2ATBA

Triple mutant 8d9d10v of scorpion toxin lqh-alpha-it
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MVRDAYIADDVNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords neurotoxin alpha-IT
publication title X-ray structures of Lqh-alpha-IT and Lqh-alpha-IT8D9D10V mutant
rcsb
source organism Leiurus quinquestriatus
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2atbA00
1AYJA 5KK4A 2I61A 2E3GA 2ASCA 4V1DC 1GPSA 4UJ0A 1ZU3A 2LY5A 2BRZA 1VNBA 2N2RA 1T7EA 1SN1A 2MZ0A 1P00A 1ZYWA 2B68A 4AAZA 2KYQA 1JKZA 1T1TA 2LJMA 1AHOA 1ZVEA 2LI7A 1PTXA 2LR3A 4AEIA 2KBJA 1NRAA 1I6FA 1GPTA 3E7UX 1I2VA 1FH3A 1ZFUA 1WMTA 1JZBA 1N4NA 1T7BA 1T7AA 2E0HA 2LKBA 2YBRC 2LT8A 2KGQA 1DJTA 2M8BB 2KBHA 2NY9X 2KPYA 1ZVGA 1MR4A 1C56A 1TI5A 2ATBA 4HE7A 3E7RL 1C55A 1BK8A 1I6GA 1DQ7A 1CN2A 2B3CA 1BCGA 2N2QA 1WT7A 1NH5A 2KSKA 1ZUTA 2YC1C 1BRZA 1SN4A 1SNBA 2N66A 1NRBA 1PX9A 3PSMA 1MYNA 1ZYVA 2SN3A 1T0ZA 1I2UA 2KBKA 1ICAA 2E3FA 1VNAA 2N69A 1JXCA 1NPIA 2YEOA 4KYPA 1B3CA 4CQKA 1CHZA 1PE4A 2NY8X 1SEGA 2GL1A 2LJ7A 1LQIA 2A7TA 2LY6A 1OZZA 1JZAA 1NE5A 5CY0A 1KV0A 1P0AA 1BMRA 1OMYA 2KJAA 4AB0A 1WWNA 1LQHA 1B7DA 1L4VA 1LQQA 4HHFA
chains in the Genus database with same CATH superfamily
1NGCA 3C7NB 3KOWA 5FPEA 1AYJA 5AQTA 1NGBA 5KK4A 2I61A 2V7ZA 2E3GA 2VY6A 2ASCA 5AQGA 5BPMA 3KP0A 5AQNA 2E2FA 3AY9A 5AQZA 2BUPA 4V1DC 5AQWA 3BK3C 1GPSA 2KHOA 4UJ0A 1NGFA 1ZU3A 3FZFA 2LY5A 2BRZA 1VNBA 2N2RA 4IO8A 1T7EA 5AQRA 5FPMA 5AQPA 1SN1A 3R2VA 3C7NA 2MZ0A 1P00A 1ZYWA 2B68A 2QWQA 5EXWA 4AAZA 5AQKA 2QW9A 2QWNA 5F2RA 1LQQA 2KYQA 1JKZA 1T1TA 1K8BA 2LJMA 5BPNA 1AHOA 3IUCA 5AQXA 5AQIA 4UAEF 1ZVEA 5AR0A 2LI7A 1NGGA 1NGDA 1PTXA 2LR3A 2QWRA 1BA0A 4H5VA 5AQMA 5BPLA 4AEIA 4H5NA 2E88A 2LN8A 4HWIA 2KBJA 1KAXA 1NRAA 2QWOA 1DKGD 1I6FA 4HHFA 3GDQA 1GPTA 3D2EA 3E7UX 1I2VA 5EX5A 2QXLA 3SF4D 1FH3A 5AQQA 1ZFUA 1KAYA 1WMTA 3KOXA 1JZBA 1N4NA 3LDLA 3D2FA 4FL9A 5F1XA 1T7BA 5AQLA 1T7AA 2E0HA 5FPDA 2LKBA 1QQMA 2YBRC 3LDNA 2LT8A 3GL1A 2YIPA 3KP1A 5AQSA 2KGQA 4H5WA 1DJTA 2M8BB 2KBHA 3LDQA 1QQNA 2NY9X 2MBKA 2KPYA 1ZVGA 3KHWA 1MR4A 1C56A 1TI5A 2ATBA 2GMOA 2QWMA 3FE1A 5BN8A 3ATVA 3FZHA 1BA1A 4HE7A 5FPNA 3E7RL 1HPMA 1C55A 1HJOA 5AQVA 5F0XA 1BK8A 1DQ7A 1CN2A 1I6GA 3QFPA 2B3CA 1BCGA 