2N69A

Nmr structure of non-sweet mutant (ins18ri19) of sweet protein brazzein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Defensin-like protein
publication title NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb
source organism Pentadiplandra brazzeana
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n69A00
1ZUTA 1JZAA 1I6FA 5KK4A 2I61A 1WWNA 1AYJA 1CN2A 1VNAA 2LR3A 1NPIA 1SEGA 1B3CA 1JZBA 2E3FA 1LQQA 1ZU3A 1ZVEA 4CQKA 2LY6A 1T0ZA 1P0AA 1GPTA 1VNBA 1N4NA 1ICAA 1T7AA 1ZYVA 1OMYA 1T7BA 1TI5A 1WT7A 2NY9X 2SN3A 3E7RL 2KBJA 2KBHA 1ZFUA 4UJ0A 1P00A 1I2VA 1PX9A 4AB0A 2NY8X 2E0HA 1GPSA 2B68A 2N2RA 2YEOA 1SNBA 2YBRC 4V1DC 2KJAA 1OZZA 1NE5A 1ZYWA 4AEIA 2MZ0A 1BK8A 2E3GA 3E7UX 2N69A 4KYPA 4HHFA 2M8BB 2ATBA 1JXCA 2LY5A 4AAZA 2ASCA 2B3CA 3PSMA 1SN1A 1DQ7A 1L4VA 5CY0A 1ZVGA 2LKBA 1KV0A 1NH5A 2KGQA 2YC1C 1PE4A 1T1TA 2N2QA 1LQIA 2KYQA 1I6GA 1PTXA 1MR4A 2KBKA 1BRZA 2KPYA 2N66A 1T7EA 1C55A 2GL1A 1JKZA 1C56A 2LT8A 1BMRA 1DJTA 2BRZA 2KSKA 1FH3A 2A7TA 1CHZA 1WMTA 1AHOA 1BCGA 1NRBA 1SN4A 2LJ7A 1LQHA 1NRAA 1MYNA 2LJMA 4HE7A 2LI7A 1B7DA 1I2UA
chains in the Genus database with same CATH superfamily
1BUPA 3KC6A 3LDPA 3L56A 2YILA 2QWOA 1ZUTA 5AQRA 1JZAA 5AQKA 3KP0A 3QFPA 1I6FA 5KK4A 5FPDA 2I61A 1WWNA 3C7NA 1AYJA 2MBKA 4IO8A 5AQQA 3FE1A 1VNAA 1QQNA 2LR3A 1CN2A 1NGCA 1NPIA 2QWNA 4UADE 1NGDA 1SEGA 3SF4D 1B3CA 1JZBA 2E3FA 1LQQA 3D2FB 1NGGA 1BA0A 1ZU3A 1ZVEA 2JDQD 2LY6A 1T0ZA 1P0AA 2QWRA 3BK3C 1VNBA 4KBOA 5AQHA 5BPLA 1GPTA 1KAXA 1N4NA 3KVGA 5AQJA 5BN8A 5FPEA 5FPMA 3LDNA 1ICAA 5EX5A 1T7AA 3L6QA 3GL1A 2G2KA 1ZYVA 3QMLA 5AQXA 1OMYA 1T7BA 1TI5A 1WT7A 2NY9X 2SN3A 2V7ZA 3D2EB 3E7RL 3KOWA 5EVZA 5F2RA 1I6GA 3CQXA 2KBJA 2KBHA 2E8AA 1ZFUA 2QWPA 2D56A 5AQOA 4UJ0A 1P00A 5EXWA 1I2VA 1K8BA 1PX9A 4AB0A 2NY8X 2E0HA 1GPSA 3KOZA 1HJOA 5AQLA 2KHOA 1QQMA 5AQGA 2B68A 2N2RA 3FZHA 2YEOA 1SNBA 3LDOA 2YBRC 3JXUA 5BPNA 4V1DC 3KP1A 5F0XA 4UAEF 3FZLA 2KJAA 1OZZA 1NGJA 3GKUA 1NE5A 1ZYWA 2MN5A 2GMOA 3KOXA 3QFUA 4AEIA 2QWMA 2MZ0A 1BK8A 2E3GA 3LDQA 3E7UX 2N69A 1POIA 1YUWA 4KYPA 4HHFA 2M8BB 4FL9A 5AQUA 2ATBA 1JXCA 1NGEA 2LY5A 3HSCA 4AAZA 2K35A 2ASCA 3ATUA 2B3CA 3C7NB 3PSMA 1SN1A 3LDLA 3M3ZA 4H5NA 5FPNA 1NGIA 4H5RA 5F1XA 1ATRA 1DQ7A 4HWIA 1L4VA 5CY0A 3CW4A 1ZVGA 4FSVA 2LKBA 1KV0A 1DKGD 1NH5A 2QWLA 1NGBA 2KGQA 2QXLA 5AQTA 1XRSB 2YC1C 3D2FA 1PE4A 1T1TA 1KAZA 1HX1A 1UGLA 2E88A 4H5VA 4H5WA 1BA1A 2N2QA 1S3XA 3GDQA 1LQIA 2KYQA 5BPMA 1PTXA 1MR4A 