1GPTA

Solution structure of gamma 1-h and gamma 1-p thionins from barley and wheat endosperm determined by 1h-nmr: a structural motif common to toxic arthropod proteins
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
47
structure length
47
Chain Sequence
RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-1-H THIONIN
publication title Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Plant toxin
total genus 15
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1992-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1gptA00
1WMTA 1SN1A 4CQKA 1I6GA 1SN4A 1CN2A 2KBJA 1B3CA 2N2QA 1JZBA 2N66A 4AB0A 1JZAA 4V1DC 1PX9A 1T7BA 4AAZA 1DJTA 1I2UA 1KV0A 4HE7A 1WWNA 4KYPA 1P0AA 1ZUTA 2SN3A 1T7EA 2LJMA 1SEGA 1MYNA 2A7TA 4AEIA 2KBKA 1CHZA 4HHFA 1LQQA 1N4NA 1I6FA 1WT7A 2ASCA 1NPIA 1AHOA 1PTXA 1NRBA 1C55A 3PSMA 1NE5A 2ATBA 1JKZA 2N69A 2I61A 2LI7A 2B3CA 2YEOA 2KGQA 1BK8A 1TI5A 1FH3A 2BRZA 1T0ZA 2MZ0A 2E0HA 1ZU3A 2LY5A 5CY0A 2LKBA 1GPSA 2KJAA 2YC1C 1ICAA 5KK4A 1L4VA 1VNBA 1NRAA 1DQ7A 1PE4A 1ZYWA 3E7UX 2LY6A 1P00A 2KBHA 1I2VA 2YBRC 2N2RA 1GPTA 2NY8X 1ZFUA 1AYJA 1MR4A 1ZYVA 4UJ0A 1OMYA 1OZZA 1ZVEA 1BMRA 2E3GA 2KPYA 2E3FA 2LR3A 1SNBA 2NY9X 2KSKA 1VNAA 2GL1A 1BRZA 1LQHA 2LJ7A 1T1TA 1T7AA 1NH5A 1C56A 1B7DA 1JXCA 2M8BB 2LT8A 3E7RL 1LQIA 1BCGA 1ZVGA 2B68A 2KYQA
chains in the Genus database with same CATH superfamily
3FZFA 2MN5A 1WMTA 3LDOA 1SN1A 1BA0A 5AQOA 3LDNA 2KHOA 2G2KA 4CQKA 1I6GA 1SN4A 3LDPA 2KBJA 1CN2A 3ATUA 4UAFE 1B3CA 4H5TA 2N2QA 5F1XA 5FPEA 5BN9A 1JZBA 1BA1A 2KYQA 2N66A 4AB0A 1JZAA 4V1DC 1PX9A 1T7BA 4KBOA 4AAZA 1DJTA 1I2UA 1KV0A 4HE7A 3KC6A 2QXLA 2GMOA 3KOZA 5F0XA 1WWNA 4KYPA 5AQPA 5AQHA 5FPDA 4FSVA 1P0AA 3IUCA 3LDQA 1ZUTA 3I33A 3SF4D 2SN3A 2QWMA 3KOYA 1T7EA 3AY9A 3QFPA 2LJMA 3D2EA 1SEGA 2QW9A 1MYNA 2A7TA 3KHWA 2YIPA 3KOXA 4AEIA 2KBKA 2QWNA 3GKUA 1ATSA 1CHZA 3QFUA 4HHFA 2VY6A 1LQQA 2K35A 5AQRA 4GNIA 1N4NA 5BPLA 3KOWA 5FPMA 3L4IA 5EXWA 5AQNA 5AQKA 1I6FA 1POIA 5EX5A 1WT7A 2ASCA 4HWIA 1NPIA 1AHOA 1PTXA 4UADE 1ATRA 1NRBA 4H5RA 4IO8A 3HSCA 5AQSA 3A8YA 3PSMA 1NE5A 5AQLA 5EVZA 1C55A 2ATBA 1JKZA 2N69A 5BPMA 2I61A 2LI7A 2B3CA 3D2FB 1XRSB 1KAXA 4H5VA 5FPNA 2YEOA 1AYJA 1K8BA 1QQMA 2KGQA 3GDQA 1BK8A 5AQUA 3LDLA 2YILA 4H5WA 1TI5A 3FZLA 5AQTA 1FH3A 