2W00A 2OTJN 1TYQA 1QZ5A 3E66A 2QWMA 3EO3A 3EN9A 3WXKA 4I6MB 5BPLA 3F5TA 3HI0A 3P38A 3SAHA 3MWPA 3BF3A 4HTLA 3TSQA 2KKZA 2IVPA 3LM2A 1HJOA 3TTDA 3G6EN 4YDUA 2HF4A 1HX1A 2P9NB 3ZEUA 4B1YB 3BUZB 2ZJRL 3SK3A 2YI1A 4H0VB 4BRMA 3SF4D 3N4QA 3QB0A 5LY3A 3GDQA 2CGJA 4DCHA 2P9IA 3O6WA 3R3LA 1YJWN 5AQMA 1TUUA 5M1KA 3CCVN 1U6ZA 4FPAA 2QWQA 4UY8O 1U2VA 3O9RA 2A41A 4U7BA 3DXMA 3O80A 4JKFA 1VQ7N 3CCQN 2E2PA 3HSCA 3SBGA 1C0GA 4M63C 1O13A 2YHXA 4NLBA 3KWGA 3WXIA 3LDOA 2W41A 2RE2A 3QDKA 3MWTA 4BEBA 5AQGA 2VGMA 3CCSN 2QTDA 3SLCA 3CIPA 4BC4A 5JICA 2ZF5O 4WFBL 2D56A 3U9DA 2PAVA 3CJ7A 5E84A 4JHDB 3UKRA 2GTDA 2DPNA 3OW2M 4K42A 1IG8A 3VEWA 2FF3B 1YJ9N 5AQFA 1IJJA 3C6AA 3CCLN 1BUPA 3AGKA 2YHWA 3EE9A 3D2EB 2CGKA 3T69A 2E2NA 2A40A 3CJCA 3O5BA 1KAYA 5BR9A 2P9UA 1EO1A 5EXWA 3HM8A 4BGBA 5GADP 3CCJN 1GLDG 1TUYA 4A57A 1KC8O 4ILHA 4JNEA 1NWKA 1NGCA 1QQOA 3JS6A 2JWKA 3R2VA 3FGUA 3MDQA 1BO5O 2QW9A 4RCHA 4CZEA 3HTVA 4A5AA 4K41A 1W2BM 2P9LA 4IZ9A 1GLFO 2V7YA 3ID8A 5JLHA 4PL8A 5AQRA 4Y0WA 3VF6A 1JJ2M 4FWSA 3BP8A 3O9SA 3KC6A 1T6DA 1YJNN 5BN8A 5CR4A 5LJWA 3HBTA 4FWLA 3HOTA 4A59A 3CPWM 2BH1A 3VEZA 2VGNA 5GAGP 5AZJA 4BG9A 3CF5L 4JD2B 2YX6A 3WUHA 1KAXA 1OVYA 3UKUB 3FFKB 1T6CA 1W97L 4BRDA 3J7ZO 4B9QA 5FPDA 2ASMA 2CH6A 2F9TA 1NGHA 4R79A 4PHTX 3D2FB 3M5RA 3DLLL 3QMLA 1K8KB 3CJBA 3TSPA 1VQLN 4M7XA 4H0PA 3CERA 3CXCM 2C1GA 1JCGA 3AARA 3ZETA 3I33A 5AQZA 3HZ6A 5BPNA 1X9JA 4BROA 3CJAA 5EX5A 2E20A 5DM6L 1POIA 1G99A 1X3MA 1ESVA 2F9WA 2YILA 1KXPA 2QI2A 3EL2A 3IKMA 1ATNA 2OTLN 4CZMA 1VQPN 3DXKA 4BR9A 2FSJA 2ZGZA 3P31A 1YF5L 5AZIA 4LC9B 4YORA 3R9PA 3VPZA 4BR4A 4DQ8A 4OO1J 4H5TA 3CHWA 3VF2A 3ZX0A 4YOTA 3C6HA 2YHYA 3CC2N 2IVNA 5HOOA 5AQJA 3FZKA 4YOXA 2NRHA 2E1YA 4JKGA 5JLFA 4A2BA 4BECA 2ITMA 1MA9B 1YITN 5AQVA 4MLHA 2Q2RA 4KH5A 2E2FA 3O08A 3T7ZA 5GAHP 1JCFA 2QEXN 5AQLA 4BQLA 1NM1A 4H03B 2P9KB 4CZLA 3O9UA 1Q82O 2I7NA 3ENOA 3Q7CA 3WT0A 5FPMA 2E2QA 3C0BA 1DEJA 2V51B 3VERA 3VOVA 5E26A 5BREA 2FF6A 4Z94A 2D1KA 1Q86O 3D6RA 4B1WB 2NRXA 4F9OA 1J6ZA 3MK6A 4H0TB 2GWJA 4YDUC 4C1NI 2MN5A 5AQQA 2Q1NA 1BA0A 5AQOA 4CBWA 5M1NA 1HKCA 3ULEA 2NNWA 4FWOA 4CZFA 3O9TA 3I56N 4BE7B 3EKUA 2FLOA 4BR7A 2Q0RA 3ATVA 4CBXA 4GVEA 3U9ZA 3WXMB 1SAZA 1Q18A 4BR0A 3VMFB 3H45C 2BUPA 2KLAA 4MO5A 5GINA 1CZAN 4E1JA 3CC4N 3LDPA 3M3ZA 4YOYA 4XH1A 4G9ZA 4WYBA 4CZGA 1P8ZA 4IEEA 2PFUA 4ISGA 4BRAA 4RTFD 1YIJN 4FPBA 5KPZA 4IXCA 3D7EO 5TKYA 3U4LA 4HWIA 3I55N 3OA9A 2NRZA 3CMEN 4OPHA 3TSUA 2WFBA 4FWMA 4CD1A 2P9SB 3C65A 1GLEG 5C0YA 3A0IX 3A5LC 3IDHA 1MWMA 3VEVA 3W3DA 3S41A 3ZX2A 4MLEA 5M1QA 3OBYA 3G4SN 3C7NB 1YVNA 1VQ5N 3CC7N 4EIAA 3M1FA 4FSVA 3DAWA 2CGLA 3U8XA 3VEOA 3HRGA 1RDUA 2ZJQL 1KAZA 1HUXA 1S22A 3MN9A 4XEIA 1NGJA 2NRWA 3P4IA 5KPRA 1BG3A 4H0OA 3ZX3A 4B1UB 3H3NO 1K73O 1JCEA 1Z6RA 1RDWX 3N4PA 4ISFA 5AZJB 5MLCQ 5DM7L 4JKEA 4XJXA 4IO9L 2UYTA 3ENBA 3K9JA 3R6MA 4FO0A 1RGIA 3TTFA 2YCHA 1QVGM 3GG4A 4BREA 1D4XA 1K9MO 3LM9A 3VGKA 2D4WA 2P9PA 4B1ZA 4ILGB 2GUPA 4EAHD 5I9EB 4L3QA 2HBLA 2NRVA 1HLUA 3CCRN 1QZ6A 2FXUA 2GELA 2VCPA 5BN9A 4I6MA 4EHTA 3SJHA 3TPQA 1ZC6A 2HBKA 3IFRA 4IOXA 1C0FA 4BVPA 1NGAA 3JXUA 2RHKA 2IIRA 3F2KA 3SMPA 4MO4A 4CJ7A 4WFAL 4WFNL 1Z05A 3NVMA 3PIPL 2Q31A 1BOTO 4FOIA 1NBWA 3ATUA 3IUCA 1QVFM 4IFEA 4EFHA 1P90A 1GLCG 5GIPA 3P39A 3WEEB 2CH5A 3VF4A 4BY9C 4BRGA 3PIOL 3I8BA 4QS7A 4FWPA 3O8MA 4JK8A 1BA1A 2V7ZA 1DT9A 3EZWA 4BRIA 3W0LA 2AP1A 5AFUA 3K9KA 2ASPA 4JKAA 2QXLA 4IJNA 4GNIA 2W40A 1S72N 3DJCA 2E2OA 3WQUA 1NJIO 1NGGA 3CMAN 2KHOA 3BF1A 4NB4A 2H3GX 1S3XA 3SMSA 1VQNN 2HF3A 1SQKA 1VAZA 1VQ9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYP A;  3KHY A;  3KZB A;  3VEN A;  3UB5 A;  4A2A A;  2QWR A;  4BRH A;  4CZK A;  3RSE A;  5KQ8 A;  3D2E A;  3VGM A;  3EKS A;  1GLB G;  4BG8 A;  1TYQ B;  3QBX A;  2GWK A;  1BU6 O;  5F2R A;  2ASO A;  4FWN A;  3VES A;  3QFP A;  3BEX A;  3AY9 A;  3G25 A;  2YJF A;  3FZH A;  3QIC A;  4O8K A;  2I7P A;  5AQH A;  4BRP A;  4JHD A;  3ZEU B;  3KVG A;  5ADX A;  4WQ4 A;  1E4G T;  3OHR A;  3AAP A;  2OAN A;  2A5X A;  4BC5 A;  2P9I B;  5BPM A;  5AR0 A;  2Q0U A;  5AQU A;  4BRL A;  3VET A;  5AQY A;  4NO7 A;  3UKU A;  4PKH A;  1U2V B;  3DXM B;  1NGB A;  3O1B A;  3H1V X;  4BGA A;  4AM7 A;  2NZT A;  3LL3 A;  1K8K A;  4WQ5 A;  4C23 A;  4QS9 A;  3WXJ A;  3CJ9 A;  5AQW A;  4B1X B;  3J8A A;  2E8A A;  1GLJ O;  4H0Y B;  3B8A X;  4JN4 A;  3R8E A;  3UKR B;  4KBO A;  3LDQ A;  3FZL A;  2AA4 A;  5F1X A;  1T44 A;  2QWO A;  4GY2 B;  5BRF A;  1RFQ A;  5FPE A;  2P9U B;  1HKG A;  3WXL A;  4K43 A;  4BR5 A;  4FL9 A;  5AQT A;  2YJE A;  4CZH A;  2BTF A;  1QQM A;  5AQN A;  4PL7 A;  2P9L B;  3CQX A;  5EY4 A;  1OKJ A;  1ATR A;  3CI5 A;  2P9K A;  3WQT A;  3QBW A;  5AFU H;  5BRH A;  1X3N A;  5AQI A;  2GEM A;  4O5F A;  4XH5 A;  3A5O C;  3CET A;  4H5V A;  3MN7 A;  3IMX A;  1MDU B;  4PKI A;  1HKB A;  2V52 B;  2J4R A;  1E4F T;  4BRN A;  1SZ2 A;  3M6G A;  3VGL A;  1ZBS A;  3CQY A;  3L4I A;  3H3O B;  3QFU A;  2PBD A;  5EOY A;  3ZET B;  1Y64 A;  1QHA A;  1BWF O;  3AAQ A;  4ISE A;  4PKG A;  4B1V A;  2Q36 A;  3GBT A;  1YXQ A;  3DXK B;  2P9N A;  5AZI B;  5ADX H;  3RSE B;  4J8F A;  4BRK A;  4CBU A;  4BVO A;  1MWK A;  3TU5 A;  2QWN A;  3VEY A;  2P9S A;  1GLL O;  3MN5 A;  3A5N C;  3O4W A;  4RWT A;  3L0Q A;  3C7N A;  1XUP O;  4DB3 A;  3FZM A;  3GL1 A;  1NLV A;  