1DJTA

Atomic resolution structure of scorpion alpha-like toxin bmk m1 in a new crystal form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LIKE NEUROTOXIN BMK M1
publication title Atomic Resolution Structure of Scorpion Alpha-Like Toxin BmK M1 in a New Crystal Form
rcsb
molecule tags Toxin
total genus 16
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1djtA00
2I61A 1L4VA 1GPSA 1PTXA 2NY9X 1JKZA 2KSKA 1B3CA 1ZU3A 5CY0A 1WWNA 1ZYVA 2LY6A 1ZYWA 2MZ0A 1MR4A 1WMTA 1FH3A 2LT8A 2LJ7A 4HHFA 1C56A 1P00A 2ASCA 1WT7A 1MYNA 1ZVGA 2A7TA 1BCGA 1AHOA 2N66A 1BRZA 2KPYA 4AB0A 4AEIA 1T7EA 2E3GA 2YBRC 4HE7A 2KGQA 2N2QA 2N69A 3E7UX 2B68A 1NPIA 2N2RA 1T7AA 2E3FA 1LQIA 1DQ7A 1OMYA 1NE5A 1ZFUA 4CQKA 1SN1A 1PX9A 1N4NA 3E7RL 1I6GA 1VNBA 1NRAA 2E0HA 1NRBA 5KK4A 1AYJA 1T1TA 1OZZA 1KV0A 1I6FA 4UJ0A 1LQHA 1CN2A 2YEOA 1NH5A 1BK8A 4KYPA 1ZUTA 1P0AA 1T7BA 1JZBA 2KBKA 2LY5A 1I2VA 1PE4A 1SEGA 1SNBA 2GL1A 2LKBA 2KJAA 1LQQA 4AAZA 2B3CA 1VNAA 2YC1C 1ICAA 1GPTA 1SN4A 2KYQA 2LI7A 1T0ZA 2KBJA 2LJMA 1B7DA 2ATBA 1BMRA 2LR3A 1DJTA 2M8BB 1CHZA 2KBHA 3PSMA 2NY8X 1ZVEA 1I2UA 2SN3A 1C55A 1JXCA 4V1DC 1JZAA 1TI5A 2BRZA
chains in the Genus database with same CATH superfamily
2I61A 1L4VA 1GPSA 1PTXA 2QWPA 5BPMA 2NY9X 3D2EA 3HSCA 2KSKA 1JKZA 5BPNA 2BUPA 4IO8A 1B3CA 1ZU3A 5CY0A 1WWNA 2LN8A 2MBKA 1ZYVA 5F0XA 2LY6A 1ZYWA 2MZ0A 1HPMA 1MR4A 1QQMA 2K35A 1WMTA 3FE1A 5AQZA 1FH3A 2LT8A 2LJ7A 3I33A 2V7ZA 5BN9A 4H5VA 4HHFA 1S3XA 1C56A 3KP1A 3L4IA 3BK3C 3M3ZA 1P00A 2ASCA 3GDQA 1WT7A 5AQUA 1MYNA 2QWLA 1ZVGA 1NGGA 5AQIA 3A8YA 5AQJA 3SF4D 1BA1A 2A7TA 1QQOA 1BCGA 3C7NB 5FPMA 1AHOA 4GNIA 5EXWA 2YIPA 5AQQA 3AY9A 3KOWA 1K8BA 2N66A 3ATVA 3JXUA 5F2RA 1BA0A 2KPYA 3QFPA 1BRZA 2JDQD 2G2KA 4AB0A 3CQXA 3L6QA 1KAYA 5AQVA 1NGCA 4AEIA 3KVGA 1HX1A 1T7EA 2E3GA 2YBRC 4HE7A 5AQOA 3KOZA 3FZLA 2KGQA 2N2QA 2N69A 1KAXA 3E7UX 4KBOA 3QI7A 1BUPA 2B68A 5AQKA 5AQNA 1NPIA 3KP0A 5AQSA 2N2RA 3D2EB 1T7AA 2E3FA 3IUCA 5FPEA 5BN8A 3ATUA 1LQIA 1ATSA 2QWMA 1DQ7A 5AQWA 1OMYA 1NE5A 2E88A 3KOYA 2MN5A 1ZFUA 1NGIA 4CQKA 5AQYA 1SN1A 1PX9A 1N4NA 5FPDA 3E7RL 1DKGD 1I6GA 1VNBA 1NRAA 3LDPA 2E0HA 3D2FA 3FZHA 1QQNA 4FL9A 2YILA 2VY6A 3LDNA 5AQGA 1NRBA 2QWRA 2E8AA 2KHOA 4H5WA 3C7NA 5AQLA 5AQTA 1T1TA 