2KBKA

Solution structure of bmk-m10
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
b'VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVPGKCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin BmK-M10
publication title Solution Structure of BmK-M10
rcsb
molecule tags Toxin
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kbkA00
1ZFUA 2LJMA 1I6GA 1ZYWA 1SEGA 1BCGA 3PSMA 2YBRC 2N66A 2NY9X 2KJAA 1LQQA 4V1DC 2ASCA 2A7TA 1PE4A 4AB0A 1ZU3A 1LQIA 1PX9A 2KYQA 4AAZA 2E3GA 1VNAA 4AEIA 2KPYA 1PTXA 1WT7A 1NRAA 4HHFA 1B7DA 1ZUTA 1SN1A 1JZBA 1DJTA 1L4VA 1P00A 1KV0A 1AHOA 1I2UA 1I2VA 2N2RA 1T7EA 1GPSA 1ICAA 1T1TA 1LQHA 1WWNA 2KGQA 2LI7A 3E7UX 1ZYVA 2I61A 2NY8X 2N69A 1CN2A 1NH5A 2MZ0A 2LR3A 1ZVGA 2LKBA 1CHZA 5KK4A 1TI5A 2LT8A 2LY5A 1DQ7A 1JKZA 1NE5A 1C56A 2M8BB 2SN3A 1SNBA 2N2QA 1BMRA 1BRZA 1NPIA 2YEOA 1SN4A 2KBKA 1ZVEA 5CY0A 4UJ0A 1MR4A 2KBHA 4CQKA 3E7RL 1BK8A 2KBJA 2LY6A 2BRZA 1MYNA 2ATBA 1GPTA 2B68A 2GL1A 1JZAA 1T0ZA 4KYPA 4HE7A 2LJ7A 1VNBA 1P0AA 2E0HA 2B3CA 2E3FA 1I6FA 2KSKA 1WMTA 1T7AA 1JXCA 1B3CA 1OMYA 2YC1C 1OZZA 1AYJA 1N4NA 1NRBA 1FH3A 1T7BA 1C55A
chains in the Genus database with same CATH superfamily
1ZFUA 2LJMA 5BPNA 5F0XA 5AQPA 1I6GA 1HX1A 3CW4A 3LDLA 1BA1A 1ZYWA 1YUWA 3QFPA 4H5NA 1SEGA 3KOYA 1BCGA 5AQLA 3PSMA 2YBRC 2N66A 3D2EB 2NY9X 2KJAA 1LQQA 2YIOA 3FZHA 4V1DC 2ASCA 2A7TA 1PE4A 4AB0A 5EY4A 1ZU3A 5AQGA 1ATRA 1S3XA 2VY6A 2QXLA 2QWLA 4H5RA 5FPNA 1LQIA 1HPMA 1NGJA 5EX5A 1PX9A 2KYQA 4AAZA 3IUCA 3FE1A 2E3GA 2E88A 3GKUA 1HJOA 1VNAA 2QWQA 3D2FA 3L56A 5AQOA 3LDPA 4UADE 5AR0A 1ATSA 4AEIA 2KPYA 1PTXA 2YIPA 1WT7A 5AQWA 1NRAA 5F1XA 5F2RA 1DKGD 3R2VA 4HHFA 5FPEA 5AQIA 1NGFA 5AQMA 1B7DA 1ZUTA 4H5TA 1SN1A 3LDQA 2E2FA 2V7ZA 2JDQD 1JZBA 2QWPA 3KOWA 1DJTA 1NGBA 1QQOA 1UGLA 1L4VA 3A8YA 2QWMA 1P00A 1KV0A 1AHOA 5AQUA 1I2UA 2G2KA 3FZFA 2QWRA 1I2VA 1BA0A 1NGAA 2N2RA 3QFUA 3QI7A 1T7EA 1QQMA 4H5VA 3LDNA 5AQVA 1GPSA 1ICAA 1NGHA 1T1TA 2YILA 1LQHA 3ATUA 1WWNA 2KGQA 2QW9A 2LI7A 3E7UX 3L6QA 1ZYVA 3D2FB 5AQZA 2I61A 5FPDA 2GMOA 2MBKA 2N69A 2MN5A 2NY8X 3KP0A 4UAFE 1CN2A 1NGIA 2LN8A 3SF4D 1K8BA 2D56A 3GDQA 4HWIA 4IO8A 2KHOA 1NGEA 1NGGA 3FZMA 5AQKA 5BPMA 1NH5A 2MZ0A 2LR3A 5EVZA 1ZVGA 2LKBA 1NGDA 3ATVA 1CHZA 