1SNBA

Structure of scorpion neurotoxin bmk m8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
GRDAYIADSENCTYFCGSNPYCNDVCTENGAKSGYCQWAGRYGNACYCIDLPASERIKEGGRCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords NEUROTOXIN BMK M8
publication title Crystal structure of an acidic neurotoxin from scorpion Buthus martensii Karsch at 1.85 A resolution.
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1997-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1snbA00
1DQ7A 1SEGA 1BCGA 2E3GA 3E7UX 1BRZA 1TI5A 2KPYA 2E3FA 2N2RA 1JZAA 2MZ0A 2SN3A 1LQIA 2A7TA 1SN1A 2BRZA 1JKZA 1ZVEA 2E0HA 2B68A 5KK4A 1CHZA 1ZYWA 1B7DA 2YC1C 1AYJA 2KBJA 1NH5A 3PSMA 2LI7A 1VNAA 1L4VA 4AB0A 2KYQA 1P00A 2LJ7A 1SNBA 2LY5A 1B3CA 1JXCA 1NPIA 1T7AA 1C56A 1WT7A 1MYNA 2N69A 1I2VA 1I6FA 1ZFUA 2NY8X 2GL1A 1JZBA 1I2UA 1FH3A 1WMTA 2LT8A 5CY0A 2KJAA 1BMRA 1DJTA 1BK8A 4KYPA 2I61A 1GPTA 2LY6A 1T1TA 2ATBA 2KGQA 4UJ0A 1PE4A 1AHOA 2KBKA 1I6GA 4AEIA 2B3CA 1P0AA 2KBHA 1T7BA 2N66A 1KV0A 1T0ZA 1CN2A 1NRAA 2LR3A 2LKBA 1NRBA 4CQKA 1ZUTA 2N2QA 4AAZA 4V1DC 1PX9A 1ZVGA 2KSKA 1LQHA 1VNBA 1MR4A 1WWNA 1NE5A 1OMYA 1PTXA 2NY9X 1GPSA 1ZYVA 1N4NA 1OZZA 1SN4A 2LJMA 4HE7A 1ZU3A 1ICAA 4HHFA 2ASCA 2YEOA 1C55A 1T7EA 1LQQA 2M8BB 2YBRC 3E7RL
chains in the Genus database with same CATH superfamily
5AQNA 1DQ7A 1SEGA 1BCGA 2E3GA 3E7UX 2LN8A 4H5RA 1BRZA 1NGIA 1YUWA 1TI5A 2KPYA 2QWNA 3LDQA 2E3FA 2N2RA 3JXUA 1NGDA 5AQHA 1JZAA 3ATVA 3CQXA 2MZ0A 2SN3A 3D2EB 1LQIA 5AQGA 5FPMA 2A7TA 4KBOA 5AQXA 1SN1A 2BRZA 1JKZA 1ZVEA 2E0HA 2B68A 1ATSA 1POIA 1CHZA 2QWQA 3KOZA 5KK4A 1ZYWA 2QWPA 1B7DA 2YC1C 1AYJA 5AQWA 2KBJA 3IUCA 1NH5A 3PSMA 2LI7A 1VNAA 3ATUA 3KP0A 3R2VA 2KYQA 4H5WA 4AB0A 3QMLA 2BUPA 1P00A 5FPDA 5AQTA 1NGBA 2LJ7A 1SNBA 1HPMA 3L6QA 2LY5A 5AQLA 1KAYA 3C7NA 4FL9A 5AQQA 5F0XA 4H5TA 3AY9A 3SF4D 1B3CA 1NGGA 1JXCA 1NPIA 1T7AA 1C56A 1WT7A 4GNIA 4H5VA 1MYNA 3FZKA 4FSVA 5AQVA 2N69A 3FZFA 1QQOA 2VY6A 2YILA 1I6FA 1I2VA 3QFPA 3A8YA 5F1XA 5AQPA 1ZFUA 2NY8X 1KAZA 2GL1A 2MN5A 1JZBA 2QWRA 5AQOA 1FH3A 1WMTA 1I2UA 2LT8A 2QWMA 5AQSA 2E88A 1NGCA 2G2KA 2KJAA 5CY0A 3KP1A 1NGFA 3D2FA 3KOWA 5AQUA 1BMRA 1NGEA 1DJTA 1QQNA 3QFUA 5BPNA 3L4IA 4KYPA 1BK8A 3HSCA 3FZMA 3KOXA 2I61A 5AQFA 2LY6A 1GPTA 1BA1A 1XRSB 3FE1A 3KC6A 