2A7TA

Crystal structure of a novel neurotoxin from buthus tamalus at 2.2a resolution.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'GEDGYIADGDNCTYICTFNNYCHALCTDKKGDSGACDWWVPYGVVCWCEDLPTPVPIRGSGKCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin
publication title Crystal structure of a highly acidic neurotoxin from scorpion Buthus tamulus at 2.2A resolution reveals novel structural features.
pubmed doi rcsb
molecule tags Toxin
total genus 14
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2a7tA00
1AHOA 1WT7A 1T7AA 1VNBA 2LJMA 1CHZA 2NY9X 2LKBA 5KK4A 1GPTA 2LR3A 2YBRC 3PSMA 1SNBA 1ZFUA 2KJAA 1JXCA 4CQKA 1FH3A 2LI7A 2ASCA 2LY6A 1MYNA 1NH5A 1OZZA 2SN3A 2KBJA 2M8BB 1C55A 1ZYWA 2N2QA 2KBKA 1OMYA 2E3GA 3E7RL 1PTXA 2YC1C 1NRBA 2N2RA 2BRZA 1BK8A 1PE4A 2LY5A 4UJ0A 1DQ7A 1ICAA 1T1TA 1MR4A 1WMTA 1T7BA 2A7TA 3E7UX 1KV0A 1JZBA 1SEGA 2KPYA 2LJ7A 1ZYVA 1B7DA 1NE5A 1T0ZA 2B3CA 1JZAA 2KGQA 2ATBA 4HE7A 2YEOA 1GPSA 1L4VA 1I6GA 1LQHA 2KSKA 1P0AA 1NPIA 4KYPA 1LQQA 4AAZA 2B68A 1I2VA 2LT8A 1B3CA 1LQIA 2E3FA 1ZVEA 1I6FA 1BCGA 5CY0A 1CN2A 2E0HA 4HHFA 1TI5A 2N66A 1T7EA 2I61A 1NRAA 2KBHA 1P00A 1ZUTA 1ZU3A 1I2UA 1ZVGA 1AYJA 2GL1A 4AB0A 4AEIA 1SN1A 4V1DC 1PX9A 1WWNA 1DJTA 1VNAA 2KYQA 2N69A 2NY8X 1BRZA 1C56A 1SN4A 1BMRA 1N4NA 2MZ0A 1JKZA
chains in the Genus database with same CATH superfamily
4FL9A 1AHOA 5AQOA 1K8BA 1WT7A 3LDQA 1T7AA 1VNBA 4H5VA 2G2KA 2LJMA 1CHZA 3LDOA 5F0XA 2NY9X 1NGJA 5BN9A 2YILA 3KC6A 2LKBA 5KK4A 3D2FA 3GDQA 5AQHA 2LR3A 1GPTA 4H5TA 3KVGA 1HPMA 4HWIA 2E8AA 2QWRA 4UAFE 5FPNA 3KP0A 5AQTA 1HX1A 3GL1A 5AQXA 4H5RA 5AQFA 4GNIA 2YBRC 3PSMA 1SNBA 3KOWA 3FZFA 1ZFUA 2KJAA 1JXCA 4CQKA 1S3XA 5FPDA 3C7NA 1KAYA 5FPMA 3QFUA 5BPLA 1FH3A 2LI7A 2ASCA 2LY6A 1MYNA 1NGIA 5BPMA 3SF4D 1NGEA 1NH5A 1OZZA 1HJOA 2SN3A 3I33A 2E88A 2KBJA 2M8BB 5AQQA 1C55A 1ZYWA 5AQSA 2N2QA 2BUPA 1NGHA 3KOZA 2KBKA 5EX5A 1OMYA 2E3GA 3E7RL 1QQOA 1PTXA 2YC1C 1NRBA 1YUWA 2N2RA 2BRZA 2QWOA 5AQNA 3R2VA 1BUPA 1BK8A 3FZKA 1PE4A 1POIA 5EY4A 3ATUA 2LY5A 4UJ0A 2JDQD 3QI7A 2YIPA 1DQ7A 1ICAA 2LN8A 1NGBA 1T1TA 1MR4A 1WMTA 1T7BA 2A7TA 3E7UX 1KV0A 5AQPA 2QWPA 3LDLA 1JZBA 1NGDA 1SEGA 1KAXA 5AQUA 1BA1A 2KPYA 2LJ7A 5EXWA 1QQMA 1ZYVA 4FSVA 1BMRA 3KHWA 1B7DA 1NE5A 5AQJA 2QWLA 1T0ZA 3QFPA 4KBOA 