1WUA A;  3FLC O;  4EHU A;  1NGI A;  1YUW A;  4BC3 A;  5AQS A;  2WUS A;  1YAG A;  5KQD A;  1H1V A;  4K25 A;  2E1Z A;  4BRF A;  4FWQ A;  4BRC A;  1HPM A;  2QWP A;  3LDL A;  3FZF A;  5EVZ A;  4BQZ A;  1WOQ A;  3LDN A;  1EQY A;  2IVO A;  3A8Y A;  3ULE B;  5JMV A;  4FWR A;  4WQ4 C;  4BRQ A;  2E88 A;  4QS8 A;  3UE5 A;  5BRD A;  1DGK N;  3A5M C;  4CZI A;  4XH4 A;  1V4S A;  4IJA A;  4CZJ A;  3H46 O;  2VWB A;  3H1Q A;  4H5N A;  5AQP A;  3GOI A;  1QQN A;  2D0O A;  4A62 A;  2HOE A;  2A3Z A;  2A6A A;  1LCU A;  1ZXO A;  3DWL A;  4WQ5 C;  1NGE A;  2ZWH A;  3FR0 A;  5LJV A;  4IWV A;  4DHY A;  4A61 A;  4FWK A;  4JD2 A;  3H6E A;  1V4T A;  2FSN A;  5FPN A;  2FSK A;  1ATS A;  4H5W A;  2QM1 A;  4AM6 A;  3WEE A;  3MN6 A;  4M7Y A;  4CI6 A;  3D2F A;  3FE1 A;  3L6Q A;  5B8H A;  1XC3 A;  4BR2 A;  4IO8 A;  3MCP A;  2A42 A;  5AQX A;  2Q97 A;  2NLX A;  1LOT B;  3ENH A;  1NGD A;  2EWS A;  1BDG A;  4CD3 A;  2QWL A;  3CJ1 A;  3GE1 A;  4H0X B;  3MMV A;  1R59 O;  2HMP A;  5KPT A;  4FOE A;  2ZGY A;  1XQS C;  4H5R A;  4BC2 A;  3VEX A;  1NMD A;  5AQK A;  2D0P A;  4JAX A;  1DKG D;  5CE3 A;  1GLA G;  5F0X A;  3F9M A;  2P9P B;  5ELZ A;  1NGF A;  3O1W A;  1TYQ A;  1QZ5 A;  3EO3 A;  2QWM A;  3EN9 A;  3WXK A;  4I6M B;  5BPL A;  3HI0 A;  3BF3 A;  4HTL A;  2IVP A;  3LM2 A;  1HJO A;  4YDU A;  2HF4 A;  1HX1 A;  2P9N B;  3ZEU A;  4B1Y B;  3BUZ B;  3SK3 A;  2YI1 A;  4H0V B;  4BRM A;  3QB0 A;  5LY3 A;  3GDQ A;  2CGJ A;  4DCH A;  2P9I A;  3O6W A;  5AQM A;  1TUU A;  1U6Z A;  4FPA A;  2QWQ A;  1U2V A;  2A41 A;  3DXM A;  3O80 A;  2E2P A;  3HSC A;  1C0G A;  4M63 C;  2YHX A;  3WXI A;  3LDO A;  2W41 A;  3QDK A;  5AQG A;  3SLC A;  3CIP A;  4BC4 A;  5JIC A;  2ZF5 O;  3U9D A;  2PAV A;  3CJ7 A;  5E84 A;  4JHD B;  3UKR A;  2GTD A;  2DPN A;  4K42 A;  1IG8 A;  3VEW A;  2FF3 B;  5AQF A;  1IJJ A;  1BUP A;  2YHW A;  3D2E B;  2CGK A;  2E2N A;  2A40 A;  3CJC A;  3O5B A;  1KAY A;  5BR9 A;  2P9U A;  5EXW A;  3HM8 A;  4BGB A;  1GLD G;  1TUY A;  4JNE A;  1NWK A;  1NGC A;  1QQO A;  3JS6 A;  3FGU A;  3MDQ A;  1BO5 O;  2QW9 A;  4RCH A;  4CZE A;  3HTV A;  4K41 A;  2P9L A;  4IZ9 A;  1GLF O;  2V7Y A;  3ID8 A;  5JLH A;  4PL8 A;  5AQR A;  4Y0W A;  3VF6 A;  4FWS A;  3BP8 A;  1T6D A;  5BN8 A;  5LJW A;  3HBT A;  4FWL A;  3VEZ A;  5AZJ A;  4BG9 A;  4JD2 B;  3WUH A;  1KAX A;  3UKU B;  4BRD A;  3FFK B;  1T6C A;  4B9Q A;  5FPD A;  2ASM A;  2CH6 A;  2F9T A;  1NGH A;  3D2F B;  3QML A;  1K8K B;  3CJB A;  4M7X A;  4H0P A;  3CER A;  1JCG A;  3AAR A;  3ZET A;  3I33 A;  5AQZ A;  3HZ6 A;  5BPN A;  1X9J A;  4BRO A;  3CJA A;  5EX5 A;  2E20 A;  1G99 A;  1X3M A;  1ESV A;  2F9W A;  1KXP A;  3EL2 A;  1ATN A;  4CZM A;  3DXK A;  4BR9 A;  2FSJ A;  2ZGZ A;  3R9P A;  3VPZ A;  5AZI A;  4LC9 B;  4BR4 A;  4DQ8 A;  4H5T A;  3CHW A;  3VF2 A;  3ZX0 A;  2YHY A;  2IVN A;  5AQJ A;  3FZK A;  2NRH A;  2E1Y A;  5JLF A;  4A2B A;  2ITM A;  1MA9 B;  5AQV A;  4MLH A;  2Q2R A;  3O08 A;  1JCF A;  5AQL A;  4BQL A;  1NM1 A;  4H03 B;  2P9K B;  4CZL A;  2I7N A;  3ENO A;  3WT0 A;  5FPM A;  2E2Q A;  3C0B A;  1DEJ A;  2V51 B;  3VER A;  3VOV A;  5E26 A;  5BRE A;  2FF6 A;  4Z94 A;  2D1K A;  4B1W B;  4F9O A;  1J6Z A;  3MK6 A;  4H0T B;  2GWJ A;  4YDU C;  5AQQ A;  2Q1N A;  1BA0 A;  5AQO A;  4CBW A;  1HKC A;  3ULE A;  4FWO A;  4CZF A;  3EKU A;  2FLO A;  4BR7 A;  2Q0R A;  3ATV A;  4CBX A;  3U9Z A;  1SAZ A;  1Q18 A;  4BR0 A;  3H45 C;  2BUP A;  4MO5 A;  1CZA N;  4E1J A;  3LDP A;  3M3Z A;  4XH1 A;  4WYB A;  4CZG A;  1P8Z A;  4ISG A;  4BRA A;  4RTF D;  4FPB A;  5KPZ A;  4IXC A;  3D7E O;  5TKY A;  3U4L A;  4HWI A;  4FWM A;  4CD1 A;  2P9S B;  1GLE G;  3A0I X;  3A5L C;  3IDH A;  1MWM A;  3VEV A;  3W3D A;  3S41 A;  3ZX2 A;  4MLE A;  3C7N B;  1YVN A;  4EIA A;  3M1F A;  4FSV A;  3DAW A;  2CGL A;  3U8X A;  3VEO A;  1KAZ A;  1HUX A;  1S22 A;  3MN9 A;  4XEI A;  1NGJ A;  3P4I A;  5KPR A;  1BG3 A;  4H0O A;  3ZX3 A;  4B1U B;  3H3N O;  1JCE A;  1Z6R A;  1RDW X;  4ISF A;  5AZJ B;  2UYT A;  3R6M A;  4FO0 A;  1RGI A;  2YCH A;  3GG4 A;  4BRE A;  1D4X A;  3LM9 A;  3VGK A;  2D4W A;  2P9P A;  4B1Z A;  4EAH D;  2GUP A;  5I9E B;  4L3Q A;  1HLU A;  1QZ6 A;  2FXU A;  2GEL A;  2VCP A;  5BN9 A;  4I6M A;  4EHT A;  3SJH A;  3TPQ A;  1ZC6 A;  3IFR A;  1C0F A;  4BVP A;  1NGA A;  3JXU A;  2IIR A;  3SMP A;  4CJ7 A;  4MO4 A;  1Z05 A;  2Q31 A;  1BOT O;  4FOI A;  1NBW A;  3ATU A;  3IUC A;  4EFH A;  1GLC G;  3WEE B;  2CH5 A;  3VF4 A;  4BRG A;  3I8B A;  4QS7 A;  4FWP A;  3O8M A;  1BA1 A;  2V7Z A;  3EZW A;  4BRI A;  3W0L A;  2AP1 A;  5AFU A;  2ASP A;  2QXL A;  4IJN A;  4GNI A;  2W40 A;  3DJC A;  2E2O A;  3WQU A;  1NGG A;  2KHO A;  3BF1 A;  4NB4 A;  2H3G X;  1S3X A;  3SMS A;  2HF3 A;  1SQK A; 
#chains in the Genus database with same CATH topology