1BUPA 1T1TA 3M3ZA 5AQYA 2ATBA 4HWIA 5EVZA 3CW4A 2KGQA 5BPLA 3GDQA 4UJ0A 5AQMA 1PE4A 1AHOA 2KBKA 5EY4A 3FZHA 1I6GA 4AEIA 3D2EA 2B3CA 5F2RA 2QXLA 1HJOA 1NGAA 2QW9A 3KVGA 5BN9A 1P0AA 2KBHA 4UAFE 1T7BA 3LDOA 2N66A 3GKUA 1S3XA 4UADE 1KV0A 1T0ZA 3GL1A 2GMOA 1CN2A 1NRAA 2LR3A 2LKBA 5AQJA 2D56A 2K35A 1NRBA 1NGJA 3LDPA 2E8AA 4CQKA 1ZUTA 5BN8A 1DKGD 2N2QA 4AAZA 3QI7A 1KAXA 4V1DC 2KHOA 1PX9A 1ZVGA 2KSKA 5AQRA 5EXWA 2YIPA 3C7NB 1LQHA 3LDLA 4IO8A 5AQZA 1VNBA 2QWLA 5AQKA 5FPEA 1MR4A 1K8BA 1WWNA 1NE5A 1OMYA 1PTXA 2NY9X 1QQMA 1UGLA 1ZYVA 3BK3C 1N4NA 1GPSA 2E2FA 1OZZA 1SN4A 5EX5A 1L4VA 2LJMA 4HE7A 4UAEF 3I33A 1ZU3A 3FZLA 4H5NA 1ICAA 2V7ZA 2MBKA 4HHFA 2QWOA 2ASCA 2YEOA 3KHWA 1C55A 3D2FB 3KOYA 1ATRA 1T7EA 3LDNA 1NGHA 2YIOA 5AQIA 5FPNA 1BA0A 1LQQA 1HX1A 2M8BB 2YBRC 3E7RL 5AR0A 2JDQD 3L56A 5BPMA
chains in the Genus database with same CATH topology
1DQ7A 1SEGA 1BCGA 2E3GA 3E7UX 1BRZA 1TI5A 2KPYA 2E3FA 2N2RA 1JZAA 2MZ0A 2SN3A 1LQIA 2A7TA 1SN1A 2BRZA 1JKZA 1ZVEA 2E0HA 2B68A 5KK4A 1CHZA 1ZYWA 1B7DA 2YC1C 1AYJA 2KBJA 1NH5A 3PSMA 2LI7A 1VNAA 1L4VA 4AB0A 2KYQA 1P00A 2LJ7A 1SNBA 2LY5A 1B3CA 1JXCA 1NPIA 1T7AA 1C56A 1WT7A 1MYNA 2N69A 1I2VA 1I6FA 1ZFUA 2NY8X 2GL1A 1JZBA 1I2UA 1FH3A 1WMTA 2LT8A 5CY0A 2KJAA 1BMRA 1DJTA 1BK8A 4KYPA 2I61A 1GPTA 2LY6A 1T1TA 2ATBA 2KGQA 4UJ0A 1PE4A 1AHOA 2KBKA 1I6GA 4AEIA 2B3CA 1P0AA 2KBHA 1T7BA 2N66A 1KV0A 1T0ZA 1CN2A 1NRAA 2LR3A 2LKBA 1NRBA 4CQKA 1ZUTA 2N2QA 4AAZA 4V1DC 1PX9A 1ZVGA 2KSKA 1LQHA 1VNBA 1MR4A 1WWNA 1NE5A 1OMYA 1PTXA 2NY9X 1GPSA 1ZYVA 1N4NA 1OZZA 1SN4A 2LJMA 4HE7A 1ZU3A 1ICAA 4HHFA 2ASCA 2YEOA 1C55A 1T7EA 1LQQA 2M8BB 2YBRC 3E7RL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQ7 A;  1SEG A;  1BCG A;  2E3G A;  3E7U X;  1BRZ A;  1TI5 A;  2KPY A;  2E3F A;  2N2R A;  1JZA A;  2MZ0 A;  2SN3 A;  1LQI A;  2A7T A;  1SN1 A;  2BRZ A;  1JKZ A;  1ZVE A;  2E0H A;  2B68 A;  5KK4 A;  1CHZ A;  1ZYW A;  1B7D A;  2YC1 C;  1AYJ A;  2KBJ A;  1NH5 A;  3PSM A;  2LI7 A;  1VNA A;  1L4V A;  4AB0 A;  2KYQ A;  1P00 A;  2LJ7 A;  1SNB A;  2LY5 A;  1B3C A;  1JXC A;  1NPI A;  1T7A A;  1C56 A;  1WT7 A;  1MYN A;  2N69 A;  1I2V A;  1I6F A;  1ZFU A;  2NY8 X;  2GL1 A;  1JZB A;  1I2U A;  1FH3 A;  1WMT A;  2LT8 A;  5CY0 A;  2KJA A;  1BMR A;  1DJT A;  