1ZYWA

Crystal structure of mutant k8dp9sr58kp60g of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIKVGGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zywA00
1SN4A 1I2VA 1VNAA 4KYPA 1TI5A 1NH5A 2NY8X 2KGQA 2KJAA 1DJTA 2N2QA 4AAZA 1GPTA 2NY9X 1NE5A 1JXCA 1JKZA 1ZYWA 2BRZA 1JZAA 1WMTA 2LKBA 1T7EA 3PSMA 2B3CA 2GL1A 1JZBA 2N66A 2E0HA 5CY0A 2I61A 1N4NA 1OZZA 2KYQA 2LR3A 2LJ7A 1BK8A 2E3GA 1FH3A 1P0AA 4CQKA 1BRZA 3E7UX 1P00A 1NRAA 1DQ7A 1KV0A 1LQQA 2KPYA 2LY6A 3E7RL 4HE7A 1C55A 1MR4A 1ZVEA 1SN1A 1T0ZA 1WT7A 1PX9A 1I6FA 1B3CA 2KBKA 1SEGA 1WWNA 1LQIA 2SN3A 1NRBA 2ASCA 2LJMA 2M8BB 1NPIA 1PE4A 4V1DC 2N2RA 1ICAA 2MZ0A 1BCGA 1SNBA 5KK4A 1AHOA 1C56A 4HHFA 1I2UA 1B7DA 1MYNA 1AYJA 2LI7A 2LY5A 1T1TA 2KSKA 1L4VA 2KBJA 1ZUTA 1ZYVA 1ZU3A 1ZFUA 1CHZA 1OMYA 2LT8A 2YBRC 2E3FA 1VNBA 1CN2A 2YC1C 1BMRA 1PTXA 2YEOA 2A7TA 1LQHA 1I6GA 4UJ0A 4AB0A 2ATBA 4AEIA 1T7AA 2KBHA 1ZVGA 2B68A 1GPSA 2N69A 1T7BA
chains in the Genus database with same CATH superfamily
1SN4A 1NGIA 2D56A 5BN9A 1I2VA 3AY9A 1VNAA 3HSCA 1TI5A 1NH5A 4KYPA 5AQPA 2NY8X 5AQJA 2KGQA 2KJAA 1DJTA 2N2QA 3L6QA 4AAZA 1GPTA 4H5TA 2NY9X 1NGFA 1K8BA 1NE5A 1JXCA 3GKUA 4FL9A 1DKGD 3QFPA 5EVZA 1NGEA 2V7ZA 5BPNA 1JKZA 3QI7A 4H5NA 5FPEA 2QWMA 3KVGA 1NGCA 4UADE 5AQFA 4H5VA 1ZYWA 5AQNA 3KOZA 2K35A 4IO8A 5EX5A 5AQHA 3LDQA 5AQYA 2BRZA 3I33A 5AQUA 3IUCA 3QMLA 5AQOA 1JZAA 5AQZA 1WMTA 2LKBA 1T7EA 3PSMA 1JZBA 2B3CA 2GL1A 2JDQD 2N66A 2E0HA 1YUWA 3FZLA 5AQRA 5CY0A 2MN5A 5AQGA 5AQIA 2I61A 2YIPA 1N4NA 1OZZA 2KYQA 1NGHA 2LJ7A 2LR3A 1BK8A 3ATUA 2E3GA 3KP0A 1FH3A 1XRSB 2E2FA 1P0AA 5F2RA 4CQKA 4GNIA 5AQTA 3FE1A 1BRZA 3E7UX 3FZMA 1P00A 3KOXA 4H5RA 4FSVA 4UAFE 1NRAA 1DQ7A 1KV0A 1LQQA 2KPYA 2LY6A 3E7RL 3LDNA 3GL1A 4HE7A 5AQLA 1MR4A 1ATSA 1ZVEA 5AR0A 1C55A 1SN1A 2E8AA 1T0ZA 1WT7A 3BK3C 3KHWA 1PX9A 2YIOA 3C7NB 4HWIA 1BUPA 3FZKA 3M3ZA 2QWPA 1I6FA 2QXLA 1B3CA 3KP1A 3FZHA 1NGJA 1BA0A 2KBKA 1SEGA 1WWNA 1LQIA 3KOYA 1NGBA 2SN3A 2VY6A 5BPMA 1NRBA 2ASCA 2LJMA 2M8BB 1NPIA 5AQVA 1HJOA 5F0XA 1PE4A 4V1DC 3SF4D 1POIA 2MBKA 1HPMA 2N2RA 5EXWA 2MZ0A 1BCGA 5BPLA 1ICAA 3LDLA 1ATRA 4KBOA 5F1XA 3CW4A 1SNBA 5KK4A 1AHOA 1C56A 3GDQA 5AQWA 1UGLA 5BN8A 1NGAA 