5AQWA 2D56A 2B3CA 1JZAA 2KGQA 2ATBA 2KHOA 4HE7A 2YEOA 3FZLA 1GPSA 5BPNA 1ATSA 3LDPA 1L4VA 3JXUA 1I6GA 3FE1A 3D2EB 4H5WA 1LQHA 2KSKA 2QWQA 1P0AA 1NGAA 1NPIA 3CQXA 4KYPA 1LQQA 3L4IA 1NGGA 1UGLA 2MN5A 4AAZA 2B68A 5F1XA 1I2VA 2LT8A 5EVZA 5AQRA 1BA0A 3GKUA 3AY9A 5F2RA 1B3CA 1LQIA 5AQYA 2E3FA 1DKGD 1I6FA 1ZVEA 1BCGA 3KOYA 4UADE 1KAZA 5CY0A 1CN2A 2E0HA 3D2FB 5AQZA 4HHFA 1TI5A 2N66A 3IUCA 1T7EA 2QW9A 5AQIA 2I61A 1NRAA 2E2FA 2VY6A 3A8YA 2QWMA 5BN8A 1XRSB 4IO8A 3L56A 5AQKA 2KBHA 3CW4A 1P00A 1ZUTA 1ZU3A 3M3ZA 3FZHA 1I2UA 1ZVGA 5AQGA 5AQMA 1AYJA 5AQVA 3FZMA 3C7NB 5AR0A 3L6QA 2GL1A 4AB0A 1QQNA 4AEIA 1SN1A 4V1DC 1PX9A 1WWNA 3QMLA 2QXLA 2QWNA 2YIOA 2GMOA 1DJTA 1VNAA 2KYQA 3BK3C 3D2EA 5FPEA 3KP1A 1NGFA 2N69A 2NY8X 3KOXA 4UAEF 5AQLA 2V7ZA 4H5NA 3ATVA 1ATRA 1C56A 1SN4A 2MBKA 3LDNA 1BRZA 2K35A 1N4NA 2MZ0A 1NGCA 1JKZA 3HSCA
chains in the Genus database with same CATH topology
1AHOA 1WT7A 1T7AA 1VNBA 2LJMA 1CHZA 2NY9X 2LKBA 5KK4A 1GPTA 2LR3A 2YBRC 3PSMA 1SNBA 1ZFUA 2KJAA 1JXCA 4CQKA 1FH3A 2LI7A 2ASCA 2LY6A 1MYNA 1NH5A 1OZZA 2SN3A 2KBJA 2M8BB 1C55A 1ZYWA 2N2QA 2KBKA 1OMYA 2E3GA 3E7RL 1PTXA 2YC1C 1NRBA 2N2RA 2BRZA 1BK8A 1PE4A 2LY5A 4UJ0A 1DQ7A 1ICAA 1T1TA 1MR4A 1WMTA 1T7BA 2A7TA 3E7UX 1KV0A 1JZBA 1SEGA 2KPYA 2LJ7A 1ZYVA 1B7DA 1NE5A 1T0ZA 2B3CA 1JZAA 2KGQA 2ATBA 4HE7A 2YEOA 1GPSA 1L4VA 1I6GA 1LQHA 2KSKA 1P0AA 1NPIA 4KYPA 1LQQA 4AAZA 2B68A 1I2VA 2LT8A 1B3CA 1LQIA 2E3FA 1ZVEA 1I6FA 1BCGA 5CY0A 1CN2A 2E0HA 4HHFA 1TI5A 2N66A 1T7EA 2I61A 1NRAA 2KBHA 1P00A 1ZUTA 1ZU3A 1I2UA 1ZVGA 1AYJA 2GL1A 4AB0A 4AEIA 1SN1A 4V1DC 1PX9A 1WWNA 1DJTA 1VNAA 2KYQA 2N69A 2NY8X 1BRZA 1C56A 1SN4A 1BMRA 1N4NA 2MZ0A 1JKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHO A;  1WT7 A;  1T7A A;  1VNB A;  2LJM A;  1CHZ A;  2NY9 X;  2LKB A;  5KK4 A;  1GPT A;  2LR3 A;  2YBR C;  3PSM A;  1SNB A;  1ZFU A;  2KJA A;  1JXC A;  4CQK A;  1FH3 A;  2LI7 A;  2ASC A;  2LY6 A;  1MYN A;  1NH5 A;  1OZZ A;  2SN3 A;  2KBJ A;  2M8B B;  1C55 A;  1ZYW A;  2N2Q A;  2KBK A;  1OMY A;  2E3G A;  3E7R L;  1PTX A;  2YC1 C;  1NRB A;  2N2R A;  2BRZ A;  1BK8 A;  1PE4 A;  2LY5 A;  4UJ0 A;  1DQ7 A;  1ICA A;  1T1T A;  1MR4 A;  1WMT A;  1T7B A;  2A7T A;  3E7U X;  1KV0 A;  1JZB A;  1SEG A;  2KPY A;  2LJ7 A;  1ZYV A;  1B7D