1BK8 A;  4KYP A;  2I61 A;  1GPT A;  2LY6 A;  1T1T A;  2ATB A;  2KGQ A;  4UJ0 A;  1PE4 A;  1AHO A;  2KBK A;  1I6G A;  4AEI A;  2B3C A;  1P0A A;  2KBH A;  1T7B A;  2N66 A;  1KV0 A;  1T0Z A;  1CN2 A;  1NRA A;  2LR3 A;  2LKB A;  1NRB A;  4CQK A;  1ZUT A;  2N2Q A;  4AAZ A;  4V1D C;  1PX9 A;  1ZVG A;  2KSK A;  1LQH A;  1VNB A;  1MR4 A;  1WWN A;  1NE5 A;  1OMY A;  1PTX A;  2NY9 X;  1GPS A;  1ZYV A;  1N4N A;  1OZZ A;  1SN4 A;  2LJM A;  4HE7 A;  1ZU3 A;  1ICA A;  4HHF A;  2ASC A;  2YEO A;  1C55 A;  1T7E A;  1LQQ A;  2M8B B;  2YBR C;  3E7R L; 
#chains in the Genus database with same CATH topology
 5AQN A;  1DQ7 A;  1SEG A;  1BCG A;  2E3G A;  3E7U X;  2LN8 A;  4H5R A;  1BRZ A;  1NGI A;  1YUW A;  1TI5 A;  2KPY A;  2QWN A;  3LDQ A;  2E3F A;  2N2R A;  3JXU A;  1NGD A;  5AQH A;  1JZA A;  3ATV A;  3CQX A;  2MZ0 A;  2SN3 A;  3D2E B;  1LQI A;  5AQG A;  5FPM A;  2A7T A;  4KBO A;  5AQX A;  1SN1 A;  2BRZ A;  1JKZ A;  1ZVE A;  2E0H A;  2B68 A;  1ATS A;  1POI A;  1CHZ A;  2QWQ A;  3KOZ A;  5KK4 A;  1ZYW A;  2QWP A;  1B7D A;  2YC1 C;  1AYJ A;  5AQW A;  2KBJ A;  3IUC A;  1NH5 A;  3PSM A;  2LI7 A;  1VNA A;  3ATU A;  3KP0 A;  3R2V A;  2KYQ A;  4H5W A;  4AB0 A;  3QML A;  2BUP A;  1P00 A;  5FPD A;  5AQT A;  1NGB A;  2LJ7 A;  1SNB A;  1HPM A;  3L6Q A;  2LY5 A;  5AQL A;  1KAY A;  3C7N A;  4FL9 A;  5AQQ A;  5F0X A;  4H5T A;  3AY9 A;  3SF4 D;  1B3C A;  1NGG A;  1JXC A;  1NPI A;  1T7A A;  1C56 A;  1WT7 A;  4GNI A;  4H5V A;  1MYN A;  3FZK A;  4FSV A;  5AQV A;  2N69 A;  3FZF A;  1QQO A;  2VY6 A;  2YIL A;  1I6F A;  1I2V A;  3QFP A;  3A8Y A;  5F1X A;  5AQP A;  1ZFU A;  2NY8 X;  1KAZ A;  2GL1 A;  2MN5 A;  1JZB A;  2QWR A;  5AQO A;  1FH3 A;  1WMT A;  1I2U A;  2LT8 A;  2QWM A;  5AQS A;  2E88 A;  1NGC A;  2G2K A;  2KJA A;  5CY0 A;  3KP1 A;  1NGF A;  3D2F A;  3KOW A;  5AQU A;  1BMR A;  1NGE A;  1DJT A;  1QQN A;  3QFU A;  5BPN A;  3L4I A;  4KYP A;  1BK8 A;  3HSC A;  3FZM A;  3KOX A;  2I61 A;  5AQF A;  2LY6 A;  1GPT A;  1BA1 A;  1XRS B;  3FE1 A;  3KC6 A;  1BUP A;  1T1T A;  3M3Z A;  5AQY A;  2ATB A;  4HWI A;  5EVZ A;  3CW4 A;  2KGQ A;  5BPL A;  3GDQ A;  4UJ0 A;  5AQM A;  1PE4 A;  1AHO A;  2KBK A;  5EY4 A;  3FZH A;  1I6G A;  4AEI A;  3D2E A;  2B3C A;  5F2R A;  2QXL A;  