 3P1G A;  3PSI A;  3UB5 A;  1D5A A;  1N5Y A;  2QXF A;  3RSE A;  3D2E A;  1WSH A;  4HUG A;  4HCC A;  1T3V A;  2I61 A;  1J5E K;  1N32 K;  4IOC L;  1TYQ B;  3QBX A;  3WNF A;  4FK0 A;  1BU6 O;  5F2R A;  4JEP A;  2G8F A;  4M3R A;  4CE9 A;  3BEX A;  4M3Y A;  1J54 A;  2O8C B;  3O3H A;  3NBP A;  4DR1 K;  4LFB K;  3ZEU B;  4AB0 A;  3AO1 A;  4KHQ A;  3WNH A;  3AAP A;  2HST A;  2A5X A;  1C0M A;  3VQQ A;  1SNB A;  4BC5 A;  2P9I B;  3DLB A;  1J9A A;  4DTN A;  2ASC A;  2VQF K;  5AQY A;  1GOA A;  3CM6 A;  3H1V X;  4KV8 A;  3PX4 A;  3PLA A;  2YNH A;  2UU9 K;  2NZT A;  4CJ5 A;  4Z0U A;  4C23 A;  3OYK A;  4FK4 A;  1I2V A;  4X66 K;  4MDA A;  4NLC A;  1S9G A;  3OYE A;  2P51 A;  4DQP A;  5F1X A;  3O4Q A;  3PX6 A;  2OZM A;  3QI7 A;  2QA4 N;  4NYF A;  2YEO A;  3IRX A;  4FLV A;  3WXL A;  1HNI A;  4C1N K;  5J2N A;  4FZZ A;  5JS2 A;  4BR5 A;  1NJZ A;  2YJE A;  1L3U A;  1QQM A;  1SV5 A;  2C1I A;  4PL7 A;  3QES A;  5C2F A;  1HPZ A;  2P9K A;  3AVF A;  3HPG A;  4DR5 K;  3VTH A;  1LV5 A;  2IGI A;  2GEM A;  3WNG A;  4KFB A;  4JI3 K;  1D8Y A;  3A5O C;  4CVN E;  1B92 A;  3MN7 A;  3IMX A;  4GW6 A;  1HKB A;  3OVN A;  1U04 A;  1E4F T;  1BL3 A;  1OVQ A;  4F3O A;  1PTX A;  3VGL A;  1NG9 A;  2KBH A;  1ZBS A;  3L4I A;  3H3O B;  4GV9 A;  4PWD A;  5TKW A;  2MBK A;  1Y64 A;  5HP1 A;  2GX9 A;  1HRH A;  4GV3 A;  3DLE A;  4B1V A;  2D5R A;  3OYF A;  3DXK B;  4NCA A;  3RVC A;  4DUZ K;  2HNZ A;  4FJJ A;  3SJJ A;  4BVO A;  4JI5 K;  4LY7 A;  5LL6 Z;  1W0H A;  1RT6 A;  4JKG B;  3VEY A;  2N2R A;  2P9S A;  4OGE A;  4ELV A;  1G15 A;  5IWA K;  4LF5 K;  3L0Q A;  2OPR A;  5GAE P;  3GL1 A;  1WUA A;  4G1Q A;  1IV0 A;  1C1A A;  3RMA A;  4YOW A;  5HL7 L;  2HND A;  4I9Q A;  4DSE A;  4IDH A;  4LF8 K;  1ZBI A;  4JS5 A;  4C8M A;  3DLH A;  4ZTJ A;  3CFP A;  2XHB A;  3PSM A;  1JKZ A;  4WQ4 C;  5EU7 A;  1R0A A;  1Q7Y O;  3A5M C;  4XH4 A;  3HVT A;  4KHP K;  3MXI A;  4DV4 K;  3H46 O;  2VWB A;  2LN8 A;  1VQ6 N;  4H5N A;  3GOI A;  1SN1 A;  4FJ9 A;  1NU0 A;  3SAG A;  3AV9 A;  4OPK A;  3TAR A;  3NVK A;  2B5J A;  4JI0 K;  2GUI A;  1LCU A;  1ZXO A;  3OTO K;  3K5M A;  1NE5 A;  4QOZ B;  3KLF A;  2ZWH A;  3FR0 A;  2G2K A;  1N33 K;  4GKJ K;  4FWK A;  3H6E A;  1V4T A;  2FSN A;  3E7U X;  4AM6 A;  1GOC A;  3WEE A;  3JSM A;  4CI6 A;  1RDA A;  3MCP A;  4OVL A;  3U3Y A;  3E01 A;  1NGD A;  2EWS A;  1BDG A;  3ULD A;  1SKR A;  3GE1 A;  2W6K A;  1NJX A;  4OX9 K;  3G71 N;  5HRO A;  4DR6 K;  1ZBL A;  1NMD A;  5AQK A;  4JAX A;  1GLA G;  1KSP A;  4KI6 A;  1GPT A;  2W00 A;  2OTJ N;  1TYQ A;  1QSS A;  2ETJ A;  2B68 A;  1QZ5 A;  3THX B;  3EN9 A;  4I6M B;  1D9F A;  3SUP A;  2KKZ A;  1RT3 A;  2HNY A;  2O8C A;  3HL8 A;  3TTD A;  4EP5 A;  1HX1 A;  5HRR A;  3ZEU A;  2ZJR L;  1JXB A;  4TSX A;  2Z1H A;  5K14 A;  5LY3 A;  1TL3 A;  2RKI A;  3K5L A;  4K8Z A;  2P9I A;  3R3L A;  1YJW N;  4CFB A;  3DLR A;  4H4M A;  4DFJ A;  3OJS A;  4V19 S;  3AVH A;  4JKF A;  3CYM A;  2KBJ A;  4M63 C;  1O13 A;  4AIL C;  1XNQ K;  4DR4 K;  3LDO A;  2W41 A;  2RE2 A;  3QDK A;  3LAK A;  3MWT A;  3ZT2 A;  1FKP A;  1CXQ A;  3CIP A;  5J1E A;  3MEG A;  5KTQ A;  4J2E A;  1QS4 A;  5E84 A;  3VA3 A;  4DV1 K;  3VEW A;  1IG8 A;  1YJ9 N;  3T1H K;  1IJJ A;  3AGK A;  1T7B A;  1RBT A;  4FLZ A;  1RTH A;  3T69 A;  3HPO A;  2A40 A;  1KAY A;  4YY3 K;  5CY0 A;  2XY8 A;  2BE2 A;  1EX4 A;  4A57 A;  4ELT A;  4BE2 A;  4OLA A;  4W5T A;  2JWK A;  3TAQ A;  5J2P A;  3FGU A;  2DFE A;  4DF4 A;  1RBR A;  3DLK A;  4DSL A;  1BO5 O;  1J5O A;  1I94 K;  4IZ9 A;  1GLF O;  4DSJ A;  3AO4 A;  4PL8 A;  5KI6 A;  1JJ2 M;  4B3S K;  4B3O A;  4Q5V A;  4CES A;  1RTI A;  3AVM A;  1MYN A;  3DYA A;  5GAG P;  4M3X A;  4AHR A;  3PX0 A;  3UKU B;  3K58 A;  4BRD A;  2JLE A;  1QHT A;  4B9Q A;  4EP4 A;  5FPD A;  2ASM A;  4LF6 K;  1S1V A;  3K0S A;  3F73 A;  3PO5 A;  3M5R A;  3RR7 A;  3QML A;  3VQ7 A;  3L3U A;  4HCB A;  4KKO A;  4EZ6 A;  4LFA K;  2AJQ A;  4LF7 K;  1JXC A;  5BPN A;  5DM6 L;  3CJA A;  5EX5 A;  1FH3 A;  3ZCM A;  1PE4 A;  1RT5 A;  2YIL A;  4B9M A;  4DQI A;  4DSK A;  1ATN A;  3AO5 A;  3DXK A;  2ZGZ A;  2E4L A;  3P31 A;  1YF5 L;  4BR4 A;  4OO1 J;  5SZT A;  2QKK A;  3ZX0 A;  4FJG A;  2YHY A;  3QER A;  2RN2 A;  2YNF A;  2NRH A;  4JKG A;  2UXC K;  2XO7 A;  2ITM A;  1MA9 B;  4BDZ A;  2R7Y A;  3T3F A;  3O08 A;  2QEX N;  1JZB A;  4H03 B;  1NK4 A;  4KTQ A;  4KHY A;  3O9U A;  3ENO A;  4CJK A;  3NH0 A;  4HHF A;  2GBZ A;  4FJN A;  3MEE A;  3SNN A;  3PV8 A;  1W7A A;  3ZSW A;  3D6R A;  2ITG A;  4LH5 A;  3MK6 A;  4F8R A;  2GWJ A;  4C1N I;  2MN5 A;  5M1N A;  4Z4G A;  3RTV A;  4CJT A;  3VA0 A;  1JL2 A;  2FLO A;  2Q0R A;  3WXM B;  4RW4 A;  3KK3 A;  1Q18 A;  1NK7 A;  3VMF B;  4FK2 A;  5JEN A;  3NDK A;  4IEE A;  4E7K A;  4AHU A;  4Q0B A;  4ISG A;  4CJF A;  3D7E O;  1REV A;  4HWI A;  2NRZ A;  2RPI A;  2A7T A;  1WSG A;  1S6Q A;  1GOB A;  4Z4H A;  2LY6 A;  3IDH A;  3A2F A;  3VEV A;  1XNR K;  3ZX2 A;  2GV9 A;  1SKW A;  4B9L A;  3G4S N;  3C7N B;  1YVN A;  1IBL K;  1K8B A;  3QIN A;  3DAW A;  1EWR A;  3HRG A;  2ATQ A;  2HHS A;  1EWQ A;  1S22 A;  1HUX A;  5KGW A;  1VSK A;  1NGJ A;  1BG3 A;  1VSH A;  3ZSV A;  1JCE A;  1Z6R A;  5LMN K;  4ISF A;  4KHW A;  5DM7 L;  3RR8 A;  1NRB A;  1YT3 A;  2UYT A;  1Z26 A;  3P83 D;  3K9J A;  3K59 A;  4CCH A;  3TTF A;  2ZQB A;  2E6M A;  4ID5 A;  4RW9 A;  1K9M O;  4E7I A;  1OH7 A;  2N66 A;  4B1Z A;  4ILG B;  2KBK A;  3IG1 A;  4EAH D;  4M3Z A;  4FJL A;  3THX A;  1NOZ A;  1QZ6 A;  4CJ4 A;  2VCP A;  4I6M A;  2XY6 A;  3TPQ A;  3IS9 A;  4X62 K;  3RMB A;  4MO4 A;  3NVM A;  2Q31 A;  1VRT A;  3AVN A;  2F96 A;  1TKZ A;  3GKU A;  4GVM A;  1GLC G;  2XRI A;  4BY9 C;  2CH5 A;  4B9N A;  2KFN A;  2DTU A;  3KOW A;  4MFB A;  2Q3S A;  4JK8 A;  3NAE A;  1BA1 A;  2NY9 X;  2P5O A;  4FJ7 