5AQJA 5AQFA 1TI5A 5BN8A 5KK4A 3GL1A 2LT8A 3M3ZA 2LY5A 2BUPA 1DQ7A 1JKZA 2K35A 5AQYA 1NE5A 1C56A 3FZKA 4KBOA 1NGCA 2M8BB 1KAYA 1SNBA 2SN3A 1POIA 5AQNA 2N2QA 1BMRA 3HSCA 1BRZA 1NPIA 4FSVA 4UAEF 2YEOA 4H5WA 1BUPA 5BN9A 1SN4A 1ZVEA 2E8AA 2KBKA 3AY9A 1QQNA 3C7NA 3C7NB 5CY0A 4UJ0A 1MR4A 5AQQA 3KP1A 2KBHA 1KAXA 3E7RL 4CQKA 2KBJA 2LY6A 2QWOA 2QWNA 1BK8A 2BRZA 3FZLA 5BPLA 3KVGA 1MYNA 2ATBA 3L4IA 3D2EA 1GPTA 5EXWA 2B68A 3LDOA 3CQXA 5FPMA 2GL1A 1JZAA 1T0ZA 4KYPA 4HE7A 3JXUA 2LJ7A 1VNBA 1P0AA 3KC6A 3BK3C 2E0HA 2B3CA 2E3FA 3QMLA 1I6FA 2KSKA 5AQSA 1WMTA 1T7AA 4FL9A 1KAZA 3I33A 4GNIA 1JXCA 3KOZA 5AQRA 1B3CA 1OMYA 2YC1C 1OZZA 5AQHA 5AQXA 1AYJA 1XRSB 1N4NA 3KHWA 3KOXA 1NRBA 1FH3A 1T7BA 5AQTA 1C55A
chains in the Genus database with same CATH topology
1ZFUA 2LJMA 1I6GA 1ZYWA 1SEGA 1BCGA 3PSMA 2YBRC 2N66A 2NY9X 2KJAA 1LQQA 4V1DC 2ASCA 2A7TA 1PE4A 4AB0A 1ZU3A 1LQIA 1PX9A 2KYQA 4AAZA 2E3GA 1VNAA 4AEIA 2KPYA 1PTXA 1WT7A 1NRAA 4HHFA 1B7DA 1ZUTA 1SN1A 1JZBA 1DJTA 1L4VA 1P00A 1KV0A 1AHOA 1I2UA 1I2VA 2N2RA 1T7EA 1GPSA 1ICAA 1T1TA 1LQHA 1WWNA 2KGQA 2LI7A 3E7UX 1ZYVA 2I61A 2NY8X 2N69A 1CN2A 1NH5A 2MZ0A 2LR3A 1ZVGA 2LKBA 1CHZA 5KK4A 1TI5A 2LT8A 2LY5A 1DQ7A 1JKZA 1NE5A 1C56A 2M8BB 2SN3A 1SNBA 2N2QA 1BMRA 1BRZA 1NPIA 2YEOA 1SN4A 2KBKA 1ZVEA 5CY0A 4UJ0A 1MR4A 2KBHA 4CQKA 3E7RL 1BK8A 2KBJA 2LY6A 2BRZA 1MYNA 2ATBA 1GPTA 2B68A 2GL1A 1JZAA 1T0ZA 4KYPA 4HE7A 2LJ7A 1VNBA 1P0AA 2E0HA 2B3CA 2E3FA 1I6FA 2KSKA 1WMTA 1T7AA 1JXCA 1B3CA 1OMYA 2YC1C 1OZZA 1AYJA 1N4NA 1NRBA 1FH3A 1T7BA 1C55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZFU A;  2LJM A;  1I6G A;  1ZYW A;  1SEG A;  1BCG A;  3PSM A;  2YBR C;  2N66 A;  2NY9 X;  2KJA A;  1LQQ A;  4V1D C;  2ASC A;  2A7T A;  1PE4 A;  4AB0 A;  1ZU3 A;  1LQI A;  1PX9 A;  2KYQ A;  4AAZ A;  2E3G A;  1VNA A;  4AEI A;  2KPY A;  1PTX A;  1WT7 A;  1NRA A;  4HHF A;  1B7D A;  1ZUT A;  1SN1 A;  1JZB A;  1DJT A;  1L4V A;  1P00 A;  1KV0 A;  1AHO A;  1I2U A;  1I2V A;  2N2R A;  1T7E A;  1GPS A;  1ICA A;  1T1T A;  1LQH A;  1WWN A;  2KGQ A;  2LI7 A;  3E7U X;  1ZYV A;  2I61 A;  2NY8 X;  2N69 A;  1CN2 A;  1NH5 A;  2MZ0 A;  2LR3 A;  1ZVG A;  2LKB A;  1CHZ A;  5KK4 A;  1TI5 A;  2LT8 A;  2LY5 A;  1DQ7 A;  1JKZ A;  