A;  1NE5 A;  1T0Z A;  2B3C A;  1JZA A;  2KGQ A;  2ATB A;  4HE7 A;  2YEO A;  1GPS A;  1L4V A;  1I6G A;  1LQH A;  2KSK A;  1P0A A;  1NPI A;  4KYP A;  1LQQ A;  4AAZ A;  2B68 A;  1I2V A;  2LT8 A;  1B3C A;  1LQI A;  2E3F A;  1ZVE A;  1I6F A;  1BCG A;  5CY0 A;  1CN2 A;  2E0H A;  4HHF A;  1TI5 A;  2N66 A;  1T7E A;  2I61 A;  1NRA A;  2KBH A;  1P00 A;  1ZUT A;  1ZU3 A;  1I2U A;  1ZVG A;  1AYJ A;  2GL1 A;  4AB0 A;  4AEI A;  1SN1 A;  4V1D C;  1PX9 A;  1WWN A;  1DJT A;  1VNA A;  2KYQ A;  2N69 A;  2NY8 X;  1BRZ A;  1C56 A;  1SN4 A;  1BMR A;  1N4N A;  2MZ0 A;  1JKZ A; 
#chains in the Genus database with same CATH topology
 4FL9 A;  1AHO A;  5AQO A;  1K8B A;  1WT7 A;  3LDQ A;  1T7A A;  1VNB A;  4H5V A;  2G2K A;  2LJM A;  1CHZ A;  3LDO A;  5F0X A;  2NY9 X;  1NGJ A;  5BN9 A;  2YIL A;  3KC6 A;  2LKB A;  5KK4 A;  3D2F A;  3GDQ A;  5AQH A;  2LR3 A;  1GPT A;  4H5T A;  3KVG A;  1HPM A;  4HWI A;  2E8A A;  2QWR A;  4UAF E;  5FPN A;  3KP0 A;  5AQT A;  1HX1 A;  3GL1 A;  5AQX A;  4H5R A;  5AQF A;  4GNI A;  2YBR C;  3PSM A;  1SNB A;  3KOW A;  3FZF A;  1ZFU A;  2KJA A;  1JXC A;  4CQK A;  1S3X A;  5FPD A;  3C7N A;  1KAY A;  5FPM A;  3QFU A;  5BPL A;  1FH3 A;  2LI7 A;  2ASC A;  2LY6 A;  1MYN A;  1NGI A;  5BPM A;  3SF4 D;  1NGE A;  1NH5 A;  1OZZ A;  1HJO A;  2SN3 A;  3I33 A;  2E88 A;  2KBJ A;  2M8B B;  5AQQ A;  1C55 A;  1ZYW A;  5AQS A;  2N2Q A;  2BUP A;  1NGH A;  3KOZ A;  2KBK A;  5EX5 A;  1OMY A;  2E3G A;  3E7R L;  1QQO A;  1PTX A;  2YC1 C;  1NRB A;  1YUW A;  2N2R A;  2BRZ A;  2QWO A;  5AQN A;  3R2V A;  1BUP A;  1BK8 A;  3FZK A;  1PE4 A;  1POI A;  5EY4 A;  3ATU A;  2LY5 A;  4UJ0 A;  2JDQ D;  3QI7 A;  2YIP A;  1DQ7 A;  1ICA A;  2LN8 A;  1NGB A;  1T1T A;  1MR4 A;  1WMT A;  1T7B A;  2A7T A;  3E7U X;  1KV0 A;  5AQP A;  2QWP A;  3LDL A;  1JZB A;  1NGD A;  1SEG A;  1KAX A;  5AQU A;  1BA1 A;  2KPY A;  2LJ7 A;  5EXW A;  1QQM A;  1ZYV A;  4FSV A;  1BMR A;  3KHW A;  1B7D A;  1NE5 A;  5AQJ A;  2QWL A;  1T0Z A;  3QFP A;  4KBO A;  5AQW A;  2D56 A;  2B3C A;  1JZA A;  2KGQ A;  2ATB A;  2KHO A;  4HE7 A;  2YEO A;  3FZL A;  1GPS A;  5BPN A;  1ATS A;  3LDP A;  1L4V A;  3JXU A;  1I6G A;  3FE1 A;  3D2E B;  4H5W A;  1LQH A;  2KSK A;  2QWQ A;  1P0A A;  1NGA A;  1NPI A;  3CQX A;  4KYP