2KBKA

Solution structure of bmk-m10
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVPGKCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurotoxin BmK-M10
publication title Solution Structure of BmK-M10
rcsb
molecule tags Toxin
total genus 10
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kbkA00
1I6GA 3PSMA 4AB0A 2N2RA 4AAZA 2ATBA 2KJAA 5CY0A 2NY8X 4HHFA 1ZFUA 1DJTA 1BCGA 1JXCA 1AYJA 1T0ZA 2LI7A 1PTXA 1T7BA 1VNBA 1DQ7A 1NRBA 2YEOA 2LJ7A 1CHZA 2E3FA 1B3CA 1T7EA 2KBHA 1NE5A 1WT7A 2N69A 4KYPA 1MYNA 1AHOA 1BMRA 1JKZA 1SN1A 4V1DC 2KBJA 1P0AA 2KYQA 2KSKA 1B7DA 3E7RL 1FH3A 1NRAA 1JZAA 1ZYVA 1GPSA 2BRZA 1ZVGA 4HE7A 1LQHA 2LY6A 1GPTA 1JZBA 2LT8A 1SNBA 1KV0A 2M8BB 1BRZA 1I2VA 1ICAA 2E3GA 1PE4A 1N4NA 4CQKA 1MR4A 1SEGA 1SN4A 2E0HA 1OZZA 1TI5A 1CN2A 1T7AA 1NH5A 2KBKA 1LQQA 3E7UX 1I6FA 2N2QA 4AEIA 2YBRC 2LY5A 1OMYA 1P00A 1I2UA 1PX9A 2I61A 1ZU3A 1WWNA 1ZVEA 2ASCA 2KGQA 2NY9X 1ZYWA 4UJ0A 1T1TA 2B68A 2N66A 1ZUTA 2SN3A 2KPYA 2YC1C 2LR3A 1WMTA 1C55A 1VNAA 1BK8A 1L4VA 2GL1A 1LQIA 5KK4A 2MZ0A 1NPIA 2A7TA 2B3CA 2LJMA 2LKBA 1C56A
chains in the Genus database with same CATH superfamily
1HX1A 3FZMA 1I6GA 2GMOA 3PSMA 4UAFE 2N2RA 3L6QA 4AB0A 4AAZA 3KOXA 2ATBA 2BUPA 2KJAA 1BUPA 5CY0A 5AQPA 1ATRA 1K8BA 2NY8X 4HHFA 1ZFUA 5AQYA 5AQVA 1DJTA 1BCGA 1JXCA 1AYJA 1S3XA 5AQHA 5AQSA 3KC6A 1T0ZA 1NGAA 2KHOA 2LN8A 3SF4D 5FPNA 1PTXA 1NGGA 2LI7A 4H5WA 3FE1A 1T7BA 1VNBA 4HWIA 5AQIA 1DKGD 1DQ7A 3I33A 3D2EA 3KOZA 1NRBA 2VY6A 2E8AA 3FZLA 3R2VA 2YEOA 2LJ7A 1CHZA 2E3FA 1KAZA 1T7EA 2E88A 4H5RA 1B3CA 2QWLA 3KOWA 2KBHA 3FZFA 3FZKA 2LKBA 3KHWA 1NE5A 1KAYA 1WT7A 2N69A 3GDQA 4KYPA 1MYNA 1AHOA 2QWNA 1BA1A 3A8YA 2JDQD 5AQMA 1BMRA 1JKZA 1SN1A 3ATVA 3C7NB 4H5NA 1BA0A 1QQMA 1YUWA 2QWQA 4V1DC 1UGLA 2MBKA 2G2KA 5AQWA 5FPMA 1NGCA 1P0AA 2KBJA 2KYQA 3QFPA 4H5TA 2MN5A 2KSKA 1B7DA 3E7RL 3QI7A 4KBOA 1FH3A 1NRAA 3ATUA 4FL9A 5BPNA 1HPMA 5BPLA 2YIOA 1JZAA 2QWPA 1ZYVA 1GPSA 2BRZA 3D2FA 1ZVGA 3KVGA 5AQTA 4HE7A 5AQJA 1LQHA 2YIPA 3KP1A 3M3ZA 2LY6A 1GPTA 1JZBA 1NGFA 2LT8A 5AQKA 1SNBA 5EY4A 5AQQA 1KV0A 2QW9A 2M8BB 5F1XA 5EXWA 1BRZA 1I2VA 1ICAA 2YILA 2V7ZA 2D56A 5FPDA 2E3GA 1XRSB 5AR0A 1PE4A 3CQXA 1N4NA 3D2EB 5F0XA 4H5VA 3KOYA 3QFUA 4CQKA 1MR4A 