A;  1DT9 A;  4BRI A;  3W0L A;  1BIS A;  2AP1 A;  5AFU A;  3K9K A;  4IJN A;  4GNI A;  2W40 A;  3DJC A;  2E2O A;  1NJI O;  1I2U A;  2LI7 A;  1NGG A;  3CMA N;  3KLH A;  3BF1 A;  2H3G X;  1S3X A;  3PO4 A;  2FBX A;  3V9Z A;  1VQ9 N;  2VYP A;  3LP3 A;  3VEN A;  4FM1 A;  3Q7B A;  3VQA A;  4A2A A;  1QTM A;  4FJ5 A;  4CEB A;  1FK9 A;  5KQ8 A;  3VGM A;  1GLB G;  4BG8 A;  2IC3 A;  4DMN A;  4CJW A;  4DTJ A;  3VES A;  4HTU A;  4CHZ A;  4ZTF A;  3AY9 A;  4KHS A;  2YIP A;  1M90 O;  3ID6 A;  1RNH A;  4YOU A;  1T7E A;  5ADX A;  1JL1 A;  4JI7 K;  4KB0 A;  4CJ3 A;  1KVB A;  2PYL A;  1JLQ A;  1WB9 A;  4CGG A;  5AR0 A;  2BDP A;  3NH1 A;  5AQU A;  4BRL A;  1HQE A;  3VQ6 A;  3UKU A;  1BQM A;  1U2V B;  3LAN A;  2YHB A;  4JRQ A;  1U48 A;  4DTX A;  4UAF E;  4V1D C;  4AHC A;  2ZD1 A;  3L56 A;  4WQ5 A;  4DU1 A;  4CFA A;  4QS9 A;  3CJ9 A;  4IDK A;  1EET A;  5AQW A;  4Z4I A;  3J8A A;  4JN4 A;  4Z4C A;  3R8E A;  1FKO A;  1LWC A;  1VSI A;  3UKR B;  3VQ8 A;  4CHO A;  3FZL A;  3LAL A;  3NGZ A;  3C95 A;  4UAD E;  1T44 A;  2X6S A;  3OYD A;  4DV5 K;  5FPE A;  2P9U B;  4YHH K;  3M8P A;  1BQN A;  3HK2 A;  1HKG A;  4J2A A;  1U47 A;  5FDL A;  1IBM K;  1RT4 A;  5AQN A;  4I7F A;  3BK3 C;  1TL1 A;  3CQX A;  3NMU A;  4M3T A;  3WQT A;  3VQ4 A;  3EY1 A;  5AFU H;  5BRH A;  1M1K O;  1IH7 A;  1X3N A;  4I2Q A;  3OJU A;  4PUO A;  2HHU A;  4X64 K;  4XH5 A;  3CET A;  3CCU N;  4H5V A;  3ASM A;  3LPT A;  3KOY A;  1Q9Y A;  3M8Q A;  1KLM A;  3CYG A;  1KTQ A;  3VQB A;  4OKE A;  3RRH A;  3QFU A;  4FJI A;  2KSK A;  5EOY A;  1ZU3 A;  1QHA A;  3KOX A;  2EHG A;  1BWF O;  4A5B A;  3QEW A;  2G8V A;  3BGR A;  4CJV A;  4DU3 A;  4ISE A;  4PKG A;  2NRR A;  1Q9X A;  1BGX T;  4YOV A;  3GBT A;  1VQO N;  1EP4 A;  5FLX O;  5AZI B;  5ADX H;  3DM2 A;  1TKT A;  1N4N A;  2Z1I A;  4CBU A;  3MX5 A;  2QWN A;  3MXM A;  1XMO K;  3MN5 A;  5FRN A;  4HE7 A;  4CQK A;  4JKD A;  2Y1J A;  3A5N C;  3AVL A;  4RWT A;  3RRG A;  3C7N A;  4DB3 A;  1PX9 A;  4FJX A;  2WOM A;  1YUW A;  1W9H A;  1YAG A;  5CZ1 A;  5C12 A;  4BRF A;  4FWQ A;  4BWJ A;  2G8U A;  2BAN A;  1HNV A;  1LAW A;  2X78 A;  4JK9 A;  4BQZ A;  3OYJ A;  5CYQ A;  3LDN A;  1IG9 A;  1EQY A;  3IAY A;  2HHI A;  2E88 A;  1YTU A;  4DQS A;  1DGK N;  2HBM A;  1V4S A;  3U6F A;  1VHX A;  1ZBH A;  1JZA A;  5AQP A;  1KVA A;  2VG5 A;  3KWI A;  1ILY A;  3HJF A;  2KW4 A;  2NUB A;  2A3Z A;  3U3G A;  4OPA A;  3L2V A;  1DJT A;  1CZ9 A;  1RDC A;  3DWL A;  1VSE A;  3ZT3 A;  4IWV A;  4A61 A;  3OYN A;  4AF1 A;  5FPN A;  1ATS A;  2QM1 A;  3PUF A;  1WLJ A;  3L6Q A;  5B8H A;  4BR2 A;  4IO8 A;  3SPZ A;  2A42 A;  1Q81 O;  1EKE A;  4JV5 K;  4JKC A;  3ENH A;  4M42 A;  1WWN A;  1KD1 O;  4IEI A;  2QWL A;  3CJ1 A;  2F7T A;  5KPT A;  4FYD A;  3VQ5 A;  4KH6 A;  2G8H A;  4CEF A;  2D0A A;  4DQR A;  3F9M A;  2P9P B;  3EEQ A;  4O0I A;  3KLE A;  2DFF A;  3NF8 A;  2OPQ A;  3AVB A;  2QWM A;  3PSF A;  1TK0 A;  4DS4 A;  1S1T A;  3MWP A;  1HJO A;  4YDU A;  2HF4 A;  2P9N B;  3KD5 E;  3S9H A;  4B1Y B;  3BUZ B;  3SK3 A;  1RDD A;  3PY8 A;  4BRM A;  4KHN A;  3GDQ A;  2CGJ A;  5M1K A;  1TUU A;  3CCV N;  2P5G A;  1U6Z A;  3EZ5 A;  4DSF A;  4E3S A;  4UY8 O;  1U2V A;  4U7B A;  2A41 A;  1HMV A;  2E2P A;  1SL1 A;  4FZY A;  4LF9 K;  4BEB A;  2VGM A;  4F3T A;  3ZT0 A;  4BC4 A;  2D56 A;  3DMJ A;  3U9D A;  4JHD B;  3UKR A;  3OW2 M;  4FCY A;  3C6A A;  3CCL N;  4FLU A;  2CGK A;  4CJP A;  3ZSO A;  5FRM A;  3K2P A;  2P9U A;  1T8E A;  1EO1 A;  3HM8 A;  4BGB A;  3CCJ N;  1GLD G;  1TUY A;  2FC0 A;  4JNE A;  1NGC A;  1QQO A;  4FM0 A;  2QKB A;  1L3S A;  3R2V A;  2LT8 A;  4AHT A;  4RCH A;  1UOC A;  4CJQ A;  3HTV A;  1W2B M;  5HRS A;  2V7Y A;  5JLH A;  5AQR A;  1B9D A;  4Y0W A;  4J2B A;  4O44 A;  3AA5 X;  3KC6 A;  3V1R A;  1FXX A;  4LD0 A;  5LJW A;  4FWL A;  2G8K A;  3HOT A;  4B9V A;  3KK2 A;  2VGN A;  5DMR A;  4BG9 A;  4JD2 B;  3CF5 L;  3J7Z O;  1KAX A;  3FFK B;  3D0P A;  3DRP A;  4N47 A;  4CEO A;  4E7J A;  2CH6 A;  4DLE A;  2F9T A;  4R79 A;  2M8B B;  1RBS A;  3KKR A;  3D2F B;  3L2W A;  3AVK A;  1T0Z A;  4DSI A;  1SKS A;  1NK8 A;  5CY4 A;  2C1G A;  3HZ6 A;  2OCE A;  1X9J A;  1HJR A;  1G99 A;  2F9W A;  1KXP A;  3IKM A;  2ZE2 A;  4CEE A;  1VQP N;  1JLG A;  3R9P A;  3VPZ A;  5AZI A;  4YOR A;  1L3V A;  5T7B A;  4H5T A;  1BMR A;  1S5J A;  5I3U A;  5HRN A;  3UIQ A;  3DOK A;  4JRP A;  4OGC A;  5AQV A;  4KH5 A;  3T7Z A;  3KTQ A;  1JCF A;  4DR7 K;  5HLF A;  1AHO A;  2LSN A;  4Z4E A;  4CZL A;  1Q82 O;  1ZBU A;  5FPM A;  1FW6 A;  1DEJ A;  1VNB A;  5E26 A;  5BRE A;  2FF6 A;  5KGX A;  3OYI A;  2D1K A;  3V9X A;  2NRX A;  3CQ8 A;  4F9O A;  1U49 A;  3LZI A;  3T1A A;  1VSL A;  4F4K A;  1QVG M;  1BA0 A;  5AQO A;  3ALY A;  3I56 N;  5A2Q O;  4FM2 A;  4GVE A;  4MO5 A;  3TAN A;  4BE0 A;  4YOY A;  4WYB A;  4CZG A;  4CHQ A;  1BRZ A;  1GPS A;  3LWM A;  3V9U A;  2LKB A;  4IG3 A;  4OPJ A;  4RTF D;  1YIJ N;  1X1P A;  1TKD A;  5KPZ A;  5TKY A;  4O5B A;  4CHP A;  3M8R A;  3O3F A;  1NKB A;  3CME N;  3TSU A;  3C65 A;  3A5L C;  4DV0 K;  4FXD A;  4FW1 A;  2Z1J A;  4FSV A;  4CED A;  2ZJQ L;  3MN9 A;  3QEP A;  1NPI A;  4DTS A;  4KTW A;  4XEI A;  2IS3 A;  2HVH A;  3QLH A;  3H3N O;  1K73 O;  5AZJ B;  1RDW X;  5I42 A;  4XJX A;  4IO9 L;  3NF6 A;  3V81 A;  3ENB A;  2KYQ A;  4FO0 A;  4DFK A;  2YCH A;  4DFP A;  2UUC K;  3VGK A;  2D4W A;  2P9P A;  2D0B A;  1BHL A;  2GUP A;  2KZZ A;  5I9E B;  1KVC A;  2NRV A;  3TI0 A;  4NCB A;  1TGO A;  4LH4 A;  2FBY A;  3SJH A;  4B08 A;  4CF8 A;  4E72 A;  4CK3 A;  1NGA A;  4H8K A;  2RHK A;  2IIR A;  3KP1 A;  4WFA L;  4CF2 A;  3PIP L;  4CF1 A;  4FJM A;  1NBW A;  3HXM A;  3OYG A;  3NGI A;  3OYA A;  4IFE A;  4CJU A;  4PA1 A;  1KCF A;  2JGU A;  3PIO L;  3I8B A;  4QS7 A;  3O8M A;  3T1Y K;  4AQY K;  2N2Q A;  4JKA A;  4B3T K;  1S72 N;  2PY5 A;  4DV3 K;  2B4J A;  4NB4 A;  3SMS A;  4CK1 A;  3TAB A;  4B9S A;  4JHD A;  4NXN K;  4UAE F;  4JKH A;  3KZB A;  1VQ4 N;  3EE8 A;  4BRH A;  1RT2 A;  4JS4 A;  4CZK A;  1TK5 A;  4KPY A;  2K35 A;  2YC1 C;  4JI4 K;  1NK6 A;  2QK9 A;  3SAF A;  2ZM6 K;  1ZVG A;  1VQ8 N;  1P00 A;  1B9F A;  1HYS A;  4OKJ A;  4W5N A;  5D3G A;  2O4I A;  3QIP A;  4DWI A;  1LQI A;  1VK0 A;  1JLA A;  2GMO A;  5AQH A;  4BRP A;  3KVG A;  4QCL A;  4WQ4 A;  4IOA L;  2IAJ A;  2OAN A;  1IKX A;  3LPU A;  5BPM A;  2WC9 A;  1XWL A;  3F9K A;  3VET A;  4ICL A;  4NO7 A;  3I0S A;  5C15 A;  4DLG A;  4PKH A;  4B9T A;  1B7D A;  1NGB A;  2B3C A;  4BGA A;  3R1X A;  4AM7 A;  3L4Q A;  4CEA A;  3ZSQ A;  3LL3 A;  4KTZ A;  1BK8 A;  1Z25 A;  3HPH A;  4FVU A;  3WXJ A;  2NRT A;  4DR3 K;  2E8A A;  1ICA A;  2UXD K;  3NE6 A;  4KBO A;  3LDQ A;  4X65 K;  1UA1 A;  2O8B B;  1LQQ A;  2KPY A;  2HHH K;  4GY2 B;  5BRF A;  5JVG L;  1IBK K;  4K43 A;  1IKW A;  3ZSZ A;  4FL9 A;  5AQT A;  3RWU A;  4ZHR A;  3ISN C;  4CZH A;  5H1S Q;  1BCG A;  1NK5 A;  3CPE A;  3HYF A;  2HB5 A;  1ATR A;  3CI5 A;  3KK7 A;  1SS6 A;  3QBW A;  1NNE A;  4JK7 A;  2YNG A;  4QAG A;  4DV2 K;  3P5J A;  4O5F A;  1BIZ A;  3CD6 N;  3C94 A;  3LZJ A;  1WBD A;  2J4R A;  1SZ2 A;  2XY5 A;  1UAX A;  4GKK K;  3OYC A;  3TR8 A;  5C25 A;  4H4O A;  3KP0 A;  2LJ7 A;  2KJA A;  3CQY A;  3HOS A;  2D0C A;  4JYA K;  2OPP A;  4NCG A;  2PBD A;  3SUO A;  3DLG A;  3AAQ A;  4JKB A;  5GIO A;  2JDQ D;  5JS1 A;  2Q36 A;  2Z1G A;  1YXQ A;  4C8N A;  3L2Q A;  3E9L A;  4DTO A;  4CK2 A;  3V1O A;  1D9D A;  3RSE B;  3QEV A;  1MWK A;  1LWE A;  2OPS A;  2VY6 A;  3VN5 A;  5KRT A;  4HHT A;  4CER A;  4KRF A;  3DOL A;  1NJW A;  3CW4 A;  1TAQ A;  1I6F A;  3C6U A;  2PZS A;  3FZM A;  1NLV A;  1NGI A;  4BC3 A;  5AQS A;  2WUS A;  4IBN A;  4CEC A;  2Y1I A;  4I2P A;  4BRC A;  1HPM A;  1U45 A;  5FRO A;  2IVO A;  1HNW K;  3ULE B;  4FWR A;  4QS8 A;  4UJ0 A;  5BRD A;  3THY B;  3OY9 A;  4IJA A;  2KTQ A;  4M45 A;  3MX2 A;  2HBJ A;  3VQ9 A;  1YHQ N;  2D0O A;  4A62 A;  3LP0 A;  2HOE A;  4OKK A;  4GV6 A;  2A6A A;  1N6Q A;  4C8K A;  3BZK A;  3E1Y A;  4DHY A;  1TI5 A;  2FSK A;  4AH9 A;  4H5W A;  1NOY A;  3AGR A;  3MN6 A;  4M7Y A;  4CW7 B;  2VWJ A;  4WCE L;  2Q97 A;  2HHW A;  2NLX A;  4CD3 A;  5M1P A;  3QNN A;  2JWL A;  2W6L A;  3CFR A;  3MMV A;  1R59 O;  4GMJ B;  1HNZ K;  2A1S A;  4BC2 A;  5KRS A;  2D0P A;  3LAM A;  4DQQ A;  3HST B;  4DS5 A;  4E1N A;  5F0X A;  4KRE A;  4E19 A;  1KQS M;  1NGF A;  3O1W A;  1T05 A;  1C56 A;  3AA4 A;  3G10 A;  3DRS A;  3EO3 A;  1NH5 A;  4DF8 A;  4JLH A;  4LSL A;  4E0D A;  4FVM A;  5BPL A;  3F5T A;  3P38 A;  4CF9 A;  3ZSY A;  3BF3 A;  4HTL A;  2IDO A;  1C1C A;  3TSQ A;  2IVP A;  4CGI A;  4DV6 K;  3TAG A;  3RMD A;  3G6E N;  1T7A A;  1QSL A;  4KI4 A;  1Y97 A;  1X9M A;  2YI1 A;  4H0V B;  2KFZ A;  3SF4 D;  2RF2 A;  3O3G A;  3O6W A;  5AQM A;  2QWQ A;  3H08 A;  1ZFU A;  1KV0 A;  2KQ2 A;  3O9R A;  2G8W A;  3O80 A;  1LWF A;  3HSC A;  2YHX A;  4BDY A;  3WXI A;  3LWL A;  3O4N A;  2O8D B;  1ASU A;  5AQG A;  2F4V K;  2QTD A;  4WFB L;  4CHY A;  1HNX K;  2PAV A;  1A5W A;  3B6O A;  2GTD A;  2W42 A;  2O8B A;  2DPN A;  2FF3 B;  1RDB A;  5AQF A;  2VWK A;  1BUP A;  2YHW A;  3EE9 A;  3TWH A;  3QEX A;  4R5P A;  5EXW A;  4JI1 K;  1YTA A;  3JS6 A;  4LSN A;  3MDQ A;  3HT3 A;  1WAJ A;  1EXQ A;  5CZ2 A;  4K41 A;  1DLO A;  2BGG A;  3I0R A;  4K8X A;  2O4G A;  4FWS A;  3BP8 A;  1XC9 A;  3O9S A;  1YJN N;  5BN8 A;  5CR4 A;  4A59 A;  4N76 A;  2BH1 A;  1JLF A;  3OS0 A;  2WON A;  1OVY A;  1T6C A;  1W97 L;  2YHA A;  4ID1 A;  2OYQ A;  1NGH A;  4N5S A;  4PHT X;  5HRP A;  3DLL L;  1NKC A;  3LP1 A;  1K8K B;  3CJB A;  1VQL N;  3MXJ A;  3CER A;  3CXC M;  4BRO A;  2E20 A;  1RTJ A;  1POI A;  1X3M A;  1ESV A;  2HHT A;  3QIO A;  3LP2 A;  4N56 A;  4DU4 A;  4W5R A;  4CZM A;  3HVR A;  2FSJ A;  4Y1D A;  3CHW A;  3VF2 A;  3C6H A;  3CC2 N;  1X9W A;  2IVN A;  1LQH A;  3FZK A;  1DQ7 A;  1S6P A;  4YOX A;  5JLF A;  4A2B A;  3J81 O;  1QSY A;  1YIT N;  4MLH A;  5GAH P;  5AQL A;  4BQL A;  4DUY K;  2I7N A;  3WT0 A;  1S1W A;  3C0B A;  2E2Q A;  2E6L A;  3VER A;  4HVJ A;  4Z94 A;  4HUE A;  1IKY A;  4H0T B;  1YVU A;  4FJ8 A;  4FJK A;  5AQQ A;  2Q1N A;  4CBW A;  2UXB K;  3ULE A;  2NNW A;  4FWO A;  4CZF A;  5J2Q A;  4KYP A;  2E3F A;  4BE7 B;  3EKU A;  3THY A;  2HW3 A;  3ATV A;  4WE1 A;  3K5N A;  4BR0 A;  1ITG A;  2KLA A;  3H45 C;  1LW2 A;  2VG7 A;  3KLI A;  4E1J A;  3CC4 N;  3LDP A;  3SQ2 A;  1VSF A;  4Y1C A;  3KLG A;  1P8Z A;  2PFU A;  5SWM A;  1Q8I A;  4FPB A;  4C8L A;  4IXC A;  2YV0 X;  3I55 N;  3OA9 A;  4OPH A;  1ZBF A;  4FWM A;  2X6N A;  1TAU A;  1GLE G;  5C0Y A;  3A0I X;  3W3D A;  1TV6 A;  4MLE A;  5M1Q A;  1VRU A;  3SV3 A;  