2ATBA

Triple mutant 8d9d10v of scorpion toxin lqh-alpha-it
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'MVRDAYIADDVNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords neurotoxin alpha-IT
publication title X-ray structures of Lqh-alpha-IT and Lqh-alpha-IT8D9D10V mutant
rcsb
source organism Leiurus quinquestriatus
molecule tags Toxin
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2atbA00
2E3GA 2LKBA 1NPIA 1C55A 1FH3A 4V1DC 1JXCA 1BRZA 1LQHA 1JKZA 1T7AA 2GL1A 1P0AA 2NY8X 2MZ0A 1N4NA 1NRAA 1B7DA 2B3CA 1WWNA 1DJTA 4UJ0A 2N66A 1SEGA 3E7RL 1SNBA 1C56A 1NRBA 1ZUTA 2LT8A 4AAZA 1BK8A 1ZYVA 1B3CA 1NH5A 2KGQA 1KV0A 2N2RA 1I2VA 1DQ7A 1I6GA 1GPTA 1VNBA 2KSKA 1I6FA 2KBKA 2LY6A 2E0HA 1BCGA 2YEOA 1T7BA 2KPYA 2I61A 1P00A 1CHZA 1SN1A 2BRZA 1JZBA 1AYJA 2LY5A 1LQQA 1SN4A 3E7UX 1JZAA 4AB0A 1PX9A 4HE7A 1NE5A 1AHOA 1OMYA 2E3FA 1L4VA 1TI5A 2LR3A 2SN3A 1GPSA 1MYNA 1WT7A 1T0ZA 2LJ7A 4HHFA 2N2QA 2B68A 5CY0A 1CN2A 1ICAA 2KJAA 2ATBA 2LI7A 1WMTA 2A7TA 2NY9X 2ASCA 2YBRC 1BMRA 2KYQA 1PE4A 1MR4A 1VNAA 2YC1C 5KK4A 4CQKA 1PTXA 1ZFUA 4KYPA 1I2UA 1T7EA 2LJMA 1ZU3A 1T1TA 1ZVEA 2KBHA 2M8BB 1ZVGA 1ZYWA 2KBJA 3PSMA 1LQIA 2N69A 1OZZA 4AEIA
chains in the Genus database with same CATH superfamily
4UADE 2E3GA 3KOYA 2LKBA 2QWRA 1NPIA 3ATUA 1C55A 1KAZA 1FH3A 3C7NB 4V1DC 5AQWA 5AQJA 5EX5A 1NGGA 5AQNA 1JXCA 3FZMA 1BRZA 1POIA 3I33A 1LQHA 3LDQA 1JKZA 3KP1A 1T7AA 5F0XA 3D2EA 1KAYA 1UGLA 2GL1A 3LDLA 5BPLA 1P0AA 3L4IA 2NY8X 5AR0A 5AQRA 2MZ0A 5BN9A 1N4NA 2E2FA 1NRAA 1B7DA 5AQPA 2B3CA 1WWNA 3FZLA 5AQIA 1DJTA 5AQHA 1BUPA 4UJ0A 2N66A 5AQKA 4H5RA 1SEGA 2D56A 3KC6A 1NGCA 2QXLA 3E7RL 1SNBA 3GDQA 1C56A 1NRBA 1NGHA 1ZUTA 4HWIA 2LT8A 5AQZA 4AAZA 5AQQA 1BK8A 2KHOA 1ZYVA 1B3CA 3LDPA 2YILA 5AQVA 2LN8A 1NH5A 4GNIA 2KGQA 3D2EB 1NGDA 3QFPA 2GMOA 3CW4A 1KV0A 2N2RA 1KAXA 1I2VA 4UAFE 1DQ7A 3KOXA 5AQFA 3D2FA 1I6GA 2K35A 3D2FB 3HSCA 1GPTA 1VNBA 2KSKA 5BPNA 3GL1A 1I6FA 2KBKA 4H5TA 2LY6A 3A8YA 1NGFA 1BCGA 2E0HA 1HJOA 2YEOA 5AQOA 5AQMA 5EXWA 3CQXA 5AQTA 1T7BA 2KPYA 2I61A 3KVGA 1P00A 1CHZA 1HX1A 1SN1A 5BN8A 1YUWA 2BRZA 2QWNA 4H5WA 5BPMA 1JZBA 2E88A 3QI7A 1AYJA 2LY5A 1LQQA 1SN4A 3FZFA 2QWQA 3E7UX 1JZAA 1ATRA 4H5NA 1PX9A 4HE7A 5FPNA 4AB0A 1NE5A 3LDOA 2G2KA 1AHOA 