4UAEF 1S3XA 2QWOA 4HHFA 1I2UA 1B7DA 1MYNA 1AYJA 1KAZA 2LI7A 1QQOA 1NGDA 5AQXA 2KHOA 1KAXA 2QWNA 2LY5A 5AQSA 3D2EA 1T1TA 2KSKA 3D2FA 5AQMA 1L4VA 2YILA 1NGGA 5FPNA 5FPDA 2KBJA 1ZUTA 1ZYVA 3L56A 1ZU3A 5AQKA 1ZFUA 1CHZA 1OMYA 1QQNA 2LT8A 3LDPA 2YBRC 2E3FA 1VNBA 5FPMA 3LDOA 1CN2A 2GMOA 4H5WA 3QFUA 5EY4A 2YC1C 1BMRA 1PTXA 1QQMA 3A8YA 3KC6A 2YEOA 2A7TA 2QWLA 3KOWA 1LQHA 3ATVA 1HX1A 3L4IA 2LN8A 1I6GA 3JXUA 4UJ0A 4AB0A 2ATBA 4AEIA 1T7AA 2KBHA 2QWQA 1ZVGA 2B68A 1GPSA 3CQXA 1BA1A 3D2EB 1KAYA 3D2FB 2BUPA 3C7NA 3R2VA 2G2KA 3FZFA 2N69A 2QWRA 1T7BA 2QW9A 2E88A 5AQQA
chains in the Genus database with same CATH topology
1SN4A 1I2VA 1VNAA 4KYPA 1TI5A 1NH5A 2NY8X 2KGQA 2KJAA 1DJTA 2N2QA 4AAZA 1GPTA 2NY9X 1NE5A 1JXCA 1JKZA 1ZYWA 2BRZA 1JZAA 1WMTA 2LKBA 1T7EA 3PSMA 2B3CA 2GL1A 1JZBA 2N66A 2E0HA 5CY0A 2I61A 1N4NA 1OZZA 2KYQA 2LR3A 2LJ7A 1BK8A 2E3GA 1FH3A 1P0AA 4CQKA 1BRZA 3E7UX 1P00A 1NRAA 1DQ7A 1KV0A 1LQQA 2KPYA 2LY6A 3E7RL 4HE7A 1C55A 1MR4A 1ZVEA 1SN1A 1T0ZA 1WT7A 1PX9A 1I6FA 1B3CA 2KBKA 1SEGA 1WWNA 1LQIA 2SN3A 1NRBA 2ASCA 2LJMA 2M8BB 1NPIA 1PE4A 4V1DC 2N2RA 1ICAA 2MZ0A 1BCGA 1SNBA 5KK4A 1AHOA 1C56A 4HHFA 1I2UA 1B7DA 1MYNA 1AYJA 2LI7A 2LY5A 1T1TA 2KSKA 1L4VA 2KBJA 1ZUTA 1ZYVA 1ZU3A 1ZFUA 1CHZA 1OMYA 2LT8A 2YBRC 2E3FA 1VNBA 1CN2A 2YC1C 1BMRA 1PTXA 2YEOA 2A7TA 1LQHA 1I6GA 4UJ0A 4AB0A 2ATBA 4AEIA 1T7AA 2KBHA 1ZVGA 2B68A 1GPSA 2N69A 1T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN4 A;  1I2V A;  1VNA A;  4KYP A;  1TI5 A;  1NH5 A;  2NY8 X;  2KGQ A;  2KJA A;  1DJT A;  2N2Q A;  4AAZ A;  1GPT A;  2NY9 X;  1NE5 A;  1JXC A;  1JKZ A;  1ZYW A;  2BRZ A;  1JZA A;  1WMT A;  2LKB A;  1T7E A;  3PSM A;  2B3C A;  2GL1 A;  1JZB A;  2N66 A;  2E0H A;  5CY0 A;  2I61 A;  1N4N A;  1OZZ A;  2KYQ A;  2LR3 A;  2LJ7 A;  1BK8 A;  2E3G A;  1FH3 A;  1P0A A;  4CQK A;  1BRZ A;  3E7U X;  1P00 A;  1NRA A;  1DQ7 A;  1KV0 A;  1LQQ A;  2KPY A;  2LY6 A;  3E7R L;  4HE7 A;  1C55 A;  1MR4 A;  1ZVE A;  1SN1 A;  1T0Z A;  1WT7 A;  1PX9 A;  1I6F A;  1B3C A;  2KBK A;  1SEG A;  1WWN A;  1LQI A;  2SN3 A;  1NRB A;  2ASC A;  2LJM A;  2M8B B;  1NPI A;  1PE4 A;  4V1D C;  2N2R A;  1ICA A;  2MZ0 A;  1BCG A;  1SNB A;  5KK4 A;  1AHO A;  1C56 A;  4HHF A;  1I2U A;  1B7D A;  1MYN A;  1AYJ A;  2LI7 A;  2LY5 A;  1T1T A;  2KSK A;  1L4V A;  2KBJ A;  1ZUT A;  1ZYV A;  1ZU3 A;  1ZFU A;  1CHZ A;  1OMY A;  2LT8 A;  2YBR C;  2E3F A;  1VNB A;  1CN2 A;  2YC1 C;  1BMR A;  1PTX A;  2YEO A;  2A7T A;  1LQH A;  1I6G A;  4UJ0 A;  4AB0 A;  2ATB A;  4AEI A;  1T7A A;  2KBH A;  1ZVG A;  2B68 A;  1GPS A;  2N69 A;  1T7B A; 
#chains in the Genus database with same CATH topology
 1SN4 A;  1NGI A;  2D56 A;  5BN9 A;  1I2V A;  3AY9 A;  1VNA A;  3HSC A;  1TI5 A;  1NH5 A;  4KYP A;  5AQP A;  2NY8 X;  5AQJ A;  2KGQ A;  2KJA A;  1DJT A;  2N2Q A;  3L6Q A;  4AAZ A;  1GPT A;  4H5T A;  2NY9 X;  1NGF A;  1K8B A;  1NE5 A;  1JXC A;  3GKU A;  4FL9 A;  1DKG D;  3QFP A;  5EVZ A;  1NGE A;  2V7Z A;  5BPN A;  1JKZ A;  3QI7 A;  4H5N A;  5FPE A;  2QWM A;  3KVG A;  1NGC A;  4UAD E;  5AQF A;  4H5V A;  1ZYW A;  5AQN A;  3KOZ A;  2K35 A;  4IO8 A;  5EX5 A;  5AQH A;  3LDQ A;  5AQY A;  2BRZ A;  3I33 A;  5AQU A;  3IUC A;  3QML A;  5AQO A;  1JZA A;  5AQZ A;  1WMT A;  2LKB A;  1T7E A;  3PSM A;  1JZB A;  2B3C A;  2GL1 A;  2JDQ D;  2N66 A;  2E0H A;  1YUW A;  3FZL A;  5AQR A;  5CY0 A;  2MN5 A;  5AQG A;  5AQI A;  2I61 A;  2YIP A;  1N4N A;  1OZZ A;  2KYQ A;  1NGH A;  2LJ7 A;  2LR3 A;  1BK8 A;  3ATU A;  2E3G A;  3KP0 A;  1FH3 A;  1XRS B;  2E2F A;  1P0A A;  5F2R A;  4CQK A;  4GNI A;  5AQT A;  3FE1 A;  1BRZ A;  3E7U X;  3FZM A;  1P00 A;  3KOX A;  4H5R A;  4FSV A;  4UAF E;  1NRA A;  1DQ7 A;  1KV0 A;  1LQQ A;  2KPY A;  2LY6 A;  3E7R L;  3LDN A;  3GL1 A;  4HE7 A;  5AQL A;  1MR4 A;  1ATS A;  1ZVE A;  5AR0 A;  1C55 A;  1SN1 A;  2E8A A;  1T0Z A;  1WT7 A;  3BK3 C;  3KHW A;  1PX9 A;  2YIO A;  3C7N B;  4HWI A;  1BUP A;  3FZK A;  3M3Z A;  2QWP A;  1I6F A;  2QXL A;  1B3C A;  3KP1 A;  3FZH A;  1NGJ A;  1BA0 A;  2KBK A;  1SEG A;  1WWN A;  1LQI A;  3KOY A;  1NGB A;  2SN3 A;  2VY6 A;  5BPM A;  1NRB A;  2ASC A;  2LJM A;  2M8B B;  1NPI A;  5AQV A;  1HJO A;  5F0X A;  1PE4 A;  4V1D C;  3SF4 D;  1POI A;  2MBK A;  1HPM A;  2N2R A;  5EXW A;  2MZ0 A;  1BCG A;  5BPL A;  1ICA A;  3LDL A;  1ATR A;  4KBO A;  5F1X A;  3CW4 A;  1SNB A;  5KK4 A;  1AHO A;  