5AQFA 5KK4A 1AYJA 1OZZA 1KV0A 1I6FA 4H5TA 5EY4A 1LQHA 4UJ0A 3L56A 5BPLA 1CN2A 2YEOA 1NH5A 3R2VA 3LDLA 2QWNA 1BK8A 4KYPA 3QMLA 5FPNA 2QWOA 1ZUTA 3GKUA 4H5NA 4HWIA 1NGBA 4UADE 4UAFE 1POIA 1P0AA 1NGJA 2D56A 1T7BA 1JZBA 2KBKA 2LY5A 1I2VA 1PE4A 2E2FA 3FZMA 1SEGA 2QXLA 3LDQA 1SNBA 3FZKA 2GL1A 3KHWA 2LKBA 2KJAA 4FSVA 1NGEA 3LDOA 1LQQA 5AQRA 1KAZA 4AAZA 4UAEF 2B3CA 5AQHA 5F1XA 1VNAA 5AQPA 1NGAA 3CW4A 3QFUA 5AQMA 1UGLA 3FZFA 2YC1C 5EVZA 1ICAA 2QW9A 1GPTA 1SN4A 2KYQA 2LI7A 1ATRA 1T0ZA 2KBJA 2LJMA 3D2FB 1B7DA 5AR0A 2ATBA 1BMRA 2LR3A 1NGFA 1HJOA 1DJTA 2QWQA 2M8BB 1CHZA 2KBHA 1YUWA 3PSMA 5AQXA 1XRSB 1NGHA 1NGDA 2NY8X 3KC6A 1ZVEA 3GL1A 4H5RA 5EX5A 2YIOA 1I2UA 2SN3A 1C55A 1JXCA 4V1DC 2GMOA 1JZAA 3KOXA 1TI5A 2BRZA
chains in the Genus database with same CATH topology
2I61A 1L4VA 1GPSA 1PTXA 2NY9X 1JKZA 2KSKA 1B3CA 1ZU3A 5CY0A 1WWNA 1ZYVA 2LY6A 1ZYWA 2MZ0A 1MR4A 1WMTA 1FH3A 2LT8A 2LJ7A 4HHFA 1C56A 1P00A 2ASCA 1WT7A 1MYNA 1ZVGA 2A7TA 1BCGA 1AHOA 2N66A 1BRZA 2KPYA 4AB0A 4AEIA 1T7EA 2E3GA 2YBRC 4HE7A 2KGQA 2N2QA 2N69A 3E7UX 2B68A 1NPIA 2N2RA 1T7AA 2E3FA 1LQIA 1DQ7A 1OMYA 1NE5A 1ZFUA 4CQKA 1SN1A 1PX9A 1N4NA 3E7RL 1I6GA 1VNBA 1NRAA 2E0HA 1NRBA 5KK4A 1AYJA 1T1TA 1OZZA 1KV0A 1I6FA 4UJ0A 1LQHA 1CN2A 2YEOA 1NH5A 1BK8A 4KYPA 1ZUTA 1P0AA 1T7BA 1JZBA 2KBKA 2LY5A 1I2VA 1PE4A 1SEGA 1SNBA 2GL1A 2LKBA 2KJAA 1LQQA 4AAZA 2B3CA 1VNAA 2YC1C 1ICAA 1GPTA 1SN4A 2KYQA 2LI7A 1T0ZA 2KBJA 2LJMA 1B7DA 2ATBA 1BMRA 2LR3A 1DJTA 2M8BB 1CHZA 2KBHA 3PSMA 2NY8X 1ZVEA 1I2UA 2SN3A 1C55A 1JXCA 4V1DC 1JZAA 1TI5A 2BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I61 A;  1L4V A;  1GPS A;  1PTX A;  2NY9 X;  1JKZ A;  2KSK A;  1B3C A;  1ZU3 A;  5CY0 A;  1WWN A;  1ZYV A;  2LY6 A;  1ZYW A;  2MZ0 A;  1MR4 A;  1WMT A;  1FH3 A;  2LT8 A;  2LJ7 A;  4HHF A;  1C56 A;  1P00 A;  2ASC A;  1WT7 A;  1MYN A;  1ZVG A;  2A7T A;  1BCG A;  1AHO A;  2N66 A;  1BRZ A;  2KPY A;  4AB0 A;  4AEI A;  1T7E A;  2E3G A;  2YBR C;  4HE7 A;  2KGQ A;  2N2Q A;  2N69 A;  3E7U X;  2B68 A;  1NPI A;  2N2R A;  1T7A A;  2E3F A;  1LQI A;  1DQ7 A;  1OMY A;  1NE5 A;  1ZFU A;  4CQK A;  1SN1 A;  1PX9 A;  1N4N A;  3E7R L;  1I6G A;  1VNB A;  1NRA A;  2E0H A;  1NRB A;  5KK4 A;  1AYJ A;  1T1T A;  1OZZ A;  1KV0 A;  1I6F A;  4UJ0 A;  1LQH A;  1CN2 A;  2YEO A;  1NH5 A;  1BK8 A;  4KYP A;  1ZUT A;  1P0A A;  1T7B A;  1JZB A;  2KBK A;  2LY5 A;  1I2V A;  1PE4 A;  1SEG A;  1SNB A;  2GL1 A;  2LKB A;  2KJA A;  1LQQ A;  4AAZ A;  2B3C A;  1VNA A;  2YC1 C;  1ICA A;  1GPT A;  1SN4 A;  2KYQ A;  2LI7 A;  1T0Z A;  2KBJ A;  2LJM A;  1B7D A;  2ATB A;  1BMR A;  2LR3 A;  1DJT A;  2M8B B;  1CHZ A;  2KBH A;  3PSM A;  2NY8 X;  1ZVE A;  1I2U A;  2SN3 A;  1C55 A;  1JXC A;  4V1D C;  1JZA A;  1TI5 A;  2BRZ A; 
#chains in the Genus database with same CATH topology
 2I61 A;  1L4V A;  1GPS A;  1PTX A;  2QWP A;  5BPM A;  2NY9 X;  3D2E A;  3HSC A;  2KSK A;  1JKZ A;  5BPN A;  2BUP A;  4IO8 A;  1B3C A;  1ZU3 A;  5CY0 A;  1WWN A;  2LN8 A;  2MBK A;  1ZYV A;  5F0X A;  2LY6 A;  1ZYW A;  2MZ0 A;  1HPM A;  1MR4 A;  1QQM A;  2K35 A;  1WMT A;  3FE1 A;  5AQZ A;  1FH3 A;  2LT8 A;  2LJ7 A;  3I33 A;  2V7Z A;  5BN9 A;  4H5V A;  4HHF A;  1S3X A;  1C56 A;  3KP1 A;  3L4I A;  3BK3 C;  3M3Z A;  1P00 A;  2ASC A;  3GDQ A;  1WT7 A;  5AQU A;  1MYN A;  2QWL A;  1ZVG A;  1NGG A;  5AQI A;  3A8Y A;  5AQJ A;  3SF4 D;  1BA1 A;  2A7T A;  1QQO A;  1BCG A;  3C7N B;  5FPM A;  1AHO A;  4GNI A;  5EXW A;  2YIP A;  5AQQ A;  3AY9 A;  3KOW A;  1K8B A;  2N66 A;  3ATV A;  3JXU A;  5F2R A;  1BA0 A;  2KPY A;  3QFP A;  1BRZ A;  2JDQ D;  2G2K A;  4AB0 A;  3CQX A;  3L6Q A;  1KAY A;  5AQV A;  1NGC A;  4AEI A;  3KVG A;  1HX1 A;  1T7E A;  2E3G A;  2YBR C;  4HE7 A;  5AQO A;  3KOZ A;  3FZL A;  2KGQ A;  2N2Q A;  2N69 A;  1KAX A;  3E7U X;  4KBO A;  3QI7 A;  1BUP A;  2B68 A;  5AQK A;  5AQN A;  1NPI A;  3KP0 A;  5AQS A;  2N2R A;  3D2E B;  1T7A A;  2E3F A;  3IUC A;  5FPE A;  5BN8 A;  3ATU A;  1LQI A;  1ATS A;  2QWM A;  1DQ7 A;  5AQW A;  1OMY A;  1NE5 A;  2E88 A;  3KOY A;  2MN5 A;  1ZFU A;  1NGI A;  4CQK A;  5AQY A;  1SN1 A;  1PX9 A;  1N4N A;  5FPD A;  3E7R L;  1DKG D;  1I6G A;  1VNB A;  1NRA A;  3LDP A;  2E0H A;  3D2F A;  3FZH A;  1QQN A;  4FL9 A;  2YIL A;  2VY6 A;  3LDN A;  5AQG A;  1NRB A;  2QWR A;  2E8A A;  2KHO A;  4H5W A;  3C7N A;  5AQL A;  5AQT A;  1T1T A;  5AQF A;  5KK4 A;  1AYJ A;  1OZZ A;  1KV0 A;  1I6F A;  4H5T A;  5EY4 A;  1LQH A;  4UJ0 A;  3L56 A;  5BPL A;  1CN2 A;  2YEO