2BRZA 1T0ZA 2MZ0A 1NGAA 3FZMA 5F2RA 3GL1A 2JDQD 3BK3C 3FZHA 1UGLA 1BUPA 2E0HA 1NGBA 4H5NA 5AQZA 5AQIA 4UAEF 1ZU3A 2MBKA 2LY5A 2QWPA 5EY4A 5AQVA 5CY0A 2LKBA 1GPSA 5AQMA 2KJAA 2YC1C 3FZKA 1NGCA 1ICAA 3L56A 5KK4A 1L4VA 1VNBA 1NRAA 1DQ7A 1NGIA 1PE4A 1NGFA 1ZYWA 3E7UX 2LY6A 1P00A 2KBHA 1I2VA 1HJOA 2YBRC 2N2RA 1GPTA 5AQYA 2NY8X 1ZFUA 2E2FA 5BPNA 1KAYA 2E8AA 2QWLA 1MR4A 1NGGA 3FE1A 1ZYVA 5AQFA 2QWRA 5AQQA 1NGHA 1OMYA 5AQXA 4UJ0A 1QQOA 1OZZA 1ZVEA 3CW4A 3D2FA 1BMRA 2E3GA 2KPYA 2E3FA 3KVGA 1NGJA 1KAZA 2YIOA 5AR0A 2LR3A 1SNBA 2NY9X 2KSKA 1VNAA 2GL1A 2QWQA 3KP0A 3KP1A 5AQWA 1BRZA 1DKGD 1LQHA 3ATVA 5AQGA 3D2EB 2BUPA 2LJ7A 2D56A 1S3XA 1T1TA 2V7ZA 5AQJA 1HX1A 1NGDA 1T7AA 3C7NB 2QWOA 3CQXA 2E88A 3JXUA 1HPMA 3QI7A 4FL9A 1NH5A 1C56A 3M3ZA 3R2VA 3QMLA 1B7DA 1JXCA 2M8BB 3L6QA 2LT8A 3E7RL 1LQIA 1BCGA 1YUWA 2LN8A 1ZVGA 2B68A 1NGEA 1QQNA 3C7NA 5BN8A
chains in the Genus database with same CATH topology
1WMTA 1SN1A 4CQKA 1I6GA 1SN4A 1CN2A 2KBJA 1B3CA 2N2QA 1JZBA 2N66A 4AB0A 1JZAA 4V1DC 1PX9A 1T7BA 4AAZA 1DJTA 1I2UA 1KV0A 4HE7A 1WWNA 4KYPA 1P0AA 1ZUTA 2SN3A 1T7EA 2LJMA 1SEGA 1MYNA 2A7TA 4AEIA 2KBKA 1CHZA 4HHFA 1LQQA 1N4NA 1I6FA 1WT7A 2ASCA 1NPIA 1AHOA 1PTXA 1NRBA 1C55A 3PSMA 1NE5A 2ATBA 1JKZA 2N69A 2I61A 2LI7A 2B3CA 2YEOA 2KGQA 1BK8A 1TI5A 1FH3A 2BRZA 1T0ZA 2MZ0A 2E0HA 1ZU3A 2LY5A 5CY0A 2LKBA 1GPSA 2KJAA 2YC1C 1ICAA 5KK4A 1L4VA 1VNBA 1NRAA 1DQ7A 1PE4A 1ZYWA 3E7UX 2LY6A 1P00A 2KBHA 1I2VA 2YBRC 2N2RA 1GPTA 2NY8X 1ZFUA 1AYJA 1MR4A 1ZYVA 4UJ0A 1OMYA 1OZZA 1ZVEA 1BMRA 2E3GA 2KPYA 2E3FA 2LR3A 1SNBA 2NY9X 2KSKA 1VNAA 2GL1A 1BRZA 1LQHA 2LJ7A 1T1TA 1T7AA 1NH5A 1C56A 1B7DA 1JXCA 2M8BB 2LT8A 3E7RL 1LQIA 1BCGA 1ZVGA 2B68A 2KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMT A;  1SN1 A;  4CQK A;  1I6G A;  1SN4 A;  1CN2 A;  2KBJ A;  1B3C A;  2N2Q A;  1JZB A;  2N66 A;  4AB0 A;  1JZA A;  4V1D C;  1PX9 A;  1T7B A;  4AAZ A;  1DJT A;  1I2U A;  1KV0 A;  4HE7 A;  1WWN A;  4KYP A;  1P0A A;  1ZUT A;  2SN3 A;  1T7E A;  2LJM A;  1SEG A;  1MYN A;  2A7T A;  4AEI A;  2KBK A;  1CHZ A;  4HHF A;  1LQQ A;  1N4N A;  1I6F A;  1WT7 A;  2ASC A;  1NPI A;  1AHO A;  1PTX A;  1NRB A;  1C55 A;  3PSM A;  1NE5 A;  2ATB A;  1JKZ A;  2N69 A;  2I61 A;  2LI7 A;  2B3C A;  2YEO A;  2KGQ A;  1BK8 A;  1TI5 