1OMYA 2E3FA 3KHWA 1L4VA 1DKGD 1TI5A 2LR3A 2SN3A 1GPSA 1MYNA 1WT7A 2MBKA 3KOWA 2QWPA 1T0ZA 5AQSA 1QQMA 2LJ7A 4HHFA 3KP0A 2N2QA 2B68A 3FZHA 3JXUA 3M3ZA 3SF4D 3QFUA 5CY0A 1CN2A 1ICAA 1HPMA 2V7ZA 1NGBA 1S3XA 3L6QA 2KJAA 2QW9A 5AQYA 2YIOA 5EY4A 2ATBA 2LI7A 1QQNA 1WMTA 2QWOA 2YIPA 2A7TA 3QMLA 3R2VA 2NY9X 2ASCA 4FSVA 1NGIA 2YBRC 1BMRA 3C7NA 2KYQA 1PE4A 1MR4A 3FE1A 1VNAA 2YC1C 5KK4A 1BA1A 3AY9A 3FZKA 4IO8A 2BUPA 4H5VA 4CQKA 1PTXA 5AQXA 1NGJA 3KOZA 1ZFUA 5EVZA 4KYPA 2QWMA 1I2UA 1QQOA 1T7EA 2JDQD 3GKUA 1XRSB 1ZU3A 2LJMA 1T1TA 1ZVEA 2KBHA 2VY6A 5AQGA 2M8BB 1K8BA 5F1XA 3L56A 4KBOA 5AQUA 1ZVGA 1ZYWA 2MN5A 5FPEA 2KBJA 1ATSA 2QWLA 3PSMA 5F2RA 1LQIA 4FL9A 5FPMA 4UAEF 5FPDA 1BA0A 1NGAA 3IUCA 5AQLA 2N69A 3BK3C 3LDNA 1NGEA 2E8AA 1OZZA 4AEIA 3ATVA
chains in the Genus database with same CATH topology
2E3GA 2LKBA 1NPIA 1C55A 1FH3A 4V1DC 1JXCA 1BRZA 1LQHA 1JKZA 1T7AA 2GL1A 1P0AA 2NY8X 2MZ0A 1N4NA 1NRAA 1B7DA 2B3CA 1WWNA 1DJTA 4UJ0A 2N66A 1SEGA 3E7RL 1SNBA 1C56A 1NRBA 1ZUTA 2LT8A 4AAZA 1BK8A 1ZYVA 1B3CA 1NH5A 2KGQA 1KV0A 2N2RA 1I2VA 1DQ7A 1I6GA 1GPTA 1VNBA 2KSKA 1I6FA 2KBKA 2LY6A 2E0HA 1BCGA 2YEOA 1T7BA 2KPYA 2I61A 1P00A 1CHZA 1SN1A 2BRZA 1JZBA 1AYJA 2LY5A 1LQQA 1SN4A 3E7UX 1JZAA 4AB0A 1PX9A 4HE7A 1NE5A 1AHOA 1OMYA 2E3FA 1L4VA 1TI5A 2LR3A 2SN3A 1GPSA 1MYNA 1WT7A 1T0ZA 2LJ7A 4HHFA 2N2QA 2B68A 5CY0A 1CN2A 1ICAA 2KJAA 2ATBA 2LI7A 1WMTA 2A7TA 2NY9X 2ASCA 2YBRC 1BMRA 2KYQA 1PE4A 1MR4A 1VNAA 2YC1C 5KK4A 4CQKA 1PTXA 1ZFUA 4KYPA 1I2UA 1T7EA 2LJMA 1ZU3A 1T1TA 1ZVEA 2KBHA 2M8BB 1ZVGA 1ZYWA 2KBJA 3PSMA 1LQIA 2N69A 1OZZA 4AEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3G A;  2LKB A;  1NPI A;  1C55 A;  1FH3 A;  4V1D C;  1JXC A;  1BRZ A;  1LQH A;  1JKZ A;  1T7A A;  2GL1 A;  1P0A A;  2NY8 X;  2MZ0 A;  1N4N A;  1NRA A;  1B7D A;  2B3C A;  1WWN A;  1DJT A;  4UJ0 A;  2N66 A;  1SEG A;  3E7R L;  1SNB A;  1C56 A;  1NRB A;  1ZUT A;  2LT8 A;  4AAZ A;  1BK8 A;  1ZYV A;  1B3C A;  1NH5 A;  2KGQ A;  1KV0 A;  2N2R A;  1I2V A;  1DQ7 A;  1I6G A;  1GPT A;  1VNB A;  2KSK A;  1I6F A;  2KBK A;  2LY6 A;  2E0H A;  1BCG A;  2YEO A;  1T7B A;  2KPY A;  2I61 A;  1P00 A;  1CHZ A;  1SN1 A;  2BRZ A;  1JZB A;  1AYJ A;  2LY5 A;  1LQQ A;  1SN4 A;  3E7U X;  1JZA A;  4AB0 