5EX5A 5AQGA 1SEGA 1QQOA 1SN4A 2QXLA 3QMLA 3LDLA 1NGHA 1QQNA 5AQFA 3FZHA 3LDQA 5BN9A 2E0HA 1OZZA 1TI5A 3AY9A 4FSVA 1NGIA 2E2FA 1CN2A 1T7AA 5EVZA 1NH5A 4IO8A 2K35A 5AQNA 3L56A 1NGBA 2KBKA 1LQQA 3E7UX 3GL1A 1KAXA 3L4IA 2QWRA 3LDPA 2QWMA 3CW4A 1I6FA 2N2QA 4AEIA 2YBRC 1HJOA 2LY5A 3HSCA 5AQXA 1OMYA 5BPMA 2QWOA 1NGJA 3D2FB 1P00A 1I2UA 1PX9A 2I61A 4GNIA 1ZU3A 1WWNA 1ZVEA 2ASCA 2KGQA 5AQUA 2NY9X 1ZYWA 5AQOA 4UJ0A 1T1TA 2B68A 3JXUA 5BN8A 5FPEA 5F2RA 1NGEA 5AQLA 2N66A 1ZUTA 2SN3A 2KPYA 2YC1C 2LR3A 3LDNA 1WMTA 1C55A 1ATSA 3LDOA 1VNAA 5AQRA 3KP0A 1BK8A 1L4VA 3BK3C 2GL1A 5KK4A 1POIA 2MZ0A 1NPIA 2A7TA 3C7NA 1NGDA 3IUCA 4UADE 4UAEF 2B3CA 5AQZA 2LJMA 1LQIA 3GKUA 1C56A
chains in the Genus database with same CATH topology
1I6GA 3PSMA 4AB0A 2N2RA 4AAZA 2ATBA 2KJAA 5CY0A 2NY8X 4HHFA 1ZFUA 1DJTA 1BCGA 1JXCA 1AYJA 1T0ZA 2LI7A 1PTXA 1T7BA 1VNBA 1DQ7A 1NRBA 2YEOA 2LJ7A 1CHZA 2E3FA 1B3CA 1T7EA 2KBHA 1NE5A 1WT7A 2N69A 4KYPA 1MYNA 1AHOA 1BMRA 1JKZA 1SN1A 4V1DC 2KBJA 1P0AA 2KYQA 2KSKA 1B7DA 3E7RL 1FH3A 1NRAA 1JZAA 1ZYVA 1GPSA 2BRZA 1ZVGA 4HE7A 1LQHA 2LY6A 1GPTA 1JZBA 2LT8A 1SNBA 1KV0A 2M8BB 1BRZA 1I2VA 1ICAA 2E3GA 1PE4A 1N4NA 4CQKA 1MR4A 1SEGA 1SN4A 2E0HA 1OZZA 1TI5A 1CN2A 1T7AA 1NH5A 2KBKA 1LQQA 3E7UX 1I6FA 2N2QA 4AEIA 2YBRC 2LY5A 1OMYA 1P00A 1I2UA 1PX9A 2I61A 1ZU3A 1WWNA 1ZVEA 2ASCA 2KGQA 2NY9X 1ZYWA 4UJ0A 1T1TA 2B68A 2N66A 1ZUTA 2SN3A 2KPYA 2YC1C 2LR3A 1WMTA 1C55A 1VNAA 1BK8A 1L4VA 2GL1A 1LQIA 5KK4A 2MZ0A 1NPIA 2A7TA 2B3CA 2LJMA 2LKBA 1C56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6G A;  3PSM A;  4AB0 A;  2N2R A;  4AAZ A;  2ATB A;  2KJA A;  5CY0 A;  2NY8 X;  4HHF A;  1ZFU A;  1DJT A;  1BCG A;  1JXC A;  1AYJ A;  1T0Z A;  2LI7 A;  1PTX A;  1T7B A;  1VNB A;  1DQ7 A;  1NRB A;  2YEO A;  2LJ7 A;  1CHZ A;  2E3F A;  1B3C A;  1T7E A;  2KBH A;  1NE5 A;  1WT7 A;  2N69 A;  4KYP A;  1MYN A;  1AHO A;  1BMR A;  1JKZ A;  1SN1 A;  4V1D C;  2KBJ A;  1P0A A;  2KYQ A;  2KSK A;  1B7D A;  3E7R L;  1FH3 A;  1NRA A;  1JZA A;  1ZYV A;  1GPS A;  2BRZ A;  1ZVG A;  4HE7 A;  1LQH A;  2LY6 A;  1GPT A;  1JZB A;  2LT8 A;  1SNB A;  1KV0 A;  2M8B B;  1BRZ A;  1I2V A;  1ICA A;  2E3G A;  1PE4 A;  1N4N A;  4CQK A;  1MR4 A;  1SEG A;  