3VQC A;  1HR0 K;  3U8X A;  3VEO A;  4PY5 A;  2SN3 A;  4O0J A;  1BI4 B;  5C42 A;  1ZVE A;  4E1M A;  3N4P A;  5MLC Q;  4LFC K;  4JKE A;  4HUF A;  2OZS A;  4CJR A;  1RGI A;  3GG4 A;  4BRE A;  1XHZ A;  4FW2 A;  4DTP A;  1ASW A;  1OZZ A;  3L2R A;  3HP6 A;  2HBL A;  4B3M K;  3KIO A;  1HLU A;  4CIE A;  1VSD A;  1N36 K;  4EHT A;  3BZC A;  2HBK A;  3IFR A;  2F8S A;  1C0F A;  4BVP A;  3BDP A;  3F2K A;  3SMP A;  3L3V A;  4CJ7 A;  4WFN L;  2VG6 A;  1Z05 A;  2B6A A;  2LR3 A;  1BOT O;  1SEG A;  3ATU A;  3NCI A;  1QVF M;  3NH2 A;  4EFH A;  3OYB A;  4F2R A;  3VF4 A;  4BRG A;  4LF4 K;  4FWP A;  4W5O A;  3AVA A;  2QXL A;  3I8D A;  4DTR A;  3S3M A;  1KRP A;  4B3R K;  2O8D A;  2EX3 A;  4CF0 A;  1VQN N;  1VSM A;  4FLW A;  4RG8 A;  1WSI A;  3KHY A;  2QWR A;  4O55 A;  3AVC A;  2UUA K;  3EKS A;  4YNQ A;  4DFM A;  1RBV A;  3O9Q A;  1B3C A;  2YIO A;  5LMU K;  2GWK A;  2ASO A;  1JLE A;  4FWN A;  3QFP A;  1C1B A;  3NF7 A;  3G25 A;  2YJF A;  3FZH A;  1WSF A;  3QIC A;  4O8K A;  2I7P A;  1HQU A;  1T7P A;  1E4G T;  3OHR A;  1RTD A;  1VSJ A;  4K0K K;  1IO2 A;  2Q0U A;  4W5Q A;  3QEI A;  3DXM B;  1VNA A;  3O1B A;  1TK8 A;  1SL2 A;  2ATB A;  4U67 L;  1K8K A;  3SV4 A;  4B1X B;  4BWM A;  1GLJ O;  4H0Y B;  3G0Z A;  3ITH A;  1TKX A;  2P1J A;  3B8A X;  4YFU A;  3VTI A;  1JKH A;  1KFD A;  1OH6 A;  2AA4 A;  3E9O A;  3SZ2 A;  2QWO A;  4E7H A;  1RFQ A;  1ASV A;  4CGJ A;  1AYJ A;  3E9P A;  3MAQ A;  1UGL A;  2BTF A;  2P9L B;  1XMQ K;  3AA3 A;  3C6T A;  5M1F A;  5EY4 A;  1OKJ A;  5C24 A;  3ZSX A;  4CFC A;  3TAF A;  5AQI A;  5C10 A;  3LDS A;  1MDU B;  1S9E A;  4PKI A;  2V52 B;  3L8B A;  4BRN A;  3M6G A;  4E89 A;  2UUB K;  3CCE N;  3KD1 E;  4RW8 A;  2YKN A;  5CHI A;  1VQK N;  3SQ0 A;  4WF9 L;  3ZET B;  4FJH A;  4KH4 A;  1F21 A;  3V4I A;  1DTQ A;  4PQU A;  4AHV A;  1RIL A;  1A5V A;  3DRR A;  5IT9 O;  4BE1 A;  2P9N A;  1K8A O;  2YNI A;  4KHU A;  1SN4 A;  3TAM A;  4J8F A;  4BRK A;  1NKE A;  2OA8 A;  3SUN A;  1UA0 A;  2LJM A;  3TU5 A;  3KHW A;  3J7A P;  5C2D A;  1O1W A;  1SL0 A;  1GLL O;  3MCA B;  4I9L A;  3NHG A;  3KKS A;  1NJY A;  3NF9 A;  3JAM O;  1XI1 A;  3O4W A;  1XUP O;  2VQE K;  3CCM N;  1CXU A;  1WSJ A;  1ZYW A;  3FLC O;  2YKM A;  4EHU A;  5KQD A;  1H1V A;  3KK1 A;  4K25 A;  4FLY A;  2E1Z A;  1BI4 A;  3AVI A;  1WMT A;  2QWP A;  3LDL A;  3FZF A;  5EVZ A;  1WOQ A;  4MDB A;  4AHS A;  1E3M A;  3MEC A;  3A8Y A;  1YI2 N;  5JMV A;  1VQM N;  3OBW A;  4BRQ A;  2F8T A;  4DKW A;  3UE5 A;  3CFO A;  1UWB A;  4CZI A;  3OYH A;  5JVH L;  3SPY A;  3B6P A;  4CZJ A;  3V9W A;  1N8R O;  3S5T A;  4C8O A;  3H1Q A;  1QQN A;  4O8U A;  2PYJ A;  4JI6 K;  4FLT A;  1IKV A;  3ZLJ A;  1S1X A;  4O4G A;  4WQ5 C;  1NGE A;  3FFI A;  3E7R L;  4RW7 A;  5LJV A;  4EZ9 A;  1KLN A;  2DY4 A;  5M1O A;  4JD2 A;  1QE1 A;  1T03 A;  2WBN A;  3ZYY X;  3SQ1 A;  3D2F A;  3FE1 A;  3TTC A;  1XC3 A;  5KK4 A;  5AQX A;  4JI2 K;  3L2U A;  2O8E B;  4DG1 A;  3CG7 A;  1LOT B;  1SUQ A;  4CGD A;  3HO1 A;  4H0X B;  3VQD A;  2HMP A;  1FJG K;  4FOE A;  2ZGY A;  1XQS C;  1BCO A;  4H5R A;  4ILJ A;  3VEX A;  1DKG D;  2ZJP L;  5CE3 A;  4B8A B;  1WBB A;  4FLX A;  1C0T A;  3SBT A;  5ELZ A;  2A1R A;  3J7Y P;  1RCH A;  3NGY A;  3E66 A;  4IFY A;  3WXK A;  3V6D A;  5BR8 K;  3HI0 A;  3SAH A;  1TVR A;  2WTU A;  4MQ3 A;  3LM2 A;  1HYZ A;  2X74 A;  2IOC A;  1NMN A;  1WN7 A;  3N4Q A;  3QB0 A;  1LW0 A;  3S3O A;  4DCH A;  5HBM A;  4DTM A;  1S1U A;  4FPA A;  1CHZ A;  1MR4 A;  1JLB A;  3DXM A;  1JXE A;  1VQ7 N;  4KAZ A;  2KGQ A;  3CCQ N;  3SBG A;  1C0G A;  2FBV A;  4NLB A;  3KWG A;  2O8F B;  4M41 A;  3CCS N;  1OH8 A;  3SLC A;  3AA2 A;  1X9S A;  5JIC A;  2ZF5 O;  4BDP A;  3J80 O;  1C55 A;  3SYZ A;  3THW B;  3CJ7 A;  4NXM K;  3MED A;  1NRA A;  4K42 A;  3EYZ A;  4B9U A;  1I6G A;  3OYL A;  4IG0 A;  1RBU A;  1BCM A;  3D2E B;  3AO3 A;  3SUQ A;  4UQG A;  2E2N A;  3CJC A;  3O5B A;  3VQE A;  5BR9 A;  3ZSR A;  5GAD P;  4AAZ A;  1KC8 O;  4ILH A;  1NWK A;  3VQP A;  2KZM A;  3V1Q A;  1T1T A;  4DTU A;  4E7L A;  2QW9 A;  2GL1 A;  4CZE A;  4A5A A;  2P9L A;  1XRS B;  3ID8 A;  2DFH A;  3TAE A;  3VF6 A;  3NFA A;  5E41 A;  1NK0 A;  2LY5 A;  4M3U A;  1T6D A;  1C6V A;  1U4B A;  1RT1 A;  3HBT A;  1NK9 A;  3SCX A;  3D45 A;  3CPW M;  1DTT A;  3VEZ A;  5AZJ A;  3HM9 A;  2YX6 A;  3WUH A;  3BY5 A;  1JLC A;  3QNO A;  3JYT A;  2YBR C;  1WAF A;  2HHV A;  3TSP A;  3K5O A;  4CHN A;  4M7X A;  4H0P A;  1JCG A;  3AAR A;  3ZET A;  3I33 A;  5AQZ A;  3ZT4 A;  2I5J A;  3OS1 A;  4M3W A;  3QET A;  2QI2 A;  3EL2 A;  2OTL N;  3M8S A;  4KB1 A;  4BR9 A;  3SI6 A;  4DQ8 A;  4LC9 B;  2G8I A;  1L4V A;  4YOT A;  5HOO A;  5AQJ A;  2E1Y A;  4BEC A;  1MU2 A;  3RMC A;  3THV A;  3KJV A;  2Q2R A;  2E2F A;  1WSE A;  1NM1 A;  3AVG A;  3DI6 A;  2E5L K;  2P9K B;  4BAC A;  3Q7C A;  1A5X A;  4L8R B;  2BRZ A;  1J53 A;  2V51 B;  3QO9 A;  3VOV A;  1CZB A;  1VAZ A;  4IKF A;  4CEZ A;  4ELU A;  1Q86 O;  4B1W B;  3WNE A;  4RW6 A;  4CIG A;  1OH5 A;  4JI8 K;  1C0U A;  4CJL A;  1J6Z A;  2E3G A;  1N34 K;  5CYM A;  4YDU C;  1P0A A;  1HKC A;  4N41 A;  4OLB A;  4F2S A;  3O9T A;  3S3N A;  3CM5 A;  4BR7 A;  4CBX A;  3U9Z A;  1BIU A;  3ZT1 A;  1LAV A;  1SAZ A;  1ZYQ A;  3T19 A;  4DV7 K;  2BUP A;  5GIN A;  1CN2 A;  1CZA N;  1HYV A;  2N69 A;  3M3Z A;  4NYN A;  5DK5 A;  4XH1 A;  4CJE A;  4J2D A;  4G9Z A;  2HVI A;  3AO2 A;  3OYM A;  4BRA A;  1CLQ A;  2XY7 A;  3U4L A;  1ZUT A;  3TAP A;  1ZYV A;  2WFB A;  4CD1 A;  3V9S A;  2P9S B;  1MWM A;  3S41 A;  1OMY A;  3OBY A;  1VQ5 N;  3CC7 N;  4EIA A;  3M1F A;  4CGH A;  3K57 A;  2CGL A;  1RDU A;  4CEQ A;  1KAZ A;  4Z4F A;  2O8E A;  4CJS A;  2NRW A;  3P4I A;  5KPR A;  4H0O A;  3ZX3 A;  4B1U B;  2HHX A;  2E0H A;  4FZX C;  2HHQ A;  3HP9 A;  3R6M A;  4B8C A;  1D4X A;  3LM9 A;  1I39 A;  1WNS A;  4L3Q A;  2NY8 X;  3CCR N;  2FXU A;  2GEL A;  3AVJ A;  5BN9 A;  1ZC6 A;  4XIU A;  4IOX A;  3OS2 A;  1RT7 A;  3JXU A;  4DR2 K;  1L3T A;  4OJR A;  4FOI A;  1KFS A;  1QQC A;  2HMI A;  3IUC A;  4CGF A;  2FBT A;  5AJ3 K;  4CIF A;  1WT7 A;  1P90 A;  4CFD A;  5GIP A;  3P39 A;  3WEE B;  4AEI A;  1L5U A;  5J2M A;  1I3A A;  2V7Z A;  3SQ4 A;  3EZW A;  2ASP A;  4IFV A;  2O8F A;  3WQU A;  4KO0 A;  2KHO A;  2MZ0 A;  3THW A;  2HF3 A;  3KOZ A;  1SQK A;  1XHX A;  1K6Y A; 
#chains in the Genus database with same CATH homology
 4UAE F;  2VYP A;  3KHY A;  4JKH A;  3KZB A;  3VEN A;  1VQ4 N;  3Q7B A;  3UB5 A;  4A2A A;  3EE8 A;  2QWR A;  4BRH A;  4CZK A;  3RSE A;  5KQ8 A;  3D2E A;  2K35 A;  1T3V A;  3VGM A;  3EKS A;  1GLB G;  4BG8 A;  3SAF A;  3O9Q A;  4IOC L;  2YIO A;  1TYQ B;  3QBX A;  2GWK A;  1BU6 O;  5F2R A;  2ASO A;  4JEP A;  4FWN A;  3VES A;  3QFP A;  1VQ8 N;  3BEX A;  3AY9 A;  3G25 A;  2YIP A;  1M90 O;  2YJF A;  3ID6 A;  3FZH A;  4YOU A;  3QIC A;  4O8K A;  2GMO A;  2I7P A;  5AQH A;  4BRP A;  4JHD A;  3ZEU B;  3KVG A;  5ADX A;  4WQ4 A;  1E4G T;  3OHR A;  3AAP A;  4IOA L;  2HST A;  2OAN A;  2A5X A;  4BC5 A;  2P9I B;  5BPM A;  5AR0 A;  2WC9 A;  2Q0U A;  5AQU A;  4BRL A;  3VET A;  5AQY A;  4NO7 A;  5C15 A;  3UKU A;  4PKH A;  1U2V B;  3DXM B;  1NGB A;  3O1B A;  3H1V X;  4BGA A;  3R1X A;  4AM7 A;  3PLA A;  4UAF E;  2NZT A;  3L4Q A;  3LL3 A;  4U67 L;  3L56 A;  1K8K A;  4WQ5 A;  4C23 A;  4FVU A;  4QS9 A;  3WXJ A;  3CJ9 A;  2NRT A;  5AQW A;  4B1X B;  3J8A A;  2E8A A;  4MDA A;  1GLJ O;  4H0Y B;  4NLC A;  3B8A X;  4JN4 A;  3R8E A;  3VTI A;  3UKR B;  4KBO A;  3LDQ A;  3FZL A;  2AA4 A;  3E9O A;  4UAD E;  5F1X A;  1T44 A;  2QWO A;  4GY2 B;  3QI7 A;  5BRF A;  2QA4 N;  1RFQ A;  5FPE A;  2P9U B;  3E9P A;  5JVG L;  1HKG A;  3WXL A;  4C1N K;  4K43 A;  4BR5 A;  4FL9 A;  5AQT A;  2YJE A;  4CZH A;  2BTF A;  1QQM A;  5AQN A;  5H1S Q;  4PL7 A;  2C1I A;  3BK3 C;  2P9L B;  3CQX A;  3CPE A;  5M1F A;  5EY4 A;  1OKJ A;  1ATR A;  3NMU A;  3CI5 A;  2P9K A;  5C2F A;  3KK7 A;  1SS6 A;  3WQT A;  3QBW A;  4JK7 A;  5AFU H;  3VTH A;  5BRH A;  1M1K O;  1X3N A;  5AQI A;  2GEM A;  5C10 A;  4O5F A;  4XH5 A;  3A5O C;  3CET A;  3CCU N;  4H5V A;  3MN7 A;  3CD6 N;  3IMX A;  1MDU B;  4PKI A;  1HKB A;  2V52 B;  2J4R A;  1E4F T;  4BRN A;  1SZ2 A;  3M6G A;  3VGL A;  3CCE N;  1ZBS A;  3CQY A;  3HOS A;  3L4I A;  3H3O B;  4GV9 A;  3QFU A;  5TKW A;  5CHI A;  2PBD A;  5EOY A;  1VQK N;  4WF9 L;  3ZET B;  2MBK A;  1Y64 A;  1QHA A;  2GX9 A;  1BWF O;  3AAQ A;  4KH4 A;  4JKB A;  4A5B A;  4GV3 A;  4ISE A;  5GIO A;  4PKG A;  2JDQ D;  2NRR A;  4B1V A;  4YOV A;  2Q36 A;  3GBT A;  1YXQ A;  1VQO N;  3DXK B;  3E9L A;  2P9N A;  3RVC A;  1K8A O;  5AZI B;  5ADX H;  3RSE B;  4J8F A;  4BRK A;  4CBU A;  4BVO A;  1MWK A;  3TU5 A;  3KHW A;  3MX5 A;  5C2D A;  2VY6 A;  2QWN A;  4JKG B;  3VEY A;  2P9S A;  1GLL O;  3MN5 A;  3MCA B;  4JKD A;  3CW4 A;  3A5N C;  3O4W A;  4RWT A;  3L0Q A;  3C7N A;  1XUP O;  4DB3 A;  5GAE P;  3CCM N;  3FZM A;  3GL1 A;  1NLV A;  1WUA A;  3FLC O;  4EHU A;  1NGI A;  1YUW A;  4BC3 A;  5AQS A;  2WUS A;  1YAG A;  5KQD A;  1H1V A;  4YOW A;  5HL7 L;  4K25 A;  5C12 A;  2E1Z A;  4IDH A;  4BRF A;  4FWQ A;  4BRC A;  1HPM A;  2QWP A;  3LDL A;  3FZF A;  5EVZ A;  4JK9 A;  4BQZ A;  1WOQ A;  4MDB A;  3LDN A;  1EQY A;  2IVO A;  3A8Y A;  3ULE B;  1YI2 N;  5JMV A;  4FWR A;  3OBW A;  4WQ4 C;  4BRQ A;  1VQM N;  2E88 A;  4QS8 A;  4DKW A;  3UE5 A;  5BRD A;  1DGK N;  2HBM A;  3A5M C;  4CZI A;  4XH4 A;  1Q7Y O;  1V4S A;  5JVH L;  4IJA A;  3MX2 A;  4CZJ A;  2HBJ A;  1N8R O;  3H46 O;  2VWB A;  2LN8 A;  3H1Q A;  1VQ6 N;  4H5N A;  5AQP A;  3GOI A;  1QQN A;  3SAG A;  2D0O A;  3KWI A;  4A62 A;  1YHQ N;  1ILY A;  2HOE A;  4O8U A;  2A3Z A;  3NVK A;  4GV6 A;  4OPA A;  2A6A A;  1LCU A;  1ZXO A;  3DWL A;  4WQ5 C;  1NGE A;  2ZWH A;  3FR0 A;  5LJV A;  4IWV A;  3E1Y A;  4A61 A;  4DHY A;  5M1O A;  4FWK A;  4JD2 A;  3H6E A;  1V4T A;  2FSN A;  2WBN A;  5FPN A;  2FSK A;  1ATS A;  4H5W A;  2QM1 A;  4AF1 A;  3ZYY X;  3AGR A;  3WEE A;  4AM6 A;  3MN6 A;  4M7Y A;  4CI6 A;  3D2F A;  3FE1 A;  3L6Q A;  3TTC A;  5B8H A;  1XC3 A;  4BR2 A;  4IO8 A;  3MCP A;  2A42 A;  5AQX A;  1Q81 O;  4WCE L;  2Q97 A;  2NLX A;  4JKC A;  1LOT B;  3ENH A;  1NGD A;  2EWS A;  1BDG A;  1KD1 O;  4IEI A;  5M1P A;  4CD3 A;  2JWL A;  2QWL A;  3CJ1 A;  3GE1 A;  4H0X B;  3MMV A;  1R59 O;  2F7T A;  2HMP A;  5KPT A;  4FOE A;  2ZGY A;  1XQS C;  3G71 N;  4H5R A;  4BC2 A;  4ILJ A;  3VEX A;  1NMD A;  5AQK A;  2D0P A;  4JAX A;  4KH6 A;  1DKG D;  2ZJP L;  5CE3 A;  1GLA G;  5F0X A;  3F9M A;  3SBT A;  2P9P B;  5ELZ A;  1NGF A;  1KQS M;  3O1W A;  2W00 A;  2OTJ N;  1TYQ A;  1QZ5 A;  3E66 A;  2QWM