1SEGA

Crystal structure of a toxin chimera between lqh-alpha-it from the scorpion leiurus quinquestriatus hebraeus and aah2 from androctonus australis hector
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
VKDGYIVKNYNCTYFCFRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAH2: LQH-ALPHA-IT (FACE) CHIMERIC TOXIN
publication title Molecular basis of the high insecticidal potency of scorpion alpha-toxins.
pubmed doi rcsb
source organism Androctonus australis hector
molecule tags Toxin
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1segA00
1WT7A 1C56A 1GPSA 1MYNA 1LQQA 1P0AA 2GL1A 1JZBA 2N2QA 2LJMA 1FH3A 2N66A 2YC1C 1L4VA 1ZVGA 2LI7A 2MZ0A 1NPIA 3E7RL 2B3CA 1I6FA 1SN4A 1JXCA 1OMYA 1ZVEA 2KBJA 2LY6A 3E7UX 1GPTA 1DQ7A 1T7BA 1AYJA 2KGQA 2KPYA 1I2VA 1BRZA 2KJAA 1CN2A 2M8BB 4KYPA 1OZZA 2E3FA 1AHOA 2YEOA 1SN1A 2NY8X 1ZUTA 1ZYVA 2SN3A 4AB0A 1JZAA 2ASCA 1I2UA 1T7EA 1CHZA 2E0HA 4HE7A 1KV0A 2LJ7A 2A7TA 1DJTA 2B68A 2YBRC 2ATBA 1VNBA 4HHFA 1C55A 2NY9X 2LKBA 2BRZA 1NRBA 1N4NA 5KK4A 2N2RA 1BMRA 1BCGA 2KYQA 4AAZA 4UJ0A 1TI5A 2KSKA 1P00A 1NH5A 1MR4A 1ZFUA 2I61A 1LQIA 1JKZA 1WMTA 1PE4A 1LQHA 5CY0A 2LY5A 4CQKA 1NE5A 1B3CA 1PX9A 4AEIA 1SNBA 1NRAA 1T1TA 1ZYWA 1B7DA 1PTXA 2LR3A 2N69A 1SEGA 2LT8A 1T0ZA 3PSMA 1WWNA 2KBKA 1ICAA 1T7AA 1BK8A 1ZU3A 1VNAA 1I6GA 2E3GA 2KBHA 4V1DC
chains in the Genus database with same CATH superfamily
5AQJA 1NGDA 1HX1A 2JDQD 1WT7A 1C56A 1NGHA 1NGGA 1QQOA 1S3XA 1QQMA 2K35A 3KC6A 5AQVA 1MYNA 5AQUA 3L6QA 5AQKA 1GPSA 1LQQA 1P0AA 5AQIA 5FPMA 5AQLA 2GL1A 5F0XA 1BA0A 1JZBA 2N2QA 2LJMA 1FH3A 5AQNA 2N66A 2YC1C 5F2RA 5BPNA 1L4VA 1ZVGA 3I33A 2LI7A 2MN5A 3C7NB 2G2KA 2MZ0A 1NPIA 3QFUA 2QW9A 3E7RL 3D2FA 3D2FB 2B3CA 3A8YA 1I6FA 1NGCA 3D2EA 1SN4A 3D2EB 1HPMA 1JXCA 3QFPA 4H5TA 5BPMA 5AQSA 1OMYA 1ZVEA 2KBJA 2LY6A 3E7UX 5AQPA 3IUCA 1GPTA 1DQ7A 3CQXA 1T7BA 3CW4A 1AYJA 2KGQA 1NGBA 1NGAA 3LDNA 1NGJA 1XRSB 3KOYA 4H5VA 3GDQA 2KPYA 1I2VA 1BRZA 2KJAA 2QXLA 3R2VA 4KBOA 1CN2A 1DKGD 2M8BB 4KYPA 3QI7A 1OZZA 5FPNA 2E3FA 3KP0A 1AHOA 2YEOA 3ATUA 3FZLA 3HSCA 1HJOA 1SN1A 2QWMA 2NY8X 1ZUTA 1ZYVA 2QWPA 4GNIA 5FPEA 3C7NA 1POIA 3ATVA 4H5RA 3L56A 2SN3A 5FPDA 4AB0A 3LDLA 1JZAA 2ASCA 3QMLA 1I2UA 1T7EA 1CHZA 1UGLA 2E0HA 4HE7A 1KV0A 5AQXA 2LJ7A 2A7TA 1DJTA 2YILA 5BN8A 