2ATBA

Triple mutant 8d9d10v of scorpion toxin lqh-alpha-it
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MVRDAYIADDVNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords neurotoxin alpha-IT
publication title X-ray structures of Lqh-alpha-IT and Lqh-alpha-IT8D9D10V mutant
rcsb
source organism Leiurus quinquestriatus
molecule tags Toxin
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2atbA00
2KBHA 2M8BB 1NE5A 2N2QA 1OMYA 1SEGA 1NRBA 2I61A 4AAZA 2MZ0A 4UJ0A 1VNBA 5KK4A 4KYPA 1DQ7A 2KBJA 4AEIA 1DJTA 1SN4A 1TI5A 2E3GA 1B3CA 2KYQA 1C55A 1I6GA 5CY0A 1T7BA 1FH3A 2KSKA 1GPTA 1NRAA 1C56A 1JXCA 2E0HA 1ZYWA 1ZYVA 1LQHA 2YC1C 1ICAA 1B7DA 1P0AA 2NY8X 2KPYA 1P00A 1AYJA 1KV0A 1BRZA 1PX9A 1GPSA 1JZBA 2A7TA 1I2UA 1ZU3A 2LI7A 1T0ZA 1NPIA 2BRZA 1T1TA 3E7UX 1BK8A 1MYNA 2LY5A 4HE7A 1WMTA 3PSMA 2NY9X 1MR4A 2N69A 1WWNA 1BMRA 1PTXA 2LR3A 1BCGA 2LY6A 2B68A 3E7RL 2KBKA 2ATBA 2N66A 1CN2A 4V1DC 1LQQA 1L4VA 2KGQA 1ZUTA 1OZZA 4AB0A 2SN3A 1JZAA 1LQIA 2GL1A 2LKBA 4CQKA 1NH5A 1ZVEA 2ASCA 1WT7A 1T7AA 2YBRC 1AHOA 1I2VA 2YEOA 1SNBA 1T7EA 1VNAA 1SN1A 2E3FA 1PE4A 1N4NA 1ZFUA 1JKZA 1CHZA 2KJAA 2LJMA 2LT8A 1ZVGA 1I6FA 2LJ7A 2B3CA 4HHFA 2N2RA
chains in the Genus database with same CATH superfamily
1K8BA 2KBHA 2M8BB 2MBKA 1NE5A 2E8AA 3JXUA 2N2QA 3KP1A 1OMYA 2D56A 1SEGA 1NRBA 5F2RA 2YIOA 1UGLA 2I61A 5AQVA 2QWQA 4AAZA 3CW4A 5AQGA 2MZ0A 5AQPA 3GL1A 4UJ0A 3L56A 5BPNA 1VNBA 3FZHA 5KK4A 3C7NA 3M3ZA 2G2KA 3A8YA 4KYPA 5AQTA 3CQXA 4GNIA 5FPNA 3ATVA 1DQ7A 4HWIA 1YUWA 2KBJA 5AQUA 3LDNA 4AEIA 5AR0A 1DJTA 1SN4A 1TI5A 2E3GA 1B3CA 1C55A 2E2FA 4H5NA 4UAEF 5AQLA 1I6GA 3BK3C 1KAZA 2QWNA 3FZFA 3KOZA 5EVZA 5EXWA 5CY0A 1T7BA 1FH3A 3FZKA 1NGFA 2KSKA 1GPTA 3FE1A 3D2FB 3SF4D 1NRAA 1C56A 3LDQA 3AY9A 1JXCA 2E0HA 1ZYWA 2JDQD 5AQQA 1BA1A 1ZYVA 1LQHA 2YC1C 1ICAA 3ATUA 1POIA 3KOXA 3QFUA 4H5TA 1B7DA 1HJOA 2K35A 1P0AA 2QWPA 2NY8X 2KPYA 1P00A 1AYJA 1KV0A 1BRZA 1ATSA 1QQMA 1PX9A 5FPEA 1GPSA 3KOYA 1HPMA 1JZBA 2A7TA 1I2UA 1ZU3A 4IO8A 2LI7A 3KVGA 1T0ZA 2V7ZA 3LDPA 5AQXA 1NPIA 2BRZA 3D2EA 3QMLA 5F0XA 1T1TA 2MN5A 3E7UX 1MYNA 1NGHA 2LY5A 1WMTA 4HE7A 1NGCA 3PSMA 5AQKA 3GDQA 4H5RA 2BUPA 2NY9X 1KAXA 5AQRA 1MR4A 1BUPA 2N69A 1WWNA 3FZMA 1NGDA 3KOWA 5AQHA 5BPMA 1BMRA 3C7NB 