1NE5 A;  1C56 A;  2M8B B;  2SN3 A;  1SNB A;  2N2Q A;  1BMR A;  1BRZ A;  1NPI A;  2YEO A;  1SN4 A;  2KBK A;  1ZVE A;  5CY0 A;  4UJ0 A;  1MR4 A;  2KBH A;  4CQK A;  3E7R L;  1BK8 A;  2KBJ A;  2LY6 A;  2BRZ A;  1MYN A;  2ATB A;  1GPT A;  2B68 A;  2GL1 A;  1JZA A;  1T0Z A;  4KYP A;  4HE7 A;  2LJ7 A;  1VNB A;  1P0A A;  2E0H A;  2B3C A;  2E3F A;  1I6F A;  2KSK A;  1WMT A;  1T7A A;  1JXC A;  1B3C A;  1OMY A;  2YC1 C;  1OZZ A;  1AYJ A;  1N4N A;  1NRB A;  1FH3 A;  1T7B A;  1C55 A; 
#chains in the Genus database with same CATH topology
 1ZFU A;  2LJM A;  5BPN A;  5F0X A;  5AQP A;  1I6G A;  1HX1 A;  3CW4 A;  3LDL A;  1BA1 A;  1ZYW A;  1YUW A;  3QFP A;  4H5N A;  1SEG A;  3KOY A;  1BCG A;  5AQL A;  3PSM A;  2YBR C;  2N66 A;  3D2E B;  2NY9 X;  2KJA A;  1LQQ A;  2YIO A;  3FZH A;  4V1D C;  2ASC A;  2A7T A;  1PE4 A;  4AB0 A;  5EY4 A;  1ZU3 A;  5AQG A;  1ATR A;  1S3X A;  2VY6 A;  2QXL A;  2QWL A;  4H5R A;  5FPN A;  1LQI A;  1HPM A;  1NGJ A;  5EX5 A;  1PX9 A;  2KYQ A;  4AAZ A;  3IUC A;  3FE1 A;  2E3G A;  2E88 A;  3GKU A;  1HJO A;  1VNA A;  2QWQ A;  3D2F A;  3L56 A;  5AQO A;  3LDP A;  4UAD E;  5AR0 A;  1ATS A;  4AEI A;  2KPY A;  1PTX A;  2YIP A;  1WT7 A;  5AQW A;  1NRA A;  5F1X A;  5F2R A;  1DKG D;  3R2V A;  4HHF A;  5FPE A;  5AQI A;  1NGF A;  5AQM A;  1B7D A;  1ZUT A;  4H5T A;  1SN1 A;  3LDQ A;  2E2F A;  2V7Z A;  2JDQ D;  1JZB A;  2QWP A;  3KOW A;  1DJT A;  1NGB A;  1QQO A;  1UGL A;  1L4V A;  3A8Y A;  2QWM A;  1P00 A;  1KV0 A;  1AHO A;  5AQU A;  1I2U A;  2G2K A;  3FZF A;  2QWR A;  1I2V A;  1BA0 A;  1NGA A;  2N2R A;  3QFU A;  3QI7 A;  1T7E A;  1QQM A;  4H5V A;  3LDN A;  5AQV A;  1GPS A;  1ICA A;  1NGH A;  1T1T A;  2YIL A;  1LQH A;  3ATU A;  1WWN A;  2KGQ A;  2QW9 A;  2LI7 A;  3E7U X;  3L6Q A;  1ZYV A;  3D2F B;  5AQZ A;  2I61 A;  5FPD A;  2GMO A;  2MBK A;  2N69 A;  2MN5 A;  2NY8 X;  3KP0 A;  4UAF E;  1CN2 A;  1NGI A;  2LN8 A;  3SF4 D;  1K8B A;  2D56 A;  3GDQ A;  4HWI A;  4IO8 A;  2KHO A;  1NGE A;  1NGG A;  3FZM A;  5AQK A;  5BPM A;  1NH5 A;  2MZ0 A;  2LR3 A;  5EVZ A;  1ZVG A;  2LKB A;  1NGD A;  3ATV A;  1CHZ A;  5AQJ A;  5AQF A;  1TI5 A;  5BN8 A;  5KK4 A;  3GL1 A;  2LT8 A;  3M3Z A;  2LY5 A;  2BUP A;  1DQ7 A;  