2B68A 2YBRC 2LN8A 2ATBA 3KVGA 1NGEA 3KOWA 1VNBA 4FSVA 4HHFA 1C55A 2D56A 2NY9X 2LKBA 5AQZA 1K8BA 2BRZA 3KOXA 1BUPA 1NRBA 1N4NA 3LDQA 4UAEF 3LDOA 1QQNA 5EVZA 5KK4A 2N2RA 1BMRA 1BCGA 2KYQA 3SF4D 5AQTA 4AAZA 4UJ0A 3JXUA 5AQHA 1TI5A 2KSKA 3FZFA 3GL1A 4H5WA 1P00A 3L4IA 1NH5A 2QWOA 2E8AA 1MR4A 1ZFUA 3LDPA 1NGFA 1KAYA 2I61A 1LQIA 3KP1A 4H5NA 4HWIA 1JKZA 1KAXA 4UAFE 2MBKA 1NGIA 5AQOA 1YUWA 1WMTA 4IO8A 1PE4A 2KHOA 2V7ZA 1LQHA 1BA1A 3FZHA 5AQFA 5AQWA 5AQRA 5BN9A 5CY0A 5AQQA 3BK3C 2LY5A 5EY4A 1NE5A 4CQKA 5F1XA 1B3CA 2E2FA 2QWLA 1PX9A 5EX5A 2YIOA 5BPLA 3KOZA 1ATSA 3M3ZA 1SNBA 3FE1A 1NRAA 1T1TA 1ZYWA 1B7DA 1PTXA 4AEIA 2LR3A 2N69A 3AY9A 1SEGA 5AQGA 2QWNA 2E88A 5EXWA 4FL9A 2LT8A 2GMOA 1T0ZA 2QWRA 3PSMA 5AR0A 1WWNA 2KBKA 3FZKA 5AQMA 1T7AA 1ICAA 3GKUA 1BK8A 3FZMA 2QWQA 1ZU3A 2BUPA 4UADE 1VNAA 2YIPA 2E3GA 3KHWA 1I6GA 1KAZA 2KBHA 5AQYA 1ATRA 4V1DC 2VY6A
chains in the Genus database with same CATH topology
1WT7A 1C56A 1GPSA 1MYNA 1LQQA 1P0AA 2GL1A 1JZBA 2N2QA 2LJMA 1FH3A 2N66A 2YC1C 1L4VA 1ZVGA 2LI7A 2MZ0A 1NPIA 3E7RL 2B3CA 1I6FA 1SN4A 1JXCA 1OMYA 1ZVEA 2KBJA 2LY6A 3E7UX 1GPTA 1DQ7A 1T7BA 1AYJA 2KGQA 2KPYA 1I2VA 1BRZA 2KJAA 1CN2A 2M8BB 4KYPA 1OZZA 2E3FA 1AHOA 2YEOA 1SN1A 2NY8X 1ZUTA 1ZYVA 2SN3A 4AB0A 1JZAA 2ASCA 1I2UA 1T7EA 1CHZA 2E0HA 4HE7A 1KV0A 2LJ7A 2A7TA 1DJTA 2B68A 2YBRC 2ATBA 1VNBA 4HHFA 1C55A 2NY9X 2LKBA 2BRZA 1NRBA 1N4NA 5KK4A 2N2RA 1BMRA 1BCGA 2KYQA 4AAZA 4UJ0A 1TI5A 2KSKA 1P00A 1NH5A 1MR4A 1ZFUA 2I61A 1LQIA 1JKZA 1WMTA 1PE4A 1LQHA 5CY0A 2LY5A 4CQKA 1NE5A 1B3CA 1PX9A 4AEIA 1SNBA 1NRAA 1T1TA 1ZYWA 1B7DA 1PTXA 2LR3A 2N69A 1SEGA 2LT8A 1T0ZA 3PSMA 1WWNA 2KBKA 1ICAA 1T7AA 1BK8A 1ZU3A 1VNAA 1I6GA 2E3GA 2KBHA 4V1DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT7 A;  1C56 A;  1GPS A;  1MYN A;  1LQQ A;  1P0A A;  2GL1 A;  1JZB A;  2N2Q A;  2LJM A;  1FH3 A;  2N66 A;  2YC1 C;  1L4V A;  1ZVG A;  2LI7 A;  2MZ0 A;  1NPI A;  3E7R L;  2B3C A;  1I6F A;  1SN4 A;  1JXC A;  1OMY A;  1ZVE A;  2KBJ A;  2LY6 A;  3E7U X;  1GPT A;  1DQ7 A;  1T7B A;  1AYJ A;  2KGQ A;  2KPY A;  1I2V A;  1BRZ A;  2KJA A;  1CN2 A;  2M8B B;  4KYP A;  1OZZ A;  2E3F A;  1AHO A;  2YEO A;  1SN1 A;  2NY8 X;  1ZUT A;  1ZYV A;  2SN3 A;  4AB0 A;  1JZA A;  2ASC A;  1I2U A;  1T7E A;  1CHZ A;  2E0H A;  