1PTXA 2GMOA 2LR3A 4FL9A 5AQWA 1BCGA 3QI7A 2QWRA 2LY6A 2B68A 3GKUA 3E7RL 2KBKA 5FPDA 1NGJA 4UADE 3I33A 5AQFA 2ATBA 2QWOA 1NGIA 5BN8A 2N66A 2QW9A 3QFPA 5EY4A 1BA0A 2E88A 1CN2A 3L6QA 1NGGA 4V1DC 3KHWA 3D2EB 1LQQA 3LDLA 4FSVA 1L4VA 1QQOA 1NGBA 5BN9A 3R2VA 2KGQA 1ZUTA 1OZZA 4AB0A 1S3XA 2SN3A 5AQNA 1JZAA 1BK8A 1LQIA 2YILA 1XRSB 2LN8A 4UAFE 1DKGD 3D2FA 2QWLA 4KBOA 5AQJA 5EX5A 1HX1A 2GL1A 3LDOA 2LKBA 5FPMA 2YIPA 1NH5A 4CQKA 1ZVEA 1KAYA 2ASCA 1WT7A 2QXLA 1T7AA 2YBRC 1AHOA 3KC6A 5BPLA 1I2VA 2QWMA 2YEOA 4H5VA 1NGAA 1SNBA 1T7EA 2LJ7A 3FZLA 3IUCA 3KP0A 4H5WA 5AQYA 1VNAA 1SN1A 2E3FA 2VY6A 3L4IA 5AQIA 5AQMA 5AQSA 1PE4A 1N4NA 1ZFUA 5AQOA 1JKZA 1CHZA 2KHOA 2KJAA 5F1XA 2LJMA 1QQNA 1ATRA 2LT8A 1NGEA 1ZVGA 3HSCA 1I6FA 2KYQA 2B3CA 4HHFA 2N2RA 5AQZA
chains in the Genus database with same CATH topology
2KBHA 2M8BB 1NE5A 2N2QA 1OMYA 1SEGA 1NRBA 2I61A 4AAZA 2MZ0A 4UJ0A 1VNBA 5KK4A 4KYPA 1DQ7A 2KBJA 4AEIA 1DJTA 1SN4A 1TI5A 2E3GA 1B3CA 2KYQA 1C55A 1I6GA 5CY0A 1T7BA 1FH3A 2KSKA 1GPTA 1NRAA 1C56A 1JXCA 2E0HA 1ZYWA 1ZYVA 1LQHA 2YC1C 1ICAA 1B7DA 1P0AA 2NY8X 2KPYA 1P00A 1AYJA 1KV0A 1BRZA 1PX9A 1GPSA 1JZBA 2A7TA 1I2UA 1ZU3A 2LI7A 1T0ZA 1NPIA 2BRZA 1T1TA 3E7UX 1BK8A 1MYNA 2LY5A 4HE7A 1WMTA 3PSMA 2NY9X 1MR4A 2N69A 1WWNA 1BMRA 1PTXA 2LR3A 1BCGA 2LY6A 2B68A 3E7RL 2KBKA 2ATBA 2N66A 1CN2A 4V1DC 1LQQA 1L4VA 2KGQA 1ZUTA 1OZZA 4AB0A 2SN3A 1JZAA 1LQIA 2GL1A 2LKBA 4CQKA 1NH5A 1ZVEA 2ASCA 1WT7A 1T7AA 2YBRC 1AHOA 1I2VA 2YEOA 1SNBA 1T7EA 1VNAA 1SN1A 2E3FA 1PE4A 1N4NA 1ZFUA 1JKZA 1CHZA 2KJAA 2LJMA 2LT8A 1ZVGA 1I6FA 2LJ7A 2B3CA 4HHFA 2N2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBH A;  2M8B B;  1NE5 A;  2N2Q A;  1OMY A;  1SEG A;  1NRB A;  2I61 A;  4AAZ A;  2MZ0 A;  4UJ0 A;  1VNB A;  5KK4 A;  4KYP A;  1DQ7 A;  2KBJ A;  4AEI A;  1DJT A;  1SN4 A;  1TI5 A;  2E3G A;  1B3C A;  2KYQ A;  1C55 A;  1I6G A;  5CY0 A;  1T7B A;  1FH3 A;  2KSK A;  1GPT A;  1NRA A;  1C56 A;  1JXC A;  2E0H A;  1ZYW A;  1ZYV A;  1LQH A;  2YC1 C;  1ICA A;  1B7D A;  1P0A A;  2NY8 X;  2KPY A;  1P00 A;  1AYJ A;  1KV0 A;  1BRZ A;  1PX9 A;  1GPS A;  1JZB A;  2A7T A;  1I2U A;  1ZU3 A;  2LI7 A;  1T0Z A;  1NPI A;  2BRZ A;  1T1T A;  3E7U X;  1BK8 A;  1MYN A;  2LY5 A;  4HE7 A;  1WMT A;  3PSM