1HJO A;  1NGA A;  2QW9 A;  3KVG A;  5BN9 A;  1P0A A;  2KBH A;  4UAF E;  1T7B A;  3LDO A;  2N66 A;  3GKU A;  1S3X A;  4UAD E;  1KV0 A;  1T0Z A;  3GL1 A;  2GMO A;  1CN2 A;  1NRA A;  2LR3 A;  2LKB A;  5AQJ A;  2D56 A;  2K35 A;  1NRB A;  1NGJ A;  3LDP A;  2E8A A;  4CQK A;  1ZUT A;  5BN8 A;  1DKG D;  2N2Q A;  4AAZ A;  3QI7 A;  1KAX A;  4V1D C;  2KHO A;  1PX9 A;  1ZVG A;  2KSK A;  5AQR A;  5EXW A;  2YIP A;  3C7N B;  1LQH A;  3LDL A;  4IO8 A;  5AQZ A;  1VNB A;  2QWL A;  5AQK A;  5FPE A;  1MR4 A;  1K8B A;  1WWN A;  1NE5 A;  1OMY A;  1PTX A;  2NY9 X;  1QQM A;  1UGL A;  1ZYV A;  3BK3 C;  1N4N A;  1GPS A;  2E2F A;  1OZZ A;  1SN4 A;  5EX5 A;  1L4V A;  2LJM A;  4HE7 A;  4UAE F;  3I33 A;  1ZU3 A;  3FZL A;  4H5N A;  1ICA A;  2V7Z A;  2MBK A;  4HHF A;  2QWO A;  2ASC A;  2YEO A;  3KHW A;  1C55 A;  3D2F B;  3KOY A;  1ATR A;  1T7E A;  3LDN A;  1NGH A;  2YIO A;  5AQI A;  5FPN A;  1BA0 A;  1LQQ A;  1HX1 A;  2M8B B;  2YBR C;  3E7R L;  5AR0 A;  2JDQ D;  3L56 A;  5BPM A; 
#chains in the Genus database with same CATH homology
 1DQ7 A;  1SEG A;  1BCG A;  2E3G A;  3E7U X;  1BRZ A;  1TI5 A;  2KPY A;  2E3F A;  2N2R A;  1JZA A;  2MZ0 A;  2SN3 A;  1LQI A;  2A7T A;  1SN1 A;  2BRZ A;  1JKZ A;  1ZVE A;  2E0H A;  2B68 A;  5KK4 A;  1CHZ A;  1ZYW A;  1B7D A;  2YC1 C;  1AYJ A;  2KBJ A;  1NH5 A;  3PSM A;  2LI7 A;  1VNA A;  1L4V A;  4AB0 A;  2KYQ A;  1P00 A;  2LJ7 A;  1SNB A;  2LY5 A;  1B3C A;  1JXC A;  1NPI A;  1T7A A;  1C56 A;  1WT7 A;  1MYN A;  2N69 A;  1I2V A;  1I6F A;  1ZFU A;  2NY8 X;  2GL1 A;  1JZB A;  1I2U A;  1FH3 A;  1WMT A;  2LT8 A;  5CY0 A;  2KJA A;  1BMR A;  1DJT A;  1BK8 A;  4KYP A;  2I61 A;  1GPT A;  2LY6 A;  1T1T A;  2ATB A;  2KGQ A;  4UJ0 A;  1PE4 A;  1AHO A;  2KBK A;  1I6G A;  4AEI A;  2B3C A;  1P0A A;  2KBH A;  1T7B A;  2N66 A;  1KV0 A;  1T0Z A;  1CN2 A;  1NRA A;  2LR3 A;  2LKB A;  1NRB A;  4CQK A;  1ZUT A;  2N2Q A;  4AAZ A;  4V1D C;  1PX9 A;  1ZVG A;  2KSK A;  1LQH A;  1VNB A;  1MR4 A;  1WWN A;  1NE5 A;  1OMY A;  1PTX A;  2NY9 X;  1GPS A;  1ZYV A;  1N4N A;  1OZZ A;  1SN4 A;  2LJM A;  4HE7 A;  1ZU3 A;  1ICA A;  4HHF A;  2ASC A;  2YEO A;  1C55 A;  1T7E A;  1LQQ A;  2M8B B;  2YBR C;  3E7R L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...