A;  3EO3 A;  3EN9 A;  3WXK A;  4I6M B;  5BPL A;  3F5T A;  3HI0 A;  3P38 A;  3SAH A;  3MWP A;  3BF3 A;  4HTL A;  3TSQ A;  2KKZ A;  2IVP A;  3LM2 A;  1HJO A;  3TTD A;  3G6E N;  4YDU A;  2HF4 A;  1HX1 A;  2P9N B;  3ZEU A;  4B1Y B;  3BUZ B;  2ZJR L;  3SK3 A;  2YI1 A;  4H0V B;  4BRM A;  3SF4 D;  3N4Q A;  3QB0 A;  5LY3 A;  3GDQ A;  2CGJ A;  4DCH A;  2P9I A;  3O6W A;  3R3L A;  1YJW N;  5AQM A;  1TUU A;  5M1K A;  3CCV N;  1U6Z A;  4FPA A;  2QWQ A;  4UY8 O;  1U2V A;  3O9R A;  2A41 A;  4U7B A;  3DXM A;  3O80 A;  4JKF A;  1VQ7 N;  3CCQ N;  2E2P A;  3HSC A;  3SBG A;  1C0G A;  4M63 C;  1O13 A;  2YHX A;  4NLB A;  3KWG A;  3WXI A;  3LDO A;  2W41 A;  2RE2 A;  3QDK A;  3MWT A;  4BEB A;  5AQG A;  2VGM A;  3CCS N;  2QTD A;  3SLC A;  3CIP A;  4BC4 A;  5JIC A;  2ZF5 O;  4WFB L;  2D56 A;  3U9D A;  2PAV A;  3CJ7 A;  5E84 A;  4JHD B;  3UKR A;  2GTD A;  2DPN A;  3OW2 M;  4K42 A;  1IG8 A;  3VEW A;  2FF3 B;  1YJ9 N;  5AQF A;  1IJJ A;  3C6A A;  3CCL N;  1BUP A;  3AGK A;  2YHW A;  3EE9 A;  3D2E B;  2CGK A;  3T69 A;  2E2N A;  2A40 A;  3CJC A;  3O5B A;  1KAY A;  5BR9 A;  2P9U A;  1EO1 A;  5EXW A;  3HM8 A;  4BGB A;  5GAD P;  3CCJ N;  1GLD G;  1TUY A;  4A57 A;  1KC8 O;  4ILH A;  4JNE A;  1NWK A;  1NGC A;  1QQO A;  3JS6 A;  2JWK A;  3R2V A;  3FGU A;  3MDQ A;  1BO5 O;  2QW9 A;  4RCH A;  4CZE A;  3HTV A;  4A5A A;  4K41 A;  1W2B M;  2P9L A;  4IZ9 A;  1GLF O;  2V7Y A;  3ID8 A;  5JLH A;  4PL8 A;  5AQR A;  4Y0W A;  3VF6 A;  1JJ2 M;  4FWS A;  3BP8 A;  3O9S A;  3KC6 A;  1T6D A;  1YJN N;  5BN8 A;  5CR4 A;  5LJW A;  3HBT A;  4FWL A;  3HOT A;  4A59 A;  3CPW M;  2BH1 A;  3VEZ A;  2VGN A;  5GAG P;  5AZJ A;  4BG9 A;  3CF5 L;  4JD2 B;  2YX6 A;  3WUH A;  1KAX A;  1OVY A;  3UKU B;  3FFK B;  1T6C A;  1W97 L;  4BRD A;  3J7Z O;  4B9Q A;  5FPD A;  2ASM A;  2CH6 A;  2F9T A;  1NGH A;  4R79 A;  4PHT X;  3D2F B;  3M5R A;  3DLL L;  3QML A;  1K8K B;  3CJB A;  3TSP A;  1VQL N;  4M7X A;  4H0P A;  3CER A;  3CXC M;  2C1G A;  1JCG A;  3AAR A;  3ZET A;  3I33 A;  5AQZ A;  3HZ6 A;  5BPN A;  1X9J A;  4BRO A;  3CJA A;  5EX5 A;  2E20 A;  5DM6 L;  1POI A;  1G99 A;  1X3M A;  1ESV A;  2F9W A;  2YIL A;  1KXP A;  2QI2 A;  3EL2 A;  3IKM A;  1ATN A;  2OTL N;  4CZM A;  1VQP N;  3DXK A;  4BR9 A;  2FSJ A;  2ZGZ A;  3P31 A;  1YF5 L;  5AZI A;  4LC9 B;  4YOR A;  3R9P A;  3VPZ A;  4BR4 A;  4DQ8 A;  4OO1 J;  4H5T A;  3CHW A;  3VF2 A;  3ZX0 A;  4YOT A;  3C6H A;  2YHY A;  3CC2 N;  2IVN A;  5HOO A;  5AQJ A;  3FZK A;  4YOX A;  2NRH A;  2E1Y A;  4JKG A;  5JLF A;  4A2B A;  4BEC A;  2ITM A;  1MA9 B;  1YIT N;  5AQV A;  4MLH A;  2Q2R A;  4KH5 A;  2E2F A;  3O08 A;  3T7Z A;  5GAH P;  1JCF A;  2QEX N;  5AQL A;  4BQL A;  1NM1 A;  4H03 B;  2P9K B;  4CZL A;  3O9U A;  1Q82 O;  2I7N A;  3ENO A;  3Q7C A;  3WT0 A;  5FPM A;  2E2Q A;  3C0B A;  1DEJ A;  2V51 B;  3VER A;  3VOV A;  5E26 A;  5BRE A;  2FF6 A;  4Z94 A;  2D1K A;  1Q86 O;  3D6R A;  4B1W B;  2NRX A;  4F9O A;  1J6Z A;  3MK6 A;  4H0T B;  2GWJ A;  4YDU C;  4C1N I;  2MN5 A;  5AQQ A;  2Q1N A;  1BA0 A;  5AQO A;  4CBW A;  5M1N A;  1HKC A;  3ULE A;  2NNW A;  4FWO A;  4CZF A;  3O9T A;  3I56 N;  4BE7 B;  3EKU A;  2FLO A;  4BR7 A;  2Q0R A;  3ATV A;  4CBX A;  4GVE A;  3U9Z A;  3WXM B;  1SAZ A;  1Q18 A;  4BR0 A;  3VMF B;  3H45 C;  2BUP A;  2KLA A;  4MO5 A;  5GIN A;  1CZA N;  4E1J A;  3CC4 N;  3LDP A;  3M3Z A;  4YOY A;  4XH1 A;  4G9Z A;  4WYB A;  4CZG A;  1P8Z A;  4IEE A;  2PFU A;  4ISG A;  4BRA A;  4RTF D;  1YIJ N;  4FPB A;  5KPZ A;  4IXC A;  3D7E O;  5TKY A;  3U4L A;  4HWI A;  3I55 N;  3OA9 A;  2NRZ A;  3CME N;  4OPH A;  3TSU A;  2WFB A;  4FWM A;  4CD1 A;  2P9S B;  3C65 A;  1GLE G;  5C0Y A;  3A0I X;  3A5L C;  3IDH A;  1MWM A;  3VEV A;  3W3D A;  3S41 A;  3ZX2 A;  4MLE A;  5M1Q A;  3OBY A;  3G4S N;  3C7N B;  1YVN A;  1VQ5 N;  3CC7 N;  4EIA A;  3M1F A;  4FSV A;  3DAW A;  2CGL A;  3U8X A;  3VEO A;  3HRG A;  1RDU A;  2ZJQ L;  1KAZ A;  1HUX A;  1S22 A;  3MN9 A;  4XEI A;  1NGJ A;  2NRW A;  3P4I A;  5KPR A;  1BG3 A;  4H0O A;  3ZX3 A;  4B1U B;  3H3N O;  1K73 O;  1JCE A;  1Z6R A;  1RDW X;  3N4P A;  4ISF A;  5AZJ B;  5MLC Q;  5DM7 L;  4JKE A;  4XJX A;  4IO9 L;  2UYT A;  3ENB A;  3K9J A;  3R6M A;  4FO0 A;  1RGI A;  3TTF A;  2YCH A;  1QVG M;  3GG4 A;  4BRE A;  1D4X A;  1K9M O;  3LM9 A;  3VGK A;  2D4W A;  2P9P A;  4B1Z A;  4ILG B;  2GUP A;  4EAH D;  5I9E B;  4L3Q A;  2HBL A;  2NRV A;  1HLU A;  3CCR N;  1QZ6 A;  2FXU A;  2GEL A;  2VCP A;  5BN9 A;  4I6M A;  4EHT A;  3SJH A;  3TPQ A;  1ZC6 A;  2HBK A;  3IFR A;  4IOX A;  1C0F A;  4BVP A;  1NGA A;  3JXU A;  2RHK A;  2IIR A;  3F2K A;  3SMP A;  4MO4 A;  4CJ7 A;  4WFA L;  4WFN L;  1Z05 A;  3NVM A;  3PIP L;  2Q31 A;  1BOT O;  4FOI A;  1NBW A;  3ATU A;  3IUC A;  1QVF M;  4IFE A;  4EFH A;  1P90 A;  1GLC G;  5GIP A;  3P39 A;  3WEE B;  2CH5 A;  3VF4 A;  4BY9 C;  4BRG A;  3PIO L;  3I8B A;  4QS7 A;  4FWP A;  3O8M A;  4JK8 A;  1BA1 A;  2V7Z A;  1DT9 A;  3EZW A;  4BRI A;  3W0L A;  2AP1 A;  5AFU A;  3K9K A;  2ASP A;  4JKA A;  2QXL A;  4IJN A;  4GNI A;  2W40 A;  1S72 N;  3DJC A;  2E2O A;  3WQU A;  1NJI O;  1NGG A;  3CMA N;  2KHO A;  3BF1 A;  4NB4 A;  2H3G X;  1S3X A;  3SMS A;  1VQN N;  2HF3 A;  1SQK A;  1VAZ A;  1VQ9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...