A;  2NY9 X;  1MR4 A;  2N69 A;  1WWN A;  1BMR A;  1PTX A;  2LR3 A;  1BCG A;  2LY6 A;  2B68 A;  3E7R L;  2KBK A;  2ATB A;  2N66 A;  1CN2 A;  4V1D C;  1LQQ A;  1L4V A;  2KGQ A;  1ZUT A;  1OZZ A;  4AB0 A;  2SN3 A;  1JZA A;  1LQI A;  2GL1 A;  2LKB A;  4CQK A;  1NH5 A;  1ZVE A;  2ASC A;  1WT7 A;  1T7A A;  2YBR C;  1AHO A;  1I2V A;  2YEO A;  1SNB A;  1T7E A;  1VNA A;  1SN1 A;  2E3F A;  1PE4 A;  1N4N A;  1ZFU A;  1JKZ A;  1CHZ A;  2KJA A;  2LJM A;  2LT8 A;  1ZVG A;  1I6F A;  2LJ7 A;  2B3C A;  4HHF A;  2N2R A; 
#chains in the Genus database with same CATH topology
 1K8B A;  2KBH A;  2M8B B;  2MBK A;  1NE5 A;  2E8A A;  3JXU A;  2N2Q A;  3KP1 A;  1OMY A;  2D56 A;  1SEG A;  1NRB A;  5F2R A;  2YIO A;  1UGL A;  2I61 A;  5AQV A;  2QWQ A;  4AAZ A;  3CW4 A;  5AQG A;  2MZ0 A;  5AQP A;  3GL1 A;  4UJ0 A;  3L56 A;  5BPN A;  1VNB A;  3FZH A;  5KK4 A;  3C7N A;  3M3Z A;  2G2K A;  3A8Y A;  4KYP A;  5AQT A;  3CQX A;  4GNI A;  5FPN A;  3ATV A;  1DQ7 A;  4HWI A;  1YUW A;  2KBJ A;  5AQU A;  3LDN A;  4AEI A;  5AR0 A;  1DJT A;  1SN4 A;  1TI5 A;  2E3G A;  1B3C A;  1C55 A;  2E2F A;  4H5N A;  4UAE F;  5AQL A;  1I6G A;  3BK3 C;  1KAZ A;  2QWN A;  3FZF A;  3KOZ A;  5EVZ A;  5EXW A;  5CY0 A;  1T7B A;  1FH3 A;  3FZK A;  1NGF A;  2KSK A;  1GPT A;  3FE1 A;  3D2F B;  3SF4 D;  1NRA A;  1C56 A;  3LDQ A;  3AY9 A;  1JXC A;  2E0H A;  1ZYW A;  2JDQ D;  5AQQ A;  1BA1 A;  1ZYV A;  1LQH A;  2YC1 C;  1ICA A;  3ATU A;  1POI A;  3KOX A;  3QFU A;  4H5T A;  1B7D A;  1HJO A;  2K35 A;  1P0A A;  2QWP A;  2NY8 X;  2KPY A;  1P00 A;  1AYJ A;  1KV0 A;  1BRZ A;  1ATS A;  1QQM A;  1PX9 A;  5FPE A;  1GPS A;  3KOY A;  1HPM A;  1JZB A;  2A7T A;  1I2U A;  1ZU3 A;  4IO8 A;  2LI7 A;  3KVG A;  1T0Z A;  2V7Z A;  3LDP A;  5AQX A;  1NPI A;  2BRZ A;  3D2E A;  3QML A;  5F0X A;  1T1T A;  2MN5 A;  3E7U X;  1MYN A;  1NGH A;  2LY5 A;  1WMT A;  4HE7 A;  1NGC A;  3PSM A;  5AQK A;  3GDQ A;  4H5R A;  2BUP A;  2NY9 X;  1KAX A;  5AQR A;  1MR4 A;  1BUP A;  2N69 A;  1WWN A;  3FZM A;  1NGD A;  3KOW A;  5AQH A;  5BPM A;  1BMR A;  3C7N B;  1PTX A;  2GMO A;  2LR3 A;  4FL9 A;  5AQW A;  1BCG A;  3QI7 A;  2QWR A;  2LY6 A;  2B68 A;  3GKU A;  3E7R L;  2KBK A;  5FPD A;  1NGJ A;  4UAD E;  3I33 A;  5AQF