2N2QA 1WT7A 1NH5A 2KSKA 3HSCA 1ZUTA 2YC1C 1BRZA 1SN4A 3KC6A 1SNBA 2N66A 1NRBA 1NGHA 1PX9A 3QFUA 5AQFA 1BUPA 3PSMA 5AQUA 1ATRA 1MYNA 3FZLA 5AQHA 1QQOA 1NGIA 5AQOA 1ZYVA 2SN3A 1T0ZA 3M3ZA 3CW4A 1I2UA 2KBKA 1ICAA 3LDOA 2E3FA 5AQJA 3CQXA 1VNAA 2N69A 1JXCA 4GNIA 4UAFE 2JDQD 1NPIA 2YEOA 4KBOA 4KYPA 1B3CA 3QMLA 3ATUA 3KVGA 3GKUA 1NGJA 1NGEA 2YIOA 1S3XA 4CQKA 1CHZA 1ATSA 1PE4A 1YUWA 1SEGA 2NY8X 3L56A 3L4IA 5BN9A 2K35A 1HX1A 4H5RA 2GL1A 2YILA 5EVZA 2LJ7A 2QWLA 1LQIA 2E8AA 1NGAA 3FZKA 4H5TA 2A7TA 2LY6A 1OZZA 1JZAA 2QWPA 1KAZA 1NE5A 3L6QA 3KOZA 4FSVA 2G2KA 5AQYA 5CY0A 1KV0A 3D2EB 1P0AA 1BMRA 3KOYA 1OMYA 1UGLA 2MN5A 3A8YA 4UADE 5EY4A 1POIA 3JXUA 2KJAA 3QI7A 4AB0A 1WWNA 1LQHA 1B7DA 2D56A 3D2FB 3FZMA 1L4VA 1XRSB 3LDPA 3I33A
chains in the Genus database with same CATH topology
1AYJA 5KK4A 2I61A 2E3GA 2ASCA 4V1DC 1GPSA 4UJ0A 1ZU3A 2LY5A 2BRZA 1VNBA 2N2RA 1T7EA 1SN1A 2MZ0A 1P00A 1ZYWA 2B68A 4AAZA 2KYQA 1JKZA 1T1TA 2LJMA 1AHOA 1ZVEA 2LI7A 1PTXA 2LR3A 4AEIA 2KBJA 1NRAA 1I6FA 1GPTA 3E7UX 1I2VA 1FH3A 1ZFUA 1WMTA 1JZBA 1N4NA 1T7BA 1T7AA 2E0HA 2LKBA 2YBRC 2LT8A 2KGQA 1DJTA 2M8BB 2KBHA 2NY9X 2KPYA 1ZVGA 1MR4A 1C56A 1TI5A 2ATBA 4HE7A 3E7RL 1C55A 1BK8A 1I6GA 1DQ7A 1CN2A 2B3CA 1BCGA 2N2QA 1WT7A 1NH5A 2KSKA 1ZUTA 2YC1C 1BRZA 1SN4A 1SNBA 2N66A 1NRBA 1PX9A 3PSMA 1MYNA 1ZYVA 2SN3A 1T0ZA 1I2UA 2KBKA 1ICAA 2E3FA 1VNAA 2N69A 1JXCA 1NPIA 2YEOA 4KYPA 1B3CA 4CQKA 1CHZA 1PE4A 2NY8X 1SEGA 2GL1A 2LJ7A 1LQIA 2A7TA 2LY6A 1OZZA 1JZAA 1NE5A 5CY0A 1KV0A 1P0AA 1BMRA 1OMYA 2KJAA 4AB0A 1WWNA 1LQHA 1B7DA 1L4VA 1LQQA 4HHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYJ A;  5KK4 A;  2I61 A;  2E3G A;  2ASC A;  4V1D C;  1GPS A;  4UJ0 A;  1ZU3 A;  2LY5 A;  2BRZ A;  1VNB A;  2N2R A;  1T7E A;  1SN1 A;  2MZ0 A;  1P00 A;  1ZYW A;  2B68 A;  4AAZ A;  2KYQ A;  1JKZ A;  1T1T A;  2LJM A;  1AHO A;  1ZVE A;  2LI7 A;  1PTX A;  2LR3 A;  4AEI A;  2KBJ A;  1NRA A;  1I6F A;  1GPT A;  3E7U X;  1I2V A;  1FH3 A;  1ZFU A;  1WMT A;  1JZB A;  1N4N A;  1T7B A;  1T7A A;  2E0H A;  2LKB A;  2YBR C;  2LT8 A;  2KGQ A;  1DJT A;  2M8B B;  2KBH A;  2NY9 X;  2KPY A;  1ZVG A;  1MR4 A;  1C56 A;  1TI5 A;  2ATB A;  4HE7 A;  3E7R L;  1C55 A;  1BK8 A;  1I6G A;  1DQ7 A;  1CN2 A;  2B3C