1DJTA

Atomic resolution structure of scorpion alpha-like toxin bmk m1 in a new crystal form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ALPHA-LIKE NEUROTOXIN BMK M1
publication title Atomic Resolution Structure of Scorpion Alpha-Like Toxin BmK M1 in a New Crystal Form
rcsb
total genus 16
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1djtA00
2MZ0A 2LI7A 2KSKA 1ICAA 2N69A 1OMYA 1N4NA 1I6FA 1T7BA 1BMRA 4AAZA 2KPYA 4HHFA 1LQHA 1LQIA 2SN3A 1JZBA 1ZYWA 2ASCA 1P00A 1I2UA 1PX9A 4AB0A 1T1TA 2KBKA 1MR4A 1NE5A 1PTXA 1LQQA 1C56A 2E0HA 1OZZA 2A7TA 1WMTA 1WT7A 1JXCA 1T7EA 2KBHA 1JZAA 2M8BB 1T7AA 4AEIA 1AHOA 2N66A 2YBRC 4CQKA 2B68A 1I2VA 1NRBA 2LJMA 3PSMA 1NPIA 2LY5A 2E3GA 1JKZA 2ATBA 1C55A 2LT8A 1L4VA 1SN1A 1ZVEA 2LKBA 1SN4A 2LJ7A 1CN2A 2BRZA 2KGQA 2N2QA 1BCGA 5CY0A 2I61A 2NY9X 1KV0A 1WWNA 4KYPA 1ZFUA 1SEGA 3E7RL 1GPSA 1DQ7A 1NRAA 1ZYVA 4V1DC 1B7DA 1SNBA 1T0ZA 1VNAA 1GPTA 2GL1A 2NY8X 4UJ0A 1I6GA 2E3FA 3E7UX 1P0AA 1B3CA 2N2RA 2LR3A 2B3CA 1ZU3A 1MYNA 2YC1C 2YEOA 5KK4A 1FH3A 1PE4A 2KJAA 1NH5A 2KYQA 1BK8A 1CHZA 1DJTA 1BRZA 2LY6A 1ZUTA 2KBJA 1AYJA 1VNBA 1ZVGA 1TI5A 4HE7A
chains in the Genus database with same CATH superfamily
3L56A 2MZ0A 4UAEF 2LI7A 5FPEA 4KBOA 3R2VA 1YUWA 2KSKA 3KC6A 1ICAA 3LDQA 5AQTA 2N69A 3D2FB 3KOZA 1OMYA 1NGFA 5FPMA 2E8AA 5AQWA 1N4NA 5BPNA 1I6FA 1T7BA 1BMRA 2YILA 4AAZA 2KPYA 4HHFA 1NGCA 3FZFA 3KOXA 1LQHA 3KP1A 4UAFE 5FPDA 1QQOA 1QQNA 1LQIA 5AQYA 2SN3A 5AQSA 1JZBA 3CW4A 1ZYWA 2ASCA 1P00A 3ATVA 3KOYA 1I2UA 1PX9A 5AQJA 4FL9A 2E2FA 3M3ZA 1QQMA 3GL1A 4AB0A 1T1TA 2KBKA 1NGEA 3BK3C 3QMLA 1MR4A 3CQXA 1NE5A 1PTXA 1LQQA 5EXWA 3LDNA 5AQZA 5BN8A 2QWMA 1C56A 2E0HA 5F1XA 1OZZA 5AQVA 2A7TA 1WMTA 2VY6A 1BUPA 3A8YA 1WT7A 5AQMA 5EY4A 1JXCA 5EVZA 1T7EA 2YIOA 2KBHA 3KP0A 2K35A 5BPLA 1ATSA 3C7NB 1JZAA 5EX5A 2E88A 2M8BB 1S3XA 3QFUA 1T7AA 4AEIA 1AHOA 2N66A 2QWLA 2YBRC 4FSVA 2B68A 2QWPA 3LDLA 4CQKA 1NRBA 3GKUA 2LJMA 3PSMA 1NPIA 1DKGD 2BUPA 1I2VA 3D2FA 4H5RA 2LY5A 2YIPA 3SF4D 2E3GA 1JKZA 2ATBA 1C55A 2LT8A 1BA1A 5AQFA 1SN1A 3HSCA 2V7ZA 1ZVEA 1L4VA 3QFPA 1HPMA 2LKBA 5AQHA 1SN4A 2D56A 1KAXA 2LJ7A 2QWQA 1CN2A 2BRZA 2JDQD 2KGQA 2N2QA 2MBKA 3I33A 1BCGA 5AQRA 1NGDA 3GDQA 5CY0A 1NGBA 3KHWA 3L4IA 2I61A 3FZKA 