4HE7 A;  1KV0 A;  2LJ7 A;  2A7T A;  1DJT A;  2B68 A;  2YBR C;  2ATB A;  1VNB A;  4HHF A;  1C55 A;  2NY9 X;  2LKB A;  2BRZ A;  1NRB A;  1N4N A;  5KK4 A;  2N2R A;  1BMR A;  1BCG A;  2KYQ A;  4AAZ A;  4UJ0 A;  1TI5 A;  2KSK A;  1P00 A;  1NH5 A;  1MR4 A;  1ZFU A;  2I61 A;  1LQI A;  1JKZ A;  1WMT A;  1PE4 A;  1LQH A;  5CY0 A;  2LY5 A;  4CQK A;  1NE5 A;  1B3C A;  1PX9 A;  4AEI A;  1SNB A;  1NRA A;  1T1T A;  1ZYW A;  1B7D A;  1PTX A;  2LR3 A;  2N69 A;  1SEG A;  2LT8 A;  1T0Z A;  3PSM A;  1WWN A;  2KBK A;  1ICA A;  1T7A A;  1BK8 A;  1ZU3 A;  1VNA A;  1I6G A;  2E3G A;  2KBH A;  4V1D C; 
#chains in the Genus database with same CATH topology
 5AQJ A;  1NGD A;  1HX1 A;  2JDQ D;  1WT7 A;  1C56 A;  1NGH A;  1NGG A;  1QQO A;  1S3X A;  1QQM A;  2K35 A;  3KC6 A;  5AQV A;  1MYN A;  5AQU A;  3L6Q A;  5AQK A;  1GPS A;  1LQQ A;  1P0A A;  5AQI A;  5FPM A;  5AQL A;  2GL1 A;  5F0X A;  1BA0 A;  1JZB A;  2N2Q A;  2LJM A;  1FH3 A;  5AQN A;  2N66 A;  2YC1 C;  5F2R A;  5BPN A;  1L4V A;  1ZVG A;  3I33 A;  2LI7 A;  2MN5 A;  3C7N B;  2G2K A;  2MZ0 A;  1NPI A;  3QFU A;  2QW9 A;  3E7R L;  3D2F A;  3D2F B;  2B3C A;  3A8Y A;  1I6F A;  1NGC A;  3D2E A;  1SN4 A;  3D2E B;  1HPM A;  1JXC A;  3QFP A;  4H5T A;  5BPM A;  5AQS A;  1OMY A;  1ZVE A;  2KBJ A;  2LY6 A;  3E7U X;  5AQP A;  3IUC A;  1GPT A;  1DQ7 A;  3CQX A;  1T7B A;  3CW4 A;  1AYJ A;  2KGQ A;  1NGB A;  1NGA A;  3LDN A;  1NGJ A;  1XRS B;  3KOY A;  4H5V A;  3GDQ A;  2KPY A;  1I2V A;  1BRZ A;  2KJA A;  2QXL A;  3R2V A;  4KBO A;  1CN2 A;  1DKG D;  2M8B B;  4KYP A;  3QI7 A;  1OZZ A;  5FPN A;  2E3F A;  3KP0 A;  1AHO A;  2YEO A;  3ATU A;  3FZL A;  3HSC A;  1HJO A;  1SN1 A;  2QWM A;  2NY8 X;  1ZUT A;  1ZYV A;  2QWP A;  4GNI A;  5FPE A;  3C7N A;  1POI A;  3ATV A;  4H5R A;  3L56 A;  2SN3 A;  5FPD A;  4AB0 A;  3LDL A;  1JZA A;  2ASC A;  3QML A;  1I2U A;  1T7E A;  1CHZ A;  1UGL A;  2E0H A;  4HE7 A;  1KV0 A;  5AQX A;  2LJ7 A;  2A7T A;  1DJT A;  2YIL A;  5BN8 A;  2B68 A;  2YBR C;  2LN8 A;  2ATB A;  3KVG A;  1NGE A;  3KOW A;  1VNB A;  4FSV A;  4HHF A;  1C55 A;  2D56 A;  2NY9 X;  2LKB A;  5AQZ A;  1K8B A;  2BRZ A;  3KOX A;  1BUP A;  1NRB A;  1N4N A;  3LDQ A;  4UAE F;  3LDO A;  1QQN A;  5EVZ A;  5KK4 A;  2N2R A;  1BMR A;  1BCG A;  2KYQ A;  3SF4 