2A7TA

Crystal structure of a novel neurotoxin from buthus tamalus at 2.2a resolution.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin
publication title Crystal structure of a highly acidic neurotoxin from scorpion Buthus tamulus at 2.2A resolution reveals novel structural features.
pubmed doi rcsb
molecule tags Toxin
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2a7tA00
2NY8X 1NE5A 2KBKA 1T7EA 2GL1A 1AHOA 1ICAA 5CY0A 2LJ7A 1DJTA 1BCGA 2BRZA 5KK4A 1NH5A 1P0AA 1NPIA 4V1DC 1SEGA 2KBHA 1T0ZA 4AAZA 2B3CA 1MR4A 2E0HA 1T7AA 4CQKA 2I61A 2LKBA 1JZAA 1JKZA 1B3CA 1GPTA 1L4VA 1PX9A 2N66A 2MZ0A 1TI5A 2N2RA 2YBRC 2LY5A 3E7RL 1T1TA 1I6FA 1LQIA 2KGQA 1PE4A 1LQHA 1DQ7A 1I6GA 1BMRA 1C55A 2N2QA 1BK8A 1ZVEA 1SN1A 2ATBA 1NRAA 1I2UA 1WT7A 1N4NA 1AYJA 1ZUTA 4UJ0A 1OMYA 2E3GA 2ASCA 2SN3A 1WMTA 1CN2A 2M8BB 1GPSA 4HHFA 2NY9X 1BRZA 1NRBA 1FH3A 1P00A 2A7TA 2LI7A 1T7BA 1ZYVA 4HE7A 1KV0A 2LY6A 1ZFUA 2KJAA 1SNBA 1WWNA 1LQQA 2KPYA 2KSKA 2YEOA 1B7DA 4KYPA 1JXCA 2B68A 2KBJA 1VNBA 2YC1C 1C56A 1OZZA 1VNAA 1MYNA 1ZU3A 2KYQA 2LT8A 2E3FA 2LJMA 3E7UX 4AB0A 2N69A 1JZBA 4AEIA 1CHZA 2LR3A 1ZVGA 1PTXA 1SN4A 1ZYWA 3PSMA 1I2VA
chains in the Genus database with same CATH superfamily
1QQMA 3KOYA 2NY8X 5AQKA 4KBOA 2BUPA 1NGDA 1NE5A 2KBKA 1T7EA 2GL1A 1AHOA 1QQNA 3KVGA 3QFUA 3R2VA 5EX5A 5CY0A 5AQNA 2LJ7A 1ICAA 1NGGA 1DJTA 1BCGA 2BRZA 2K35A 3L6QA 1NH5A 5BPMA 2MBKA 1P0AA 5FPDA 1NPIA 4V1DC 1SEGA 2KBHA 1T0ZA 3ATUA 4AAZA 2B3CA 1MR4A 2E0HA 1ATRA 5BN8A 1NGCA 3CW4A 1QQOA 1T7AA 2GMOA 4FL9A 3SF4D 2QXLA 2I61A 2LKBA 1JZAA 1HJOA 2QWNA 3FZMA 3M3ZA 2YILA 4CQKA 1B3CA 1JKZA 1GPTA 1NGHA 5F2RA 3KHWA 1HPMA 4GNIA 3FZFA 5AQJA 5AQYA 5FPMA 1KAYA 1L4VA 2JDQD 1PX9A 3L56A 3QMLA 2N66A 3KOWA 2MZ0A 3IUCA 1TI5A 1NGBA 2N2RA 5AQWA 2YBRC 2LY5A 3E7RL 5F0XA 1T1TA 1I6FA 3A8YA 1LQIA 2KGQA 1K8BA 1PE4A 5AQVA 3KOZA 5AQPA 2YIPA 3AY9A 3LDLA 1LQHA 3GDQA 4UADE 3FZLA 1BUPA 1DQ7A 1I6GA 1BMRA 3KP0A 5BN9A 1C55A 2N2QA 5AQMA 5AR0A 5BPNA 1BK8A 3D2FA 3LDQA 1ZVEA 1SN1A 2YIOA 5AQSA 2ATBA 1NRAA 1I2UA 1WT7A 2QWOA 1N4NA 5AQLA 3BK3C 4IO8A 1AYJA 1ZUTA 4H5RA 4H5VA 4UJ0A 4UAFE 1OMYA 1UGLA 2E3GA 3LDPA 1POIA 4HWIA 2ASCA 1KAZA 2SN3A 3LDNA 1WMTA 5EVZA 2LN8A 4H5TA 5AQQA 1CN2A 2M8BB 1GPSA 3C7NA 3GKUA 