5AQIA 1XRSB 1KAZA 2NY9X 5BN9A 1NGJA 3IUCA 1KV0A 3FZMA 3KOWA 3D2EB 5AQUA 1WWNA 4KYPA 1NGAA 3FZHA 1BA0A 1K8BA 3KVGA 1ZFUA 1SEGA 2LN8A 1ATRA 1NGIA 1NGGA 3E7RL 1DQ7A 1NRAA 1ZYVA 5AQXA 3LDOA 2MN5A 1B7DA 1SNBA 1T0ZA 3C7NA 1VNAA 4V1DC 5BPMA 5FPNA 5F2RA 5AQPA 5AQQA 1GPTA 1HX1A 2G2KA 2GL1A 4HWIA 2QWNA 2NY8X 4UJ0A 1HJOA 2QWOA 1I6GA 1GPSA 2E3FA 3E7UX 1P0AA 1B3CA 1NGHA 4H5NA 4IO8A 2N2RA 2LR3A 3QI7A 5AQKA 2B3CA 1ZU3A 4UADE 4GNIA 1MYNA 5F0XA 2YC1C 2YEOA 3FE1A 5KK4A 1FH3A 1PE4A 2QW9A 2KJAA 4H5WA 1NH5A 2KYQA 5AQGA 1BK8A 1CHZA 3ATUA 1DJTA 3AY9A 3FZLA 1BRZA 3L6QA 1KAYA 5AQOA 1UGLA 2LY6A 2KHOA 1ZUTA 2KBJA 1AYJA 2QWRA 5AR0A 3D2EA 3LDPA 4H5TA 5AQNA 2GMOA 1VNBA 1ZVGA 1POIA 1TI5A 2QXLA 4H5VA 3JXUA 5AQLA 4HE7A
chains in the Genus database with same CATH topology
2MZ0A 2LI7A 2KSKA 1ICAA 2N69A 1OMYA 1N4NA 1I6FA 1T7BA 1BMRA 4AAZA 2KPYA 4HHFA 1LQHA 1LQIA 2SN3A 1JZBA 1ZYWA 2ASCA 1P00A 1I2UA 1PX9A 4AB0A 1T1TA 2KBKA 1MR4A 1NE5A 1PTXA 1LQQA 1C56A 2E0HA 1OZZA 2A7TA 1WMTA 1WT7A 1JXCA 1T7EA 2KBHA 1JZAA 2M8BB 1T7AA 4AEIA 1AHOA 2N66A 2YBRC 4CQKA 2B68A 1I2VA 1NRBA 2LJMA 3PSMA 1NPIA 2LY5A 2E3GA 1JKZA 2ATBA 1C55A 2LT8A 1L4VA 1SN1A 1ZVEA 2LKBA 1SN4A 2LJ7A 1CN2A 2BRZA 2KGQA 2N2QA 1BCGA 5CY0A 2I61A 2NY9X 1KV0A 1WWNA 4KYPA 1ZFUA 1SEGA 3E7RL 1GPSA 1DQ7A 1NRAA 1ZYVA 4V1DC 1B7DA 1SNBA 1T0ZA 1VNAA 1GPTA 2GL1A 2NY8X 4UJ0A 1I6GA 2E3FA 3E7UX 1P0AA 1B3CA 2N2RA 2LR3A 2B3CA 1ZU3A 1MYNA 2YC1C 2YEOA 5KK4A 1FH3A 1PE4A 2KJAA 1NH5A 2KYQA 1BK8A 1CHZA 1DJTA 1BRZA 2LY6A 1ZUTA 2KBJA 1AYJA 1VNBA 1ZVGA 1TI5A 4HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MZ0 A;  2LI7 A;  2KSK A;  1ICA A;  2N69 A;  1OMY A;  1N4N A;  1I6F A;  1T7B A;  1BMR A;  4AAZ A;  2KPY A;  4HHF A;  1LQH A;  1LQI A;  2SN3 A;  1JZB A;  1ZYW A;  2ASC A;  1P00 A;  1I2U A;  1PX9 A;  4AB0 A;  1T1T A;  2KBK A;  1MR4 A;  1NE5 A;  1PTX A;  1LQQ A;  1C56 A;  2E0H A;  1OZZ A;  2A7T A;  1WMT A;  1WT7 A;  1JXC A;  1T7E A;  2KBH A;  1JZA A;  2M8B B;  1T7A A;  4AEI A;  1AHO A;  2N66 A;  2YBR C;  4CQK A;  2B68 A;  1I2V A;  1NRB A;  2LJM A;  3PSM A;  1NPI A;  2LY5 A;  2E3G A;  1JKZ A;  2ATB A;  1C55 A;  2LT8 A;  1L4V A;  1SN1 A;  1ZVE A;  2LKB A;  1SN4 A;  2LJ7 A;  1CN2 A;  2BRZ A;  2KGQ A;  2N2Q