D;  5AQT A;  4AAZ A;  4UJ0 A;  3JXU A;  5AQH A;  1TI5 A;  2KSK A;  3FZF A;  3GL1 A;  4H5W A;  1P00 A;  3L4I A;  1NH5 A;  2QWO A;  2E8A A;  1MR4 A;  1ZFU A;  3LDP A;  1NGF A;  1KAY A;  2I61 A;  1LQI A;  3KP1 A;  4H5N A;  4HWI A;  1JKZ A;  1KAX A;  4UAF E;  2MBK A;  1NGI A;  5AQO A;  1YUW A;  1WMT A;  4IO8 A;  1PE4 A;  2KHO A;  2V7Z A;  1LQH A;  1BA1 A;  3FZH A;  5AQF A;  5AQW A;  5AQR A;  5BN9 A;  5CY0 A;  5AQQ A;  3BK3 C;  2LY5 A;  5EY4 A;  1NE5 A;  4CQK A;  5F1X A;  1B3C A;  2E2F A;  2QWL A;  1PX9 A;  5EX5 A;  2YIO A;  5BPL A;  3KOZ A;  1ATS A;  3M3Z A;  1SNB A;  3FE1 A;  1NRA A;  1T1T A;  1ZYW A;  1B7D A;  1PTX A;  4AEI A;  2LR3 A;  2N69 A;  3AY9 A;  1SEG A;  5AQG A;  2QWN A;  2E88 A;  5EXW A;  4FL9 A;  2LT8 A;  2GMO A;  1T0Z A;  2QWR A;  3PSM A;  5AR0 A;  1WWN A;  2KBK A;  3FZK A;  5AQM A;  1T7A A;  1ICA A;  3GKU A;  1BK8 A;  3FZM A;  2QWQ A;  1ZU3 A;  2BUP A;  4UAD E;  1VNA A;  2YIP A;  2E3G A;  3KHW A;  1I6G A;  1KAZ A;  2KBH A;  5AQY A;  1ATR A;  4V1D C;  2VY6 A; 
#chains in the Genus database with same CATH homology
 1WT7 A;  1C56 A;  1GPS A;  1MYN A;  1LQQ A;  1P0A A;  2GL1 A;  1JZB A;  2N2Q A;  2LJM A;  1FH3 A;  2N66 A;  2YC1 C;  1L4V A;  1ZVG A;  2LI7 A;  2MZ0 A;  1NPI A;  3E7R L;  2B3C A;  1I6F A;  1SN4 A;  1JXC A;  1OMY A;  1ZVE A;  2KBJ A;  2LY6 A;  3E7U X;  1GPT A;  1DQ7 A;  1T7B A;  1AYJ A;  2KGQ A;  2KPY A;  1I2V A;  1BRZ A;  2KJA A;  1CN2 A;  2M8B B;  4KYP A;  1OZZ A;  2E3F A;  1AHO A;  2YEO A;  1SN1 A;  2NY8 X;  1ZUT A;  1ZYV A;  2SN3 A;  4AB0 A;  1JZA A;  2ASC A;  1I2U A;  1T7E A;  1CHZ A;  2E0H A;  4HE7 A;  1KV0 A;  2LJ7 A;  2A7T A;  1DJT A;  2B68 A;  2YBR C;  2ATB A;  1VNB A;  4HHF A;  1C55 A;  2NY9 X;  2LKB A;  2BRZ A;  1NRB A;  1N4N A;  5KK4 A;  2N2R A;  1BMR A;  1BCG A;  2KYQ A;  4AAZ A;  4UJ0 A;  1TI5 A;  2KSK A;  1P00 A;  1NH5 A;  1MR4 A;  1ZFU A;  2I61 A;  1LQI A;  1JKZ A;  1WMT A;  1PE4 A;  1LQH A;  5CY0 A;  2LY5 A;  4CQK A;  1NE5 A;  1B3C A;  1PX9 A;  4AEI A;  1SNB A;  1NRA A;  1T1T A;  1ZYW A;  1B7D A;  1PTX A;  2LR3 A;  2N69 A;  1SEG A;  2LT8 A;  1T0Z A;  3PSM A;  1WWN A;  2KBK A;  1ICA A;  1T7A A;  1BK8 A;  1ZU3 A;  1VNA A;  1I6G A;  2E3G A;  2KBH A;  4V1D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...