5F1XA 5EXWA 3QI7A 3KC6A 1NGAA 3D2EA 2NY9X 4FSVA 4HHFA 2V7ZA 5FPEA 1BRZA 1NRBA 1FH3A 2VY6A 1P00A 2E8AA 5AQFA 2D56A 1BA1A 2A7TA 2LI7A 5EY4A 1T7BA 1ATSA 3D2FB 1ZYVA 1YUWA 2QWMA 5AQRA 3KP1A 4HE7A 1KV0A 3KOXA 2LY6A 1ZFUA 2MN5A 2KJAA 1SNBA 2E2FA 1WWNA 3L4IA 2QWLA 3I33A 5AQZA 5AQOA 1NGIA 4UAEF 5AQGA 3QFPA 1LQQA 2KPYA 2KSKA 2YEOA 1B7DA 2QWRA 1KAXA 2QWPA 4KYPA 5AQHA 5AQUA 5FPNA 5KK4A 1I2VA 1DKGD 3CQXA 1JXCA 2B68A 2KBJA 3FE1A 3LDOA 1NGFA 1VNBA 2YC1C 5AQTA 1C56A 3C7NB 3FZKA 2G2KA 5AQXA 1OZZA 1VNAA 3D2EB 1MYNA 1ZU3A 2KYQA 2LT8A 2KHOA 2E3FA 2LJMA 3ATVA 1XRSB 3E7UX 3HSCA 4AB0A 2N69A 5BPLA 1BA0A 1JZBA 1S3XA 2QWQA 4H5NA 4AEIA 3FZHA 3JXUA 1CHZA 2LR3A 2E88A 1ZVGA 1NGJA 2QW9A 5AQIA 1PTXA 1SN4A 1ZYWA 3PSMA 4H5WA 3GL1A 1NGEA 1HX1A
chains in the Genus database with same CATH topology
2NY8X 1NE5A 2KBKA 1T7EA 2GL1A 1AHOA 1ICAA 5CY0A 2LJ7A 1DJTA 1BCGA 2BRZA 5KK4A 1NH5A 1P0AA 1NPIA 4V1DC 1SEGA 2KBHA 1T0ZA 4AAZA 2B3CA 1MR4A 2E0HA 1T7AA 4CQKA 2I61A 2LKBA 1JZAA 1JKZA 1B3CA 1GPTA 1L4VA 1PX9A 2N66A 2MZ0A 1TI5A 2N2RA 2YBRC 2LY5A 3E7RL 1T1TA 1I6FA 1LQIA 2KGQA 1PE4A 1LQHA 1DQ7A 1I6GA 1BMRA 1C55A 2N2QA 1BK8A 1ZVEA 1SN1A 2ATBA 1NRAA 1I2UA 1WT7A 1N4NA 1AYJA 1ZUTA 4UJ0A 1OMYA 2E3GA 2ASCA 2SN3A 1WMTA 1CN2A 2M8BB 1GPSA 4HHFA 2NY9X 1BRZA 1NRBA 1FH3A 1P00A 2A7TA 2LI7A 1T7BA 1ZYVA 4HE7A 1KV0A 2LY6A 1ZFUA 2KJAA 1SNBA 1WWNA 1LQQA 2KPYA 2KSKA 2YEOA 1B7DA 4KYPA 1JXCA 2B68A 2KBJA 1VNBA 2YC1C 1C56A 1OZZA 1VNAA 1MYNA 1ZU3A 2KYQA 2LT8A 2E3FA 2LJMA 3E7UX 4AB0A 2N69A 1JZBA 4AEIA 1CHZA 2LR3A 1ZVGA 1PTXA 1SN4A 1ZYWA 3PSMA 1I2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NY8 X;  1NE5 A;  2KBK A;  1T7E A;  2GL1 A;  1AHO A;  1ICA A;  5CY0 A;  2LJ7 A;  1DJT A;  1BCG A;  2BRZ A;  5KK4 A;  1NH5 A;  1P0A A;  1NPI A;  4V1D C;  1SEG A;  2KBH A;  1T0Z A;  4AAZ A;  2B3C A;  1MR4 A;  2E0H A;  1T7A A;  4CQK A;  2I61 A;  2LKB A;  1JZA A;  1JKZ A;  1B3C A;  1GPT A;  1L4V A;  1PX9 A;  2N66 A;  2MZ0 A;  1TI5 A;  2N2R A;  2YBR C;  2LY5 A;  3E7R L;  1T1T A;  1I6F A;  1LQI A;  2KGQ A;  1PE4 A;  1LQH A;  1DQ7 A;  1I6G A;  1BMR A;  1C55 A;  2N2Q A;  1BK8 A;  1ZVE A;  1SN1 A;  2ATB A;  1NRA A;  1I2U A;  1WT7 A;  1N4N A;  1AYJ A;  1ZUT A;  4UJ0 A;  1OMY A;  2E3G A;  2ASC