A;  1FH3 A;  2BRZ A;  1T0Z A;  2MZ0 A;  2E0H A;  1ZU3 A;  2LY5 A;  5CY0 A;  2LKB A;  1GPS A;  2KJA A;  2YC1 C;  1ICA A;  5KK4 A;  1L4V A;  1VNB A;  1NRA A;  1DQ7 A;  1PE4 A;  1ZYW A;  3E7U X;  2LY6 A;  1P00 A;  2KBH A;  1I2V A;  2YBR C;  2N2R A;  1GPT A;  2NY8 X;  1ZFU A;  1AYJ A;  1MR4 A;  1ZYV A;  4UJ0 A;  1OMY A;  1OZZ A;  1ZVE A;  1BMR A;  2E3G A;  2KPY A;  2E3F A;  2LR3 A;  1SNB A;  2NY9 X;  2KSK A;  1VNA A;  2GL1 A;  1BRZ A;  1LQH A;  2LJ7 A;  1T1T A;  1T7A A;  1NH5 A;  1C56 A;  1B7D A;  1JXC A;  2M8B B;  2LT8 A;  3E7R L;  1LQI A;  1BCG A;  1ZVG A;  2B68 A;  2KYQ A; 
#chains in the Genus database with same CATH topology
 3FZF A;  2MN5 A;  1WMT A;  3LDO A;  1SN1 A;  1BA0 A;  5AQO A;  3LDN A;  2KHO A;  2G2K A;  4CQK A;  1I6G A;  1SN4 A;  3LDP A;  2KBJ A;  1CN2 A;  3ATU A;  4UAF E;  1B3C A;  4H5T A;  2N2Q A;  5F1X A;  5FPE A;  5BN9 A;  1JZB A;  1BA1 A;  2KYQ A;  2N66 A;  4AB0 A;  1JZA A;  4V1D C;  1PX9 A;  1T7B A;  4KBO A;  4AAZ A;  1DJT A;  1I2U A;  1KV0 A;  4HE7 A;  3KC6 A;  2QXL A;  2GMO A;  3KOZ A;  5F0X A;  1WWN A;  4KYP A;  5AQP A;  5AQH A;  5FPD A;  4FSV A;  1P0A A;  3IUC A;  3LDQ A;  1ZUT A;  3I33 A;  3SF4 D;  2SN3 A;  2QWM A;  3KOY A;  1T7E A;  3AY9 A;  3QFP A;  2LJM A;  3D2E A;  1SEG A;  2QW9 A;  1MYN A;  2A7T A;  3KHW A;  2YIP A;  3KOX A;  4AEI A;  2KBK A;  2QWN A;  3GKU A;  1ATS A;  1CHZ A;  3QFU A;  4HHF A;  2VY6 A;  1LQQ A;  2K35 A;  5AQR A;  4GNI A;  1N4N A;  5BPL A;  3KOW A;  5FPM A;  3L4I A;  5EXW A;  5AQN A;  5AQK A;  1I6F A;  1POI A;  5EX5 A;  1WT7 A;  2ASC A;  4HWI A;  1NPI A;  1AHO A;  1PTX A;  4UAD E;  1ATR A;  1NRB A;  4H5R A;  4IO8 A;  3HSC A;  5AQS A;  3A8Y A;  3PSM A;  1NE5 A;  5AQL A;  5EVZ A;  1C55 A;  2ATB A;  1JKZ A;  2N69 A;  5BPM A;  2I61 A;  2LI7 A;  2B3C A;  3D2F B;  1XRS B;  1KAX A;  4H5V A;  5FPN A;  2YEO A;  1AYJ A;  1K8B A;  1QQM A;  2KGQ A;  3GDQ A;  1BK8 A;  5AQU A;  3LDL A;  2YIL A;  4H5W A;  1TI5 A;  3FZL A;  5AQT A;  1FH3 A;  2BRZ A;  1T0Z A;  2MZ0 A;  1NGA A;  3FZM A;  5F2R A;  3GL1 A;  2JDQ D;  3BK3 C;  3FZH A;  1UGL A;  1BUP A;  2E0H A;  1NGB A;  4H5N A;  5AQZ A;  5AQI A;  4UAE F;  1ZU3 A;  2MBK A;  2LY5 A;  2QWP A;  5EY4 A;  5AQV A;  5CY0 A;  2LKB A;  1GPS A;  5AQM A;  2KJA A;  2YC1 