A;  1BCG A;  2N2Q A;  1WT7 A;  1NH5 A;  2KSK A;  1ZUT A;  2YC1 C;  1BRZ A;  1SN4 A;  1SNB A;  2N66 A;  1NRB A;  1PX9 A;  3PSM A;  1MYN A;  1ZYV A;  2SN3 A;  1T0Z A;  1I2U A;  2KBK A;  1ICA A;  2E3F A;  1VNA A;  2N69 A;  1JXC A;  1NPI A;  2YEO A;  4KYP A;  1B3C A;  4CQK A;  1CHZ A;  1PE4 A;  2NY8 X;  1SEG A;  2GL1 A;  2LJ7 A;  1LQI A;  2A7T A;  2LY6 A;  1OZZ A;  1JZA A;  1NE5 A;  5CY0 A;  1KV0 A;  1P0A A;  1BMR A;  1OMY A;  2KJA A;  4AB0 A;  1WWN A;  1LQH A;  1B7D A;  1L4V A;  1LQQ A;  4HHF A; 
#chains in the Genus database with same CATH topology
 1NGC A;  3C7N B;  3KOW A;  5FPE A;  1AYJ A;  5AQT A;  1NGB A;  5KK4 A;  2I61 A;  2V7Z A;  2E3G A;  2VY6 A;  2ASC A;  5AQG A;  5BPM A;  3KP0 A;  5AQN A;  2E2F A;  3AY9 A;  5AQZ A;  2BUP A;  4V1D C;  5AQW A;  3BK3 C;  1GPS A;  2KHO A;  4UJ0 A;  1NGF A;  1ZU3 A;  3FZF A;  2LY5 A;  2BRZ A;  1VNB A;  2N2R A;  4IO8 A;  1T7E A;  5AQR A;  5FPM A;  5AQP A;  1SN1 A;  3R2V A;  3C7N A;  2MZ0 A;  1P00 A;  1ZYW A;  2B68 A;  2QWQ A;  5EXW A;  4AAZ A;  5AQK A;  2QW9 A;  2QWN A;  5F2R A;  1LQQ A;  2KYQ A;  1JKZ A;  1T1T A;  1K8B A;  2LJM A;  5BPN A;  1AHO A;  3IUC A;  5AQX A;  5AQI A;  4UAE F;  1ZVE A;  5AR0 A;  2LI7 A;  1NGG A;  1NGD A;  1PTX A;  2LR3 A;  2QWR A;  1BA0 A;  4H5V A;  5AQM A;  5BPL A;  4AEI A;  4H5N A;  2E88 A;  2LN8 A;  4HWI A;  2KBJ A;  1KAX A;  1NRA A;  2QWO A;  1DKG D;  1I6F A;  4HHF A;  3GDQ A;  1GPT A;  3D2E A;  3E7U X;  1I2V A;  5EX5 A;  2QXL A;  3SF4 D;  1FH3 A;  5AQQ A;  1ZFU A;  1KAY A;  1WMT A;  3KOX A;  1JZB A;  1N4N A;  3LDL A;  3D2F A;  4FL9 A;  5F1X A;  1T7B A;  5AQL A;  1T7A A;  2E0H A;  5FPD A;  2LKB A;  1QQM A;  2YBR C;  3LDN A;  2LT8 A;  3GL1 A;  2YIP A;  3KP1 A;  5AQS A;  2KGQ A;  4H5W A;  1DJT A;  2M8B B;  2KBH A;  3LDQ A;  1QQN A;  2NY9 X;  2MBK A;  2KPY A;  1ZVG A;  3KHW A;  1MR4 A;  1C56 A;  1TI5 A;  2ATB A;  2GMO A;  2QWM A;  3FE1 A;  5BN8 A;  3ATV A;  3FZH A;  1BA1 A;  4HE7 A;  5FPN A;  3E7R L;  1HPM A;  1C55 A;  1HJO A;  5AQV A;  5F0X A;  1BK8 A;  1DQ7 A;  1CN2 A;  1I6G A;  3QFP A;  2B3C A;  1BCG A;  2N2Q A;  1WT7 A;  1NH5 A;  2KSK A;  3HSC A;  1ZUT A;  2YC1 C;  1BRZ A;  1SN4 A;  3KC6 A;  1SNB A;  2N66 A;  1NRB A;  1NGH A;  1PX9 A;  