1SN4 A;  2E0H A;  1OZZ A;  1TI5 A;  1CN2 A;  1T7A A;  1NH5 A;  2KBK A;  1LQQ A;  3E7U X;  1I6F A;  2N2Q A;  4AEI A;  2YBR C;  2LY5 A;  1OMY A;  1P00 A;  1I2U A;  1PX9 A;  2I61 A;  1ZU3 A;  1WWN A;  1ZVE A;  2ASC A;  2KGQ A;  2NY9 X;  1ZYW A;  4UJ0 A;  1T1T A;  2B68 A;  2N66 A;  1ZUT A;  2SN3 A;  2KPY A;  2YC1 C;  2LR3 A;  1WMT A;  1C55 A;  1VNA A;  1BK8 A;  1L4V A;  2GL1 A;  1LQI A;  5KK4 A;  2MZ0 A;  1NPI A;  2A7T A;  2B3C A;  2LJM A;  2LKB A;  1C56 A; 
#chains in the Genus database with same CATH topology
 1HX1 A;  3FZM A;  1I6G A;  2GMO A;  3PSM A;  4UAF E;  2N2R A;  3L6Q A;  4AB0 A;  4AAZ A;  3KOX A;  2ATB A;  2BUP A;  2KJA A;  1BUP A;  5CY0 A;  5AQP A;  1ATR A;  1K8B A;  2NY8 X;  4HHF A;  1ZFU A;  5AQY A;  5AQV A;  1DJT A;  1BCG A;  1JXC A;  1AYJ A;  1S3X A;  5AQH A;  5AQS A;  3KC6 A;  1T0Z A;  1NGA A;  2KHO A;  2LN8 A;  3SF4 D;  5FPN A;  1PTX A;  1NGG A;  2LI7 A;  4H5W A;  3FE1 A;  1T7B A;  1VNB A;  4HWI A;  5AQI A;  1DKG D;  1DQ7 A;  3I33 A;  3D2E A;  3KOZ A;  1NRB A;  2VY6 A;  2E8A A;  3FZL A;  3R2V A;  2YEO A;  2LJ7 A;  1CHZ A;  2E3F A;  1KAZ A;  1T7E A;  2E88 A;  4H5R A;  1B3C A;  2QWL A;  3KOW A;  2KBH A;  3FZF A;  3FZK A;  2LKB A;  3KHW A;  1NE5 A;  1KAY A;  1WT7 A;  2N69 A;  3GDQ A;  4KYP A;  1MYN A;  1AHO A;  2QWN A;  1BA1 A;  3A8Y A;  2JDQ D;  5AQM A;  1BMR A;  1JKZ A;  1SN1 A;  3ATV A;  3C7N B;  4H5N A;  1BA0 A;  1QQM A;  1YUW A;  2QWQ A;  4V1D C;  1UGL A;  2MBK A;  2G2K A;  5AQW A;  5FPM A;  1NGC A;  1P0A A;  2KBJ A;  2KYQ A;  3QFP A;  4H5T A;  2MN5 A;  2KSK A;  1B7D A;  3E7R L;  3QI7 A;  4KBO A;  1FH3 A;  1NRA A;  3ATU A;  4FL9 A;  5BPN A;  1HPM A;  5BPL A;  2YIO A;  1JZA A;  2QWP A;  1ZYV A;  1GPS A;  2BRZ A;  3D2F A;  1ZVG A;  3KVG A;  5AQT A;  4HE7 A;  5AQJ A;  1LQH A;  2YIP A;  3KP1 A;  3M3Z A;  2LY6 A;  1GPT A;  1JZB A;  1NGF A;  2LT8 A;  5AQK A;  1SNB A;  5EY4 A;  5AQQ A;  1KV0 A;  2QW9 A;  2M8B B;  5F1X A;  5EXW A;  1BRZ A;  1I2V A;  1ICA A;  2YIL A;  2V7Z A;  2D56 A;  5FPD A;  2E3G A;  1XRS B;  5AR0 A;  1PE4 A;  3CQX A;  1N4N A;  3D2E B;  5F0X A;  4H5V A;  3KOY A;  3QFU A;  4CQK A;  1MR4 A;  5EX5 A;  5AQG A;  1SEG A;  1QQO A;  1SN4 A;  2QXL A;  3QML A;  3LDL