A;  2ATB A;  2QWO A;  1NGI A;  5BN8 A;  2N66 A;  2QW9 A;  3QFP A;  5EY4 A;  1BA0 A;  2E88 A;  1CN2 A;  3L6Q A;  1NGG A;  4V1D C;  3KHW A;  3D2E B;  1LQQ A;  3LDL A;  4FSV A;  1L4V A;  1QQO A;  1NGB A;  5BN9 A;  3R2V A;  2KGQ A;  1ZUT A;  1OZZ A;  4AB0 A;  1S3X A;  2SN3 A;  5AQN A;  1JZA A;  1BK8 A;  1LQI A;  2YIL A;  1XRS B;  2LN8 A;  4UAF E;  1DKG D;  3D2F A;  2QWL A;  4KBO A;  5AQJ A;  5EX5 A;  1HX1 A;  2GL1 A;  3LDO A;  2LKB A;  5FPM A;  2YIP A;  1NH5 A;  4CQK A;  1ZVE A;  1KAY A;  2ASC A;  1WT7 A;  2QXL A;  1T7A A;  2YBR C;  1AHO A;  3KC6 A;  5BPL A;  1I2V A;  2QWM A;  2YEO A;  4H5V A;  1NGA A;  1SNB A;  1T7E A;  2LJ7 A;  3FZL A;  3IUC A;  3KP0 A;  4H5W A;  5AQY A;  1VNA A;  1SN1 A;  2E3F A;  2VY6 A;  3L4I A;  5AQI A;  5AQM A;  5AQS A;  1PE4 A;  1N4N A;  1ZFU A;  5AQO A;  1JKZ A;  1CHZ A;  2KHO A;  2KJA A;  5F1X A;  2LJM A;  1QQN A;  1ATR A;  2LT8 A;  1NGE A;  1ZVG A;  3HSC A;  1I6F A;  2KYQ A;  2B3C A;  4HHF A;  2N2R A;  5AQZ A; 
#chains in the Genus database with same CATH homology
 2KBH A;  2M8B B;  1NE5 A;  2N2Q A;  1OMY A;  1SEG A;  1NRB A;  2I61 A;  4AAZ A;  2MZ0 A;  4UJ0 A;  1VNB A;  5KK4 A;  4KYP A;  1DQ7 A;  2KBJ A;  4AEI A;  1DJT A;  1SN4 A;  1TI5 A;  2E3G A;  1B3C A;  2KYQ A;  1C55 A;  1I6G A;  5CY0 A;  1T7B A;  1FH3 A;  2KSK A;  1GPT A;  1NRA A;  1C56 A;  1JXC A;  2E0H A;  1ZYW A;  1ZYV A;  1LQH A;  2YC1 C;  1ICA A;  1B7D A;  1P0A A;  2NY8 X;  2KPY A;  1P00 A;  1AYJ A;  1KV0 A;  1BRZ A;  1PX9 A;  1GPS A;  1JZB A;  2A7T A;  1I2U A;  1ZU3 A;  2LI7 A;  1T0Z A;  1NPI A;  2BRZ A;  1T1T A;  3E7U X;  1BK8 A;  1MYN A;  2LY5 A;  4HE7 A;  1WMT A;  3PSM A;  2NY9 X;  1MR4 A;  2N69 A;  1WWN A;  1BMR A;  1PTX A;  2LR3 A;  1BCG A;  2LY6 A;  2B68 A;  3E7R L;  2KBK A;  2ATB A;  2N66 A;  1CN2 A;  4V1D C;  1LQQ A;  1L4V A;  2KGQ A;  1ZUT A;  1OZZ A;  4AB0 A;  2SN3 A;  1JZA A;  1LQI A;  2GL1 A;  2LKB A;  4CQK A;  1NH5 A;  1ZVE A;  2ASC A;  1WT7 A;  1T7A A;  2YBR C;  1AHO A;  1I2V A;  2YEO A;  1SNB A;  1T7E A;  1VNA A;  1SN1 A;  2E3F A;  1PE4 A;  1N4N A;  1ZFU A;  1JKZ A;  1CHZ A;  2KJA A;  2LJM A;  2LT8 A;  1ZVG A;  1I6F A;  2LJ7 A;  2B3C A;  4HHF A;  2N2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...