3QFU A;  5AQF A;  1BUP A;  3PSM A;  5AQU A;  1ATR A;  1MYN A;  3FZL A;  5AQH A;  1QQO A;  1NGI A;  5AQO A;  1ZYV A;  2SN3 A;  1T0Z A;  3M3Z A;  3CW4 A;  1I2U A;  2KBK A;  1ICA A;  3LDO A;  2E3F A;  5AQJ A;  3CQX A;  1VNA A;  2N69 A;  1JXC A;  4GNI A;  4UAF E;  2JDQ D;  1NPI A;  2YEO A;  4KBO A;  4KYP A;  1B3C A;  3QML A;  3ATU A;  3KVG A;  3GKU A;  1NGJ A;  1NGE A;  2YIO A;  1S3X A;  4CQK A;  1CHZ A;  1ATS A;  1PE4 A;  1YUW A;  1SEG A;  2NY8 X;  3L56 A;  3L4I A;  5BN9 A;  2K35 A;  1HX1 A;  4H5R A;  2GL1 A;  2YIL A;  5EVZ A;  2LJ7 A;  2QWL A;  1LQI A;  2E8A A;  1NGA A;  3FZK A;  4H5T A;  2A7T A;  2LY6 A;  1OZZ A;  1JZA A;  2QWP A;  1KAZ A;  1NE5 A;  3L6Q A;  3KOZ A;  4FSV A;  2G2K A;  5AQY A;  5CY0 A;  1KV0 A;  3D2E B;  1P0A A;  1BMR A;  3KOY A;  1OMY A;  1UGL A;  2MN5 A;  3A8Y A;  4UAD E;  5EY4 A;  1POI A;  3JXU A;  2KJA A;  3QI7 A;  4AB0 A;  1WWN A;  1LQH A;  1B7D A;  2D56 A;  3D2F B;  3FZM A;  1L4V A;  1XRS B;  3LDP A;  3I33 A; 
#chains in the Genus database with same CATH homology
 1AYJ A;  5KK4 A;  2I61 A;  2E3G A;  2ASC A;  4V1D C;  1GPS A;  4UJ0 A;  1ZU3 A;  2LY5 A;  2BRZ A;  1VNB A;  2N2R A;  1T7E A;  1SN1 A;  2MZ0 A;  1P00 A;  1ZYW A;  2B68 A;  4AAZ A;  2KYQ A;  1JKZ A;  1T1T A;  2LJM A;  1AHO A;  1ZVE A;  2LI7 A;  1PTX A;  2LR3 A;  4AEI A;  2KBJ A;  1NRA A;  1I6F A;  1GPT A;  3E7U X;  1I2V A;  1FH3 A;  1ZFU A;  1WMT A;  1JZB A;  1N4N A;  1T7B A;  1T7A A;  2E0H A;  2LKB A;  2YBR C;  2LT8 A;  2KGQ A;  1DJT A;  2M8B B;  2KBH A;  2NY9 X;  2KPY A;  1ZVG A;  1MR4 A;  1C56 A;  1TI5 A;  2ATB A;  4HE7 A;  3E7R L;  1C55 A;  1BK8 A;  1I6G A;  1DQ7 A;  1CN2 A;  2B3C A;  1BCG A;  2N2Q A;  1WT7 A;  1NH5 A;  2KSK A;  1ZUT A;  2YC1 C;  1BRZ A;  1SN4 A;  1SNB A;  2N66 A;  1NRB A;  1PX9 A;  3PSM A;  1MYN A;  1ZYV A;  2SN3 A;  1T0Z A;  1I2U A;  2KBK A;  1ICA A;  2E3F A;  1VNA A;  2N69 A;  1JXC A;  1NPI A;  2YEO A;  4KYP A;  1B3C A;  4CQK A;  1CHZ A;  1PE4 A;  2NY8 X;  1SEG A;  2GL1 A;  2LJ7 A;  1LQI A;  2A7T A;  2LY6 A;  1OZZ A;  1JZA A;  1NE5 A;  5CY0 A;  1KV0 A;  1P0A A;  1BMR A;  1OMY A;  2KJA A;  4AB0 A;  1WWN A;  1LQH A;  1B7D A;  1L4V A;  1LQQ A;  4HHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...