A;  1NH5 A;  3R2V A;  3LDL A;  2QWN A;  1BK8 A;  4KYP A;  3QML A;  5FPN A;  2QWO A;  1ZUT A;  3GKU A;  4H5N A;  4HWI A;  1NGB A;  4UAD E;  4UAF E;  1POI A;  1P0A A;  1NGJ A;  2D56 A;  1T7B A;  1JZB A;  2KBK A;  2LY5 A;  1I2V A;  1PE4 A;  2E2F A;  3FZM A;  1SEG A;  2QXL A;  3LDQ A;  1SNB A;  3FZK A;  2GL1 A;  3KHW A;  2LKB A;  2KJA A;  4FSV A;  1NGE A;  3LDO A;  1LQQ A;  5AQR A;  1KAZ A;  4AAZ A;  4UAE F;  2B3C A;  5AQH A;  5F1X A;  1VNA A;  5AQP A;  1NGA A;  3CW4 A;  3QFU A;  5AQM A;  1UGL A;  3FZF A;  2YC1 C;  5EVZ A;  1ICA A;  2QW9 A;  1GPT A;  1SN4 A;  2KYQ A;  2LI7 A;  1ATR A;  1T0Z A;  2KBJ A;  2LJM A;  3D2F B;  1B7D A;  5AR0 A;  2ATB A;  1BMR A;  2LR3 A;  1NGF A;  1HJO A;  1DJT A;  2QWQ A;  2M8B B;  1CHZ A;  2KBH A;  1YUW A;  3PSM A;  5AQX A;  1XRS B;  1NGH A;  1NGD A;  2NY8 X;  3KC6 A;  1ZVE A;  3GL1 A;  4H5R A;  5EX5 A;  2YIO A;  1I2U A;  2SN3 A;  1C55 A;  1JXC A;  4V1D C;  2GMO A;  1JZA A;  3KOX A;  1TI5 A;  2BRZ A; 
#chains in the Genus database with same CATH homology
 2I61 A;  1L4V A;  1GPS A;  1PTX A;  2NY9 X;  1JKZ A;  2KSK A;  1B3C A;  1ZU3 A;  5CY0 A;  1WWN A;  1ZYV A;  2LY6 A;  1ZYW A;  2MZ0 A;  1MR4 A;  1WMT A;  1FH3 A;  2LT8 A;  2LJ7 A;  4HHF A;  1C56 A;  1P00 A;  2ASC A;  1WT7 A;  1MYN A;  1ZVG A;  2A7T A;  1BCG A;  1AHO A;  2N66 A;  1BRZ A;  2KPY A;  4AB0 A;  4AEI A;  1T7E A;  2E3G A;  2YBR C;  4HE7 A;  2KGQ A;  2N2Q A;  2N69 A;  3E7U X;  2B68 A;  1NPI A;  2N2R A;  1T7A A;  2E3F A;  1LQI A;  1DQ7 A;  1OMY A;  1NE5 A;  1ZFU A;  4CQK A;  1SN1 A;  1PX9 A;  1N4N A;  3E7R L;  1I6G A;  1VNB A;  1NRA A;  2E0H A;  1NRB A;  5KK4 A;  1AYJ A;  1T1T A;  1OZZ A;  1KV0 A;  1I6F A;  4UJ0 A;  1LQH A;  1CN2 A;  2YEO A;  1NH5 A;  1BK8 A;  4KYP A;  1ZUT A;  1P0A A;  1T7B A;  1JZB A;  2KBK A;  2LY5 A;  1I2V A;  1PE4 A;  1SEG A;  1SNB A;  2GL1 A;  2LKB A;  2KJA A;  1LQQ A;  4AAZ A;  2B3C A;  1VNA A;  2YC1 C;  1ICA A;  1GPT A;  1SN4 A;  2KYQ A;  2LI7 A;  1T0Z A;  2KBJ A;  2LJM A;  1B7D A;  2ATB A;  1BMR A;  2LR3 A;  1DJT A;  2M8B B;  1CHZ A;  2KBH A;  3PSM A;  2NY8 X;  1ZVE A;  1I2U A;  2SN3 A;  1C55 A;  1JXC A;  4V1D C;  1JZA A;  1TI5 A;  2BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...