C;  3FZK A;  1NGC A;  1ICA A;  3L56 A;  5KK4 A;  1L4V A;  1VNB A;  1NRA A;  1DQ7 A;  1NGI A;  1PE4 A;  1NGF A;  1ZYW A;  3E7U X;  2LY6 A;  1P00 A;  2KBH A;  1I2V A;  1HJO A;  2YBR C;  2N2R A;  1GPT A;  5AQY A;  2NY8 X;  1ZFU A;  2E2F A;  5BPN A;  1KAY A;  2E8A A;  2QWL A;  1MR4 A;  1NGG A;  3FE1 A;  1ZYV A;  5AQF A;  2QWR A;  5AQQ A;  1NGH A;  1OMY A;  5AQX A;  4UJ0 A;  1QQO A;  1OZZ A;  1ZVE A;  3CW4 A;  3D2F A;  1BMR A;  2E3G A;  2KPY A;  2E3F A;  3KVG A;  1NGJ A;  1KAZ A;  2YIO A;  5AR0 A;  2LR3 A;  1SNB A;  2NY9 X;  2KSK A;  1VNA A;  2GL1 A;  2QWQ A;  3KP0 A;  3KP1 A;  5AQW A;  1BRZ A;  1DKG D;  1LQH A;  3ATV A;  5AQG A;  3D2E B;  2BUP A;  2LJ7 A;  2D56 A;  1S3X A;  1T1T A;  2V7Z A;  5AQJ A;  1HX1 A;  1NGD A;  1T7A A;  3C7N B;  2QWO A;  3CQX A;  2E88 A;  3JXU A;  1HPM A;  3QI7 A;  4FL9 A;  1NH5 A;  1C56 A;  3M3Z A;  3R2V A;  3QML A;  1B7D A;  1JXC A;  2M8B B;  3L6Q A;  2LT8 A;  3E7R L;  1LQI A;  1BCG A;  1YUW A;  2LN8 A;  1ZVG A;  2B68 A;  1NGE A;  1QQN A;  3C7N A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 1WMT A;  1SN1 A;  4CQK A;  1I6G A;  1SN4 A;  1CN2 A;  2KBJ A;  1B3C A;  2N2Q A;  1JZB A;  2N66 A;  4AB0 A;  1JZA A;  4V1D C;  1PX9 A;  1T7B A;  4AAZ A;  1DJT A;  1I2U A;  1KV0 A;  4HE7 A;  1WWN A;  4KYP A;  1P0A A;  1ZUT A;  2SN3 A;  1T7E A;  2LJM A;  1SEG A;  1MYN A;  2A7T A;  4AEI A;  2KBK A;  1CHZ A;  4HHF A;  1LQQ A;  1N4N A;  1I6F A;  1WT7 A;  2ASC A;  1NPI A;  1AHO A;  1PTX A;  1NRB A;  1C55 A;  3PSM A;  1NE5 A;  2ATB A;  1JKZ A;  2N69 A;  2I61 A;  2LI7 A;  2B3C A;  2YEO A;  2KGQ A;  1BK8 A;  1TI5 A;  1FH3 A;  2BRZ A;  1T0Z A;  2MZ0 A;  2E0H A;  1ZU3 A;  2LY5 A;  5CY0 A;  2LKB A;  1GPS A;  2KJA A;  2YC1 C;  1ICA A;  5KK4 A;  1L4V A;  1VNB A;  1NRA A;  1DQ7 A;  1PE4 A;  1ZYW A;  3E7U X;  2LY6 A;  1P00 A;  2KBH A;  1I2V A;  2YBR C;  2N2R A;  1GPT A;  2NY8 X;  1ZFU A;  1AYJ A;  1MR4 A;  1ZYV A;  4UJ0 A;  1OMY A;  1OZZ A;  1ZVE A;  1BMR A;  2E3G A;  2KPY A;  2E3F A;  2LR3 A;  1SNB A;  2NY9 X;  2KSK A;  1VNA A;  2GL1 A;  1BRZ A;  1LQH A;  2LJ7 A;  1T1T A;  1T7A A;  1NH5 A;  1C56 A;  1B7D A;  1JXC A;  2M8B B;  2LT8 A;  3E7R L;  1LQI A;  1BCG A;  1ZVG A;  2B68 A;  2KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...