A;  1NGH A;  1QQN A;  5AQF A;  3FZH A;  3LDQ A;  5BN9 A;  2E0H A;  1OZZ A;  1TI5 A;  3AY9 A;  4FSV A;  1NGI A;  2E2F A;  1CN2 A;  1T7A A;  5EVZ A;  1NH5 A;  4IO8 A;  2K35 A;  5AQN A;  3L56 A;  1NGB A;  2KBK A;  1LQQ A;  3E7U X;  3GL1 A;  1KAX A;  3L4I A;  2QWR A;  3LDP A;  2QWM A;  3CW4 A;  1I6F A;  2N2Q A;  4AEI A;  2YBR C;  1HJO A;  2LY5 A;  3HSC A;  5AQX A;  1OMY A;  5BPM A;  2QWO A;  1NGJ A;  3D2F B;  1P00 A;  1I2U A;  1PX9 A;  2I61 A;  4GNI A;  1ZU3 A;  1WWN A;  1ZVE A;  2ASC A;  2KGQ A;  5AQU A;  2NY9 X;  1ZYW A;  5AQO A;  4UJ0 A;  1T1T A;  2B68 A;  3JXU A;  5BN8 A;  5FPE A;  5F2R A;  1NGE A;  5AQL A;  2N66 A;  1ZUT A;  2SN3 A;  2KPY A;  2YC1 C;  2LR3 A;  3LDN A;  1WMT A;  1C55 A;  1ATS A;  3LDO A;  1VNA A;  5AQR A;  3KP0 A;  1BK8 A;  1L4V A;  3BK3 C;  2GL1 A;  5KK4 A;  1POI A;  2MZ0 A;  1NPI A;  2A7T A;  3C7N A;  1NGD A;  3IUC A;  4UAD E;  4UAE F;  2B3C A;  5AQZ A;  2LJM A;  1LQI A;  3GKU A;  1C56 A; 
#chains in the Genus database with same CATH homology
 1I6G A;  3PSM A;  4AB0 A;  2N2R A;  4AAZ A;  2ATB A;  2KJA A;  5CY0 A;  2NY8 X;  4HHF A;  1ZFU A;  1DJT A;  1BCG A;  1JXC A;  1AYJ A;  1T0Z A;  2LI7 A;  1PTX A;  1T7B A;  1VNB A;  1DQ7 A;  1NRB A;  2YEO A;  2LJ7 A;  1CHZ A;  2E3F A;  1B3C A;  1T7E A;  2KBH A;  1NE5 A;  1WT7 A;  2N69 A;  4KYP A;  1MYN A;  1AHO A;  1BMR A;  1JKZ A;  1SN1 A;  4V1D C;  2KBJ A;  1P0A A;  2KYQ A;  2KSK A;  1B7D A;  3E7R L;  1FH3 A;  1NRA A;  1JZA A;  1ZYV A;  1GPS A;  2BRZ A;  1ZVG A;  4HE7 A;  1LQH A;  2LY6 A;  1GPT A;  1JZB A;  2LT8 A;  1SNB A;  1KV0 A;  2M8B B;  1BRZ A;  1I2V A;  1ICA A;  2E3G A;  1PE4 A;  1N4N A;  4CQK A;  1MR4 A;  1SEG A;  1SN4 A;  2E0H A;  1OZZ A;  1TI5 A;  1CN2 A;  1T7A A;  1NH5 A;  2KBK A;  1LQQ A;  3E7U X;  1I6F A;  2N2Q A;  4AEI A;  2YBR C;  2LY5 A;  1OMY A;  1P00 A;  1I2U A;  1PX9 A;  2I61 A;  1ZU3 A;  1WWN A;  1ZVE A;  2ASC A;  2KGQ A;  2NY9 X;  1ZYW A;  4UJ0 A;  1T1T A;  2B68 A;  2N66 A;  1ZUT A;  2SN3 A;  2KPY A;  2YC1 C;  2LR3 A;  1WMT A;  1C55 A;  1VNA A;  1BK8 A;  1L4V A;  2GL1 A;  1LQI A;  5KK4 A;  2MZ0 A;  1NPI A;  2A7T A;  2B3C A;  2LJM A;  2LKB A;  1C56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...