A;  1PX9 A;  4HE7 A;  1NE5 A;  1AHO A;  1OMY A;  2E3F A;  1L4V A;  1TI5 A;  2LR3 A;  2SN3 A;  1GPS A;  1MYN A;  1WT7 A;  1T0Z A;  2LJ7 A;  4HHF A;  2N2Q A;  2B68 A;  5CY0 A;  1CN2 A;  1ICA A;  2KJA A;  2ATB A;  2LI7 A;  1WMT A;  2A7T A;  2NY9 X;  2ASC A;  2YBR C;  1BMR A;  2KYQ A;  1PE4 A;  1MR4 A;  1VNA A;  2YC1 C;  5KK4 A;  4CQK A;  1PTX A;  1ZFU A;  4KYP A;  1I2U A;  1T7E A;  2LJM A;  1ZU3 A;  1T1T A;  1ZVE A;  2KBH A;  2M8B B;  1ZVG A;  1ZYW A;  2KBJ A;  3PSM A;  1LQI A;  2N69 A;  1OZZ A;  4AEI A; 
#chains in the Genus database with same CATH topology
 4UAD E;  2E3G A;  3KOY A;  2LKB A;  2QWR A;  1NPI A;  3ATU A;  1C55 A;  1KAZ A;  1FH3 A;  3C7N B;  4V1D C;  5AQW A;  5AQJ A;  5EX5 A;  1NGG A;  5AQN A;  1JXC A;  3FZM A;  1BRZ A;  1POI A;  3I33 A;  1LQH A;  3LDQ A;  1JKZ A;  3KP1 A;  1T7A A;  5F0X A;  3D2E A;  1KAY A;  1UGL A;  2GL1 A;  3LDL A;  5BPL A;  1P0A A;  3L4I A;  2NY8 X;  5AR0 A;  5AQR A;  2MZ0 A;  5BN9 A;  1N4N A;  2E2F A;  1NRA A;  1B7D A;  5AQP A;  2B3C A;  1WWN A;  3FZL A;  5AQI A;  1DJT A;  5AQH A;  1BUP A;  4UJ0 A;  2N66 A;  5AQK A;  4H5R A;  1SEG A;  2D56 A;  3KC6 A;  1NGC A;  2QXL A;  3E7R L;  1SNB A;  3GDQ A;  1C56 A;  1NRB A;  1NGH A;  1ZUT A;  4HWI A;  2LT8 A;  5AQZ A;  4AAZ A;  5AQQ A;  1BK8 A;  2KHO A;  1ZYV A;  1B3C A;  3LDP A;  2YIL A;  5AQV A;  2LN8 A;  1NH5 A;  4GNI A;  2KGQ A;  3D2E B;  1NGD A;  3QFP A;  2GMO A;  3CW4 A;  1KV0 A;  2N2R A;  1KAX A;  1I2V A;  4UAF E;  1DQ7 A;  3KOX A;  5AQF A;  3D2F A;  1I6G A;  2K35 A;  3D2F B;  3HSC A;  1GPT A;  1VNB A;  2KSK A;  5BPN A;  3GL1 A;  1I6F A;  2KBK A;  4H5T A;  2LY6 A;  3A8Y A;  1NGF A;  1BCG A;  2E0H A;  1HJO A;  2YEO A;  5AQO A;  5AQM A;  5EXW A;  3CQX A;  5AQT A;  1T7B A;  2KPY A;  2I61 A;  3KVG A;  1P00 A;  1CHZ A;  1HX1 A;  1SN1 A;  5BN8 A;  1YUW A;  2BRZ A;  2QWN A;  4H5W A;  5BPM A;  1JZB A;  2E88 A;  3QI7 A;  1AYJ A;  2LY5 A;  1LQQ A;  1SN4 A;  3FZF A;  2QWQ A;  3E7U X;  1JZA A;  1ATR A;  4H5N A;  1PX9 A;  4HE7 A;  5FPN A;  4AB0 A;  1NE5 A;  3LDO A;  2G2K A;  1AHO A;  1OMY A;  2E3F A;  3KHW A;  1L4V A;  1DKG D;  1TI5 A;  2LR3 A;  2SN3 A;  1GPS A;  1MYN A;  1WT7 A;  2MBK A;  3KOW A;  2QWP A;  1T0Z A;  5AQS A;  1QQM A;  2LJ7 