A;  2SN3 A;  1WMT A;  1CN2 A;  2M8B B;  1GPS A;  4HHF A;  2NY9 X;  1BRZ A;  1NRB A;  1FH3 A;  1P00 A;  2A7T A;  2LI7 A;  1T7B A;  1ZYV A;  4HE7 A;  1KV0 A;  2LY6 A;  1ZFU A;  2KJA A;  1SNB A;  1WWN A;  1LQQ A;  2KPY A;  2KSK A;  2YEO A;  1B7D A;  4KYP A;  1JXC A;  2B68 A;  2KBJ A;  1VNB A;  2YC1 C;  1C56 A;  1OZZ A;  1VNA A;  1MYN A;  1ZU3 A;  2KYQ A;  2LT8 A;  2E3F A;  2LJM A;  3E7U X;  4AB0 A;  2N69 A;  1JZB A;  4AEI A;  1CHZ A;  2LR3 A;  1ZVG A;  1PTX A;  1SN4 A;  1ZYW A;  3PSM A;  1I2V A; 
#chains in the Genus database with same CATH topology
 1QQM A;  3KOY A;  2NY8 X;  5AQK A;  4KBO A;  2BUP A;  1NGD A;  1NE5 A;  2KBK A;  1T7E A;  2GL1 A;  1AHO A;  1QQN A;  3KVG A;  3QFU A;  3R2V A;  5EX5 A;  5CY0 A;  5AQN A;  2LJ7 A;  1ICA A;  1NGG A;  1DJT A;  1BCG A;  2BRZ A;  2K35 A;  3L6Q A;  1NH5 A;  5BPM A;  2MBK A;  1P0A A;  5FPD A;  1NPI A;  4V1D C;  1SEG A;  2KBH A;  1T0Z A;  3ATU A;  4AAZ A;  2B3C A;  1MR4 A;  2E0H A;  1ATR A;  5BN8 A;  1NGC A;  3CW4 A;  1QQO A;  1T7A A;  2GMO A;  4FL9 A;  3SF4 D;  2QXL A;  2I61 A;  2LKB A;  1JZA A;  1HJO A;  2QWN A;  3FZM A;  3M3Z A;  2YIL A;  4CQK A;  1B3C A;  1JKZ A;  1GPT A;  1NGH A;  5F2R A;  3KHW A;  1HPM A;  4GNI A;  3FZF A;  5AQJ A;  5AQY A;  5FPM A;  1KAY A;  1L4V A;  2JDQ D;  1PX9 A;  3L56 A;  3QML A;  2N66 A;  3KOW A;  2MZ0 A;  3IUC A;  1TI5 A;  1NGB A;  2N2R A;  5AQW A;  2YBR C;  2LY5 A;  3E7R L;  5F0X A;  1T1T A;  1I6F A;  3A8Y A;  1LQI A;  2KGQ A;  1K8B A;  1PE4 A;  5AQV A;  3KOZ A;  5AQP A;  2YIP A;  3AY9 A;  3LDL A;  1LQH A;  3GDQ A;  4UAD E;  3FZL A;  1BUP A;  1DQ7 A;  1I6G A;  1BMR A;  3KP0 A;  5BN9 A;  1C55 A;  2N2Q A;  5AQM A;  5AR0 A;  5BPN A;  1BK8 A;  3D2F A;  3LDQ A;  1ZVE A;  1SN1 A;  2YIO A;  5AQS A;  2ATB A;  1NRA A;  1I2U A;  1WT7 A;  2QWO A;  1N4N A;  5AQL A;  3BK3 C;  4IO8 A;  1AYJ A;  1ZUT A;  4H5R A;  4H5V A;  4UJ0 A;  4UAF E;  1OMY A;  1UGL A;  2E3G A;  3LDP A;  1POI A;  4HWI A;  2ASC A;  1KAZ A;  2SN3 A;  3LDN A;  1WMT A;  5EVZ A;  2LN8 A;  4H5T A;  5AQQ A;  1CN2 A;  2M8B B;  1GPS A;  3C7N A;  3GKU A;  5F1X A;  5EXW A;  3QI7 A;  3KC6 A;  1NGA A;  3D2E A;  2NY9 X;  4FSV A;  4HHF A;  2V7Z A;  5FPE A;  1BRZ A;  1NRB A;  1FH3 A;  2VY6 A;  