A;  1LQQ A;  3L4I A;  1NGG A;  1UGL A;  2MN5 A;  4AAZ A;  2B68 A;  5F1X A;  1I2V A;  2LT8 A;  5EVZ A;  5AQR A;  1BA0 A;  3GKU A;  3AY9 A;  5F2R A;  1B3C A;  1LQI A;  5AQY A;  2E3F A;  1DKG D;  1I6F A;  1ZVE A;  1BCG A;  3KOY A;  4UAD E;  1KAZ A;  5CY0 A;  1CN2 A;  2E0H A;  3D2F B;  5AQZ A;  4HHF A;  1TI5 A;  2N66 A;  3IUC A;  1T7E A;  2QW9 A;  5AQI A;  2I61 A;  1NRA A;  2E2F A;  2VY6 A;  3A8Y A;  2QWM A;  5BN8 A;  1XRS B;  4IO8 A;  3L56 A;  5AQK A;  2KBH A;  3CW4 A;  1P00 A;  1ZUT A;  1ZU3 A;  3M3Z A;  3FZH A;  1I2U A;  1ZVG A;  5AQG A;  5AQM A;  1AYJ A;  5AQV A;  3FZM A;  3C7N B;  5AR0 A;  3L6Q A;  2GL1 A;  4AB0 A;  1QQN A;  4AEI A;  1SN1 A;  4V1D C;  1PX9 A;  1WWN A;  3QML A;  2QXL A;  2QWN A;  2YIO A;  2GMO A;  1DJT A;  1VNA A;  2KYQ A;  3BK3 C;  3D2E A;  5FPE A;  3KP1 A;  1NGF A;  2N69 A;  2NY8 X;  3KOX A;  4UAE F;  5AQL A;  2V7Z A;  4H5N A;  3ATV A;  1ATR A;  1C56 A;  1SN4 A;  2MBK A;  3LDN A;  1BRZ A;  2K35 A;  1N4N A;  2MZ0 A;  1NGC A;  1JKZ A;  3HSC A; 
#chains in the Genus database with same CATH homology
 1AHO A;  1WT7 A;  1T7A A;  1VNB A;  2LJM A;  1CHZ A;  2NY9 X;  2LKB A;  5KK4 A;  1GPT A;  2LR3 A;  2YBR C;  3PSM A;  1SNB A;  1ZFU A;  2KJA A;  1JXC A;  4CQK A;  1FH3 A;  2LI7 A;  2ASC A;  2LY6 A;  1MYN A;  1NH5 A;  1OZZ A;  2SN3 A;  2KBJ A;  2M8B B;  1C55 A;  1ZYW A;  2N2Q A;  2KBK A;  1OMY A;  2E3G A;  3E7R L;  1PTX A;  2YC1 C;  1NRB A;  2N2R A;  2BRZ A;  1BK8 A;  1PE4 A;  2LY5 A;  4UJ0 A;  1DQ7 A;  1ICA A;  1T1T A;  1MR4 A;  1WMT A;  1T7B A;  2A7T A;  3E7U X;  1KV0 A;  1JZB A;  1SEG A;  2KPY A;  2LJ7 A;  1ZYV A;  1B7D A;  1NE5 A;  1T0Z A;  2B3C A;  1JZA A;  2KGQ A;  2ATB A;  4HE7 A;  2YEO A;  1GPS A;  1L4V A;  1I6G A;  1LQH A;  2KSK A;  1P0A A;  1NPI A;  4KYP A;  1LQQ A;  4AAZ A;  2B68 A;  1I2V A;  2LT8 A;  1B3C A;  1LQI A;  2E3F A;  1ZVE A;  1I6F A;  1BCG A;  5CY0 A;  1CN2 A;  2E0H A;  4HHF A;  1TI5 A;  2N66 A;  1T7E A;  2I61 A;  1NRA A;  2KBH A;  1P00 A;  1ZUT A;  1ZU3 A;  1I2U A;  1ZVG A;  1AYJ A;  2GL1 A;  4AB0 A;  4AEI A;  1SN1 A;  4V1D C;  1PX9 A;  1WWN A;  1DJT A;  1VNA A;  2KYQ A;  2N69 A;  2NY8 X;  1BRZ A;  1C56 A;  1SN4 A;  1BMR A;  1N4N A;  2MZ0 A;  1JKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...