A;  4HHF A;  3KP0 A;  2N2Q A;  2B68 A;  3FZH A;  3JXU A;  3M3Z A;  3SF4 D;  3QFU A;  5CY0 A;  1CN2 A;  1ICA A;  1HPM A;  2V7Z A;  1NGB A;  1S3X A;  3L6Q A;  2KJA A;  2QW9 A;  5AQY A;  2YIO A;  5EY4 A;  2ATB A;  2LI7 A;  1QQN A;  1WMT A;  2QWO A;  2YIP A;  2A7T A;  3QML A;  3R2V A;  2NY9 X;  2ASC A;  4FSV A;  1NGI A;  2YBR C;  1BMR A;  3C7N A;  2KYQ A;  1PE4 A;  1MR4 A;  3FE1 A;  1VNA A;  2YC1 C;  5KK4 A;  1BA1 A;  3AY9 A;  3FZK A;  4IO8 A;  2BUP A;  4H5V A;  4CQK A;  1PTX A;  5AQX A;  1NGJ A;  3KOZ A;  1ZFU A;  5EVZ A;  4KYP A;  2QWM A;  1I2U A;  1QQO A;  1T7E A;  2JDQ D;  3GKU A;  1XRS B;  1ZU3 A;  2LJM A;  1T1T A;  1ZVE A;  2KBH A;  2VY6 A;  5AQG A;  2M8B B;  1K8B A;  5F1X A;  3L56 A;  4KBO A;  5AQU A;  1ZVG A;  1ZYW A;  2MN5 A;  5FPE A;  2KBJ A;  1ATS A;  2QWL A;  3PSM A;  5F2R A;  1LQI A;  4FL9 A;  5FPM A;  4UAE F;  5FPD A;  1BA0 A;  1NGA A;  3IUC A;  5AQL A;  2N69 A;  3BK3 C;  3LDN A;  1NGE A;  2E8A A;  1OZZ A;  4AEI A;  3ATV A; 
#chains in the Genus database with same CATH homology
 2E3G A;  2LKB A;  1NPI A;  1C55 A;  1FH3 A;  4V1D C;  1JXC A;  1BRZ A;  1LQH A;  1JKZ A;  1T7A A;  2GL1 A;  1P0A A;  2NY8 X;  2MZ0 A;  1N4N A;  1NRA A;  1B7D A;  2B3C A;  1WWN A;  1DJT A;  4UJ0 A;  2N66 A;  1SEG A;  3E7R L;  1SNB A;  1C56 A;  1NRB A;  1ZUT A;  2LT8 A;  4AAZ A;  1BK8 A;  1ZYV A;  1B3C A;  1NH5 A;  2KGQ A;  1KV0 A;  2N2R A;  1I2V A;  1DQ7 A;  1I6G A;  1GPT A;  1VNB A;  2KSK A;  1I6F A;  2KBK A;  2LY6 A;  2E0H A;  1BCG A;  2YEO A;  1T7B A;  2KPY A;  2I61 A;  1P00 A;  1CHZ A;  1SN1 A;  2BRZ A;  1JZB A;  1AYJ A;  2LY5 A;  1LQQ A;  1SN4 A;  3E7U X;  1JZA A;  4AB0 A;  1PX9 A;  4HE7 A;  1NE5 A;  1AHO A;  1OMY A;  2E3F A;  1L4V A;  1TI5 A;  2LR3 A;  2SN3 A;  1GPS A;  1MYN A;  1WT7 A;  1T0Z A;  2LJ7 A;  4HHF A;  2N2Q A;  2B68 A;  5CY0 A;  1CN2 A;  1ICA A;  2KJA A;  2ATB A;  2LI7 A;  1WMT A;  2A7T A;  2NY9 X;  2ASC A;  2YBR C;  1BMR A;  2KYQ A;  1PE4 A;  1MR4 A;  1VNA A;  2YC1 C;  5KK4 A;  4CQK A;  1PTX A;  1ZFU A;  4KYP A;  1I2U A;  1T7E A;  2LJM A;  1ZU3 A;  1T1T A;  1ZVE A;  2KBH A;  2M8B B;  1ZVG A;  1ZYW A;  2KBJ A;  3PSM A;  1LQI A;  2N69 A;  1OZZ A;  4AEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...