1JKZ A;  2K35 A;  5AQY A;  1NE5 A;  1C56 A;  3FZK A;  4KBO A;  1NGC A;  2M8B B;  1KAY A;  1SNB A;  2SN3 A;  1POI A;  5AQN A;  2N2Q A;  1BMR A;  3HSC A;  1BRZ A;  1NPI A;  4FSV A;  4UAE F;  2YEO A;  4H5W A;  1BUP A;  5BN9 A;  1SN4 A;  1ZVE A;  2E8A A;  2KBK A;  3AY9 A;  1QQN A;  3C7N A;  3C7N B;  5CY0 A;  4UJ0 A;  1MR4 A;  5AQQ A;  3KP1 A;  2KBH A;  1KAX A;  3E7R L;  4CQK A;  2KBJ A;  2LY6 A;  2QWO A;  2QWN A;  1BK8 A;  2BRZ A;  3FZL A;  5BPL A;  3KVG A;  1MYN A;  2ATB A;  3L4I A;  3D2E A;  1GPT A;  5EXW A;  2B68 A;  3LDO A;  3CQX A;  5FPM A;  2GL1 A;  1JZA A;  1T0Z A;  4KYP A;  4HE7 A;  3JXU A;  2LJ7 A;  1VNB A;  1P0A A;  3KC6 A;  3BK3 C;  2E0H A;  2B3C A;  2E3F A;  3QML A;  1I6F A;  2KSK A;  5AQS A;  1WMT A;  1T7A A;  4FL9 A;  1KAZ A;  3I33 A;  4GNI A;  1JXC A;  3KOZ A;  5AQR A;  1B3C A;  1OMY A;  2YC1 C;  1OZZ A;  5AQH A;  5AQX A;  1AYJ A;  1XRS B;  1N4N A;  3KHW A;  3KOX A;  1NRB A;  1FH3 A;  1T7B A;  5AQT A;  1C55 A; 
#chains in the Genus database with same CATH homology
 1ZFU A;  2LJM A;  1I6G A;  1ZYW A;  1SEG A;  1BCG A;  3PSM A;  2YBR C;  2N66 A;  2NY9 X;  2KJA A;  1LQQ A;  4V1D C;  2ASC A;  2A7T A;  1PE4 A;  4AB0 A;  1ZU3 A;  1LQI A;  1PX9 A;  2KYQ A;  4AAZ A;  2E3G A;  1VNA A;  4AEI A;  2KPY A;  1PTX A;  1WT7 A;  1NRA A;  4HHF A;  1B7D A;  1ZUT A;  1SN1 A;  1JZB A;  1DJT A;  1L4V A;  1P00 A;  1KV0 A;  1AHO A;  1I2U A;  1I2V A;  2N2R A;  1T7E A;  1GPS A;  1ICA A;  1T1T A;  1LQH A;  1WWN A;  2KGQ A;  2LI7 A;  3E7U X;  1ZYV A;  2I61 A;  2NY8 X;  2N69 A;  1CN2 A;  1NH5 A;  2MZ0 A;  2LR3 A;  1ZVG A;  2LKB A;  1CHZ A;  5KK4 A;  1TI5 A;  2LT8 A;  2LY5 A;  1DQ7 A;  1JKZ A;  1NE5 A;  1C56 A;  2M8B B;  2SN3 A;  1SNB A;  2N2Q A;  1BMR A;  1BRZ A;  1NPI A;  2YEO A;  1SN4 A;  2KBK A;  1ZVE A;  5CY0 A;  4UJ0 A;  1MR4 A;  2KBH A;  4CQK A;  3E7R L;  1BK8 A;  2KBJ A;  2LY6 A;  2BRZ A;  1MYN A;  2ATB A;  1GPT A;  2B68 A;  2GL1 A;  1JZA A;  1T0Z A;  4KYP A;  4HE7 A;  2LJ7 A;  1VNB A;  1P0A A;  2E0H A;  2B3C A;  2E3F A;  1I6F A;  2KSK A;  1WMT A;  1T7A A;  1JXC A;  1B3C A;  1OMY A;  2YC1 C;  1OZZ A;  1AYJ A;  1N4N A;  1NRB A;  1FH3 A;  1T7B A;  1C55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...