A;  1BCG A;  5CY0 A;  2I61 A;  2NY9 X;  1KV0 A;  1WWN A;  4KYP A;  1ZFU A;  1SEG A;  3E7R L;  1GPS A;  1DQ7 A;  1NRA A;  1ZYV A;  4V1D C;  1B7D A;  1SNB A;  1T0Z A;  1VNA A;  1GPT A;  2GL1 A;  2NY8 X;  4UJ0 A;  1I6G A;  2E3F A;  3E7U X;  1P0A A;  1B3C A;  2N2R A;  2LR3 A;  2B3C A;  1ZU3 A;  1MYN A;  2YC1 C;  2YEO A;  5KK4 A;  1FH3 A;  1PE4 A;  2KJA A;  1NH5 A;  2KYQ A;  1BK8 A;  1CHZ A;  1DJT A;  1BRZ A;  2LY6 A;  1ZUT A;  2KBJ A;  1AYJ A;  1VNB A;  1ZVG A;  1TI5 A;  4HE7 A; 
#chains in the Genus database with same CATH topology
 3L56 A;  2MZ0 A;  4UAE F;  2LI7 A;  5FPE A;  4KBO A;  3R2V A;  1YUW A;  2KSK A;  3KC6 A;  1ICA A;  3LDQ A;  5AQT A;  2N69 A;  3D2F B;  3KOZ A;  1OMY A;  1NGF A;  5FPM A;  2E8A A;  5AQW A;  1N4N A;  5BPN A;  1I6F A;  1T7B A;  1BMR A;  2YIL A;  4AAZ A;  2KPY A;  4HHF A;  1NGC A;  3FZF A;  3KOX A;  1LQH A;  3KP1 A;  4UAF E;  5FPD A;  1QQO A;  1QQN A;  1LQI A;  5AQY A;  2SN3 A;  5AQS A;  1JZB A;  3CW4 A;  1ZYW A;  2ASC A;  1P00 A;  3ATV A;  3KOY A;  1I2U A;  1PX9 A;  5AQJ A;  4FL9 A;  2E2F A;  3M3Z A;  1QQM A;  3GL1 A;  4AB0 A;  1T1T A;  2KBK A;  1NGE A;  3BK3 C;  3QML A;  1MR4 A;  3CQX A;  1NE5 A;  1PTX A;  1LQQ A;  5EXW A;  3LDN A;  5AQZ A;  5BN8 A;  2QWM A;  1C56 A;  2E0H A;  5F1X A;  1OZZ A;  5AQV A;  2A7T A;  1WMT A;  2VY6 A;  1BUP A;  3A8Y A;  1WT7 A;  5AQM A;  5EY4 A;  1JXC A;  5EVZ A;  1T7E A;  2YIO A;  2KBH A;  3KP0 A;  2K35 A;  5BPL A;  1ATS A;  3C7N B;  1JZA A;  5EX5 A;  2E88 A;  2M8B B;  1S3X A;  3QFU A;  1T7A A;  4AEI A;  1AHO A;  2N66 A;  2QWL A;  2YBR C;  4FSV A;  2B68 A;  2QWP A;  3LDL A;  4CQK A;  1NRB A;  3GKU A;  2LJM A;  3PSM A;  1NPI A;  1DKG D;  2BUP A;  1I2V A;  3D2F A;  4H5R A;  2LY5 A;  2YIP A;  3SF4 D;  2E3G A;  1JKZ A;  2ATB A;  1C55 A;  2LT8 A;  1BA1 A;  5AQF A;  1SN1 A;  3HSC A;  2V7Z A;  1ZVE A;  1L4V A;  3QFP A;  1HPM A;  2LKB A;  5AQH A;  1SN4 A;  2D56 A;  1KAX A;  2LJ7 A;  2QWQ A;  1CN2 A;  2BRZ A;  2JDQ D;  2KGQ A;  2N2Q A;  2MBK A;  3I33 A;  1BCG A;  5AQR A;  1NGD A;  3GDQ A;  5CY0 A;  1NGB A;  3KHW A;  3L4I A;  2I61 A;  3FZK A;  5AQI A;  1XRS B;  1KAZ A;  2NY9 X;  5BN9 A;  1NGJ A;  3IUC A;  1KV0 A;  3FZM A;  3KOW A;  3D2E B;  5AQU A;  