1P00 A;  2E8A A;  5AQF A;  2D56 A;  1BA1 A;  2A7T A;  2LI7 A;  5EY4 A;  1T7B A;  1ATS A;  3D2F B;  1ZYV A;  1YUW A;  2QWM A;  5AQR A;  3KP1 A;  4HE7 A;  1KV0 A;  3KOX A;  2LY6 A;  1ZFU A;  2MN5 A;  2KJA A;  1SNB A;  2E2F A;  1WWN A;  3L4I A;  2QWL A;  3I33 A;  5AQZ A;  5AQO A;  1NGI A;  4UAE F;  5AQG A;  3QFP A;  1LQQ A;  2KPY A;  2KSK A;  2YEO A;  1B7D A;  2QWR A;  1KAX A;  2QWP A;  4KYP A;  5AQH A;  5AQU A;  5FPN A;  5KK4 A;  1I2V A;  1DKG D;  3CQX A;  1JXC A;  2B68 A;  2KBJ A;  3FE1 A;  3LDO A;  1NGF A;  1VNB A;  2YC1 C;  5AQT A;  1C56 A;  3C7N B;  3FZK A;  2G2K A;  5AQX A;  1OZZ A;  1VNA A;  3D2E B;  1MYN A;  1ZU3 A;  2KYQ A;  2LT8 A;  2KHO A;  2E3F A;  2LJM A;  3ATV A;  1XRS B;  3E7U X;  3HSC A;  4AB0 A;  2N69 A;  5BPL A;  1BA0 A;  1JZB A;  1S3X A;  2QWQ A;  4H5N A;  4AEI A;  3FZH A;  3JXU A;  1CHZ A;  2LR3 A;  2E88 A;  1ZVG A;  1NGJ A;  2QW9 A;  5AQI A;  1PTX A;  1SN4 A;  1ZYW A;  3PSM A;  4H5W A;  3GL1 A;  1NGE A;  1HX1 A; 
#chains in the Genus database with same CATH homology
 2NY8 X;  1NE5 A;  2KBK A;  1T7E A;  2GL1 A;  1AHO A;  1ICA A;  5CY0 A;  2LJ7 A;  1DJT A;  1BCG A;  2BRZ A;  5KK4 A;  1NH5 A;  1P0A A;  1NPI A;  4V1D C;  1SEG A;  2KBH A;  1T0Z A;  4AAZ A;  2B3C A;  1MR4 A;  2E0H A;  1T7A A;  4CQK A;  2I61 A;  2LKB A;  1JZA A;  1JKZ A;  1B3C A;  1GPT A;  1L4V A;  1PX9 A;  2N66 A;  2MZ0 A;  1TI5 A;  2N2R A;  2YBR C;  2LY5 A;  3E7R L;  1T1T A;  1I6F A;  1LQI A;  2KGQ A;  1PE4 A;  1LQH A;  1DQ7 A;  1I6G A;  1BMR A;  1C55 A;  2N2Q A;  1BK8 A;  1ZVE A;  1SN1 A;  2ATB A;  1NRA A;  1I2U A;  1WT7 A;  1N4N A;  1AYJ A;  1ZUT A;  4UJ0 A;  1OMY A;  2E3G A;  2ASC A;  2SN3 A;  1WMT A;  1CN2 A;  2M8B B;  1GPS A;  4HHF A;  2NY9 X;  1BRZ A;  1NRB A;  1FH3 A;  1P00 A;  2A7T A;  2LI7 A;  1T7B A;  1ZYV A;  4HE7 A;  1KV0 A;  2LY6 A;  1ZFU A;  2KJA A;  1SNB A;  1WWN A;  1LQQ A;  2KPY A;  2KSK A;  2YEO A;  1B7D A;  4KYP A;  1JXC A;  2B68 A;  2KBJ A;  1VNB A;  2YC1 C;  1C56 A;  1OZZ A;  1VNA A;  1MYN A;  1ZU3 A;  2KYQ A;  2LT8 A;  2E3F A;  2LJM A;  3E7U X;  4AB0 A;  2N69 A;  1JZB A;  4AEI A;  1CHZ A;  2LR3 A;  1ZVG A;  1PTX A;  1SN4 A;  1ZYW A;  3PSM A;  1I2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...