1C56 A;  3GDQ A;  5AQW A;  1UGL A;  5BN8 A;  1NGA A;  4UAE F;  1S3X A;  2QWO A;  4HHF A;  1I2U A;  1B7D A;  1MYN A;  1AYJ A;  1KAZ A;  2LI7 A;  1QQO A;  1NGD A;  5AQX A;  2KHO A;  1KAX A;  2QWN A;  2LY5 A;  5AQS A;  3D2E A;  1T1T A;  2KSK A;  3D2F A;  5AQM A;  1L4V A;  2YIL A;  1NGG A;  5FPN A;  5FPD A;  2KBJ A;  1ZUT A;  1ZYV A;  3L56 A;  1ZU3 A;  5AQK A;  1ZFU A;  1CHZ A;  1OMY A;  1QQN A;  2LT8 A;  3LDP A;  2YBR C;  2E3F A;  1VNB A;  5FPM A;  3LDO A;  1CN2 A;  2GMO A;  4H5W A;  3QFU A;  5EY4 A;  2YC1 C;  1BMR A;  1PTX A;  1QQM A;  3A8Y A;  3KC6 A;  2YEO A;  2A7T A;  2QWL A;  3KOW A;  1LQH A;  3ATV A;  1HX1 A;  3L4I A;  2LN8 A;  1I6G A;  3JXU A;  4UJ0 A;  4AB0 A;  2ATB A;  4AEI A;  1T7A A;  2KBH A;  2QWQ A;  1ZVG A;  2B68 A;  1GPS A;  3CQX A;  1BA1 A;  3D2E B;  1KAY A;  3D2F B;  2BUP A;  3C7N A;  3R2V A;  2G2K A;  3FZF A;  2N69 A;  2QWR A;  1T7B A;  2QW9 A;  2E88 A;  5AQQ A; 
#chains in the Genus database with same CATH homology
 1SN4 A;  1I2V A;  1VNA A;  4KYP A;  1TI5 A;  1NH5 A;  2NY8 X;  2KGQ A;  2KJA A;  1DJT A;  2N2Q A;  4AAZ A;  1GPT A;  2NY9 X;  1NE5 A;  1JXC A;  1JKZ A;  1ZYW A;  2BRZ A;  1JZA A;  1WMT A;  2LKB A;  1T7E A;  3PSM A;  2B3C A;  2GL1 A;  1JZB A;  2N66 A;  2E0H A;  5CY0 A;  2I61 A;  1N4N A;  1OZZ A;  2KYQ A;  2LR3 A;  2LJ7 A;  1BK8 A;  2E3G A;  1FH3 A;  1P0A A;  4CQK A;  1BRZ A;  3E7U X;  1P00 A;  1NRA A;  1DQ7 A;  1KV0 A;  1LQQ A;  2KPY A;  2LY6 A;  3E7R L;  4HE7 A;  1C55 A;  1MR4 A;  1ZVE A;  1SN1 A;  1T0Z A;  1WT7 A;  1PX9 A;  1I6F A;  1B3C A;  2KBK A;  1SEG A;  1WWN A;  1LQI A;  2SN3 A;  1NRB A;  2ASC A;  2LJM A;  2M8B B;  1NPI A;  1PE4 A;  4V1D C;  2N2R A;  1ICA A;  2MZ0 A;  1BCG A;  1SNB A;  5KK4 A;  1AHO A;  1C56 A;  4HHF A;  1I2U A;  1B7D A;  1MYN A;  1AYJ A;  2LI7 A;  2LY5 A;  1T1T A;  2KSK A;  1L4V A;  2KBJ A;  1ZUT A;  1ZYV A;  1ZU3 A;  1ZFU A;  1CHZ A;  1OMY A;  2LT8 A;  2YBR C;  2E3F A;  1VNB A;  1CN2 A;  2YC1 C;  1BMR A;  1PTX A;  2YEO A;  2A7T A;  1LQH A;  1I6G A;  4UJ0 A;  4AB0 A;  2ATB A;  4AEI A;  1T7A A;  2KBH A;  1ZVG A;  2B68 A;  1GPS A;  2N69 A;  1T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...