1WWN A;  4KYP A;  1NGA A;  3FZH A;  1BA0 A;  1K8B A;  3KVG A;  1ZFU A;  1SEG A;  2LN8 A;  1ATR A;  1NGI A;  1NGG A;  3E7R L;  1DQ7 A;  1NRA A;  1ZYV A;  5AQX A;  3LDO A;  2MN5 A;  1B7D A;  1SNB A;  1T0Z A;  3C7N A;  1VNA A;  4V1D C;  5BPM A;  5FPN A;  5F2R A;  5AQP A;  5AQQ A;  1GPT A;  1HX1 A;  2G2K A;  2GL1 A;  4HWI A;  2QWN A;  2NY8 X;  4UJ0 A;  1HJO A;  2QWO A;  1I6G A;  1GPS A;  2E3F A;  3E7U X;  1P0A A;  1B3C A;  1NGH A;  4H5N A;  4IO8 A;  2N2R A;  2LR3 A;  3QI7 A;  5AQK A;  2B3C A;  1ZU3 A;  4UAD E;  4GNI A;  1MYN A;  5F0X A;  2YC1 C;  2YEO A;  3FE1 A;  5KK4 A;  1FH3 A;  1PE4 A;  2QW9 A;  2KJA A;  4H5W A;  1NH5 A;  2KYQ A;  5AQG A;  1BK8 A;  1CHZ A;  3ATU A;  1DJT A;  3AY9 A;  3FZL A;  1BRZ A;  3L6Q A;  1KAY A;  5AQO A;  1UGL A;  2LY6 A;  2KHO A;  1ZUT A;  2KBJ A;  1AYJ A;  2QWR A;  5AR0 A;  3D2E A;  3LDP A;  4H5T A;  5AQN A;  2GMO A;  1VNB A;  1ZVG A;  1POI A;  1TI5 A;  2QXL A;  4H5V A;  3JXU A;  5AQL A;  4HE7 A; 
#chains in the Genus database with same CATH homology
 2MZ0 A;  2LI7 A;  2KSK A;  1ICA A;  2N69 A;  1OMY A;  1N4N A;  1I6F A;  1T7B A;  1BMR A;  4AAZ A;  2KPY A;  4HHF A;  1LQH A;  1LQI A;  2SN3 A;  1JZB A;  1ZYW A;  2ASC A;  1P00 A;  1I2U A;  1PX9 A;  4AB0 A;  1T1T A;  2KBK A;  1MR4 A;  1NE5 A;  1PTX A;  1LQQ A;  1C56 A;  2E0H A;  1OZZ A;  2A7T A;  1WMT A;  1WT7 A;  1JXC A;  1T7E A;  2KBH A;  1JZA A;  2M8B B;  1T7A A;  4AEI A;  1AHO A;  2N66 A;  2YBR C;  4CQK A;  2B68 A;  1I2V A;  1NRB A;  2LJM A;  3PSM A;  1NPI A;  2LY5 A;  2E3G A;  1JKZ A;  2ATB A;  1C55 A;  2LT8 A;  1L4V A;  1SN1 A;  1ZVE A;  2LKB A;  1SN4 A;  2LJ7 A;  1CN2 A;  2BRZ A;  2KGQ A;  2N2Q A;  1BCG A;  5CY0 A;  2I61 A;  2NY9 X;  1KV0 A;  1WWN A;  4KYP A;  1ZFU A;  1SEG A;  3E7R L;  1GPS A;  1DQ7 A;  1NRA A;  1ZYV A;  4V1D C;  1B7D A;  1SNB A;  1T0Z A;  1VNA A;  1GPT A;  2GL1 A;  2NY8 X;  4UJ0 A;  1I6G A;  2E3F A;  3E7U X;  1P0A A;  1B3C A;  2N2R A;  2LR3 A;  2B3C A;  1ZU3 A;  1MYN A;  2YC1 C;  2YEO A;  5KK4 A;  1FH3 A;  1PE4 A;  2KJA A;  1NH5 A;  2KYQ A;  1BK8 A;  1CHZ A;  1DJT A;  1BRZ A;  2LY6 A;  1ZUT A;  2KBJ A;  1AYJ A;  1VNB A;  1ZVG A;  1TI5 A;  4HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...