2KBKA 4UAFE 5AQMA 2LN8A 1NGFA 3R2VA 5AQVA 1BRZA 1HPMA 2KPYA 2N66A 3A8YA 2QW9A 1T7EA 2YIPA 3FZFA 1C55A 2GL1A 2VY6A 3KHWA 1NGAA 1JKZA 1C56A 2LT8A 3D2EA 3FZMA 5AQFA 1BMRA 1DJTA 5AQIA 2BRZA 2KSKA 1FH3A 1ATSA 5AQWA 2A7TA 1CHZA 1WMTA 5BN9A 1AHOA 2QWQA 1BCGA 3QI7A 1NGHA 5AQSA 4GNIA 1NRBA 3L4IA 1SN4A 3ATVA 2LJ7A 5AR0A 1LQHA 1KAYA 3IUCA 5AQZA 1QQOA 1NRAA 1MYNA 3AY9A 3FZKA 3KOYA 2LJMA 5AQNA 4HE7A 5AQYA 2BUPA 5AQPA 2YIOA 3I33A 4CQKA 5EY4A 2LI7A 1B7DA 1I2UA 4H5TA 2E2FA
chains in the Genus database with same CATH topology
1ZUTA 1JZAA 1I6FA 5KK4A 2I61A 1WWNA 1AYJA 1CN2A 1VNAA 2LR3A 1NPIA 1SEGA 1B3CA 1JZBA 2E3FA 1LQQA 1ZU3A 1ZVEA 4CQKA 2LY6A 1T0ZA 1P0AA 1GPTA 1VNBA 1N4NA 1ICAA 1T7AA 1ZYVA 1OMYA 1T7BA 1TI5A 1WT7A 2NY9X 2SN3A 3E7RL 2KBJA 2KBHA 1ZFUA 4UJ0A 1P00A 1I2VA 1PX9A 4AB0A 2NY8X 2E0HA 1GPSA 2B68A 2N2RA 2YEOA 1SNBA 2YBRC 4V1DC 2KJAA 1OZZA 1NE5A 1ZYWA 4AEIA 2MZ0A 1BK8A 2E3GA 3E7UX 2N69A 4KYPA 4HHFA 2M8BB 2ATBA 1JXCA 2LY5A 4AAZA 2ASCA 2B3CA 3PSMA 1SN1A 1DQ7A 1L4VA 5CY0A 1ZVGA 2LKBA 1KV0A 1NH5A 2KGQA 2YC1C 1PE4A 1T1TA 2N2QA 1LQIA 2KYQA 1I6GA 1PTXA 1MR4A 2KBKA 1BRZA 2KPYA 2N66A 1T7EA 1C55A 2GL1A 1JKZA 1C56A 2LT8A 1BMRA 1DJTA 2BRZA 2KSKA 1FH3A 2A7TA 1CHZA 1WMTA 1AHOA 1BCGA 1NRBA 1SN4A 2LJ7A 1LQHA 1NRAA 1MYNA 2LJMA 4HE7A 2LI7A 1B7DA 1I2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUT A;  1JZA A;  1I6F A;  5KK4 A;  2I61 A;  1WWN A;  1AYJ A;  1CN2 A;  1VNA A;  2LR3 A;  1NPI A;  1SEG A;  1B3C A;  1JZB A;  2E3F A;  1LQQ A;  1ZU3 A;  1ZVE A;  4CQK A;  2LY6 A;  1T0Z A;  1P0A A;  1GPT A;  1VNB A;  1N4N A;  1ICA A;  1T7A A;  1ZYV A;  1OMY A;  1T7B A;  1TI5 A;  1WT7 A;  2NY9 X;  2SN3 A;  3E7R L;  2KBJ A;  2KBH A;  1ZFU A;  4UJ0 A;  1P00 A;  1I2V A;  1PX9 A;  4AB0 A;  2NY8 X;  2E0H A;  1GPS A;  2B68 A;  2N2R A;  2YEO A;  1SNB A;  2YBR C;  4V1D C;  2KJA A;  1OZZ A;  1NE5 A;  1ZYW A;  4AEI A;  2MZ0 A;  1BK8 A;  2E3G A;  3E7U X;  2N69 A;  4KYP A;  4HHF A;  2M8B B;  2ATB A;  1JXC A;  2LY5 A;  4AAZ A;  2ASC A;  2B3C A;  3PSM A;  1SN1 A;  1DQ7 A;  1L4V A;  5CY0 A;  1ZVG A;  2LKB A;  1KV0 A;  1NH5 A;  2KGQ A;  2YC1 C;  1PE4 A;  1T1T A;  2N2Q A;  1LQI A;  2KYQ A;  1I6G A;  1PTX A;  1MR4 A;  2KBK A;  1BRZ A;  2KPY A;  2N66 A;  1T7E A;  1C55 A;  2GL1 A;  1JKZ A;  1C56 A;  2LT8 A;  1BMR A;  1DJT A;  2BRZ A;  2KSK A;  1FH3 A;  2A7T A;  1CHZ A;  1WMT A;  1AHO A;  1BCG A;  1NRB A;  1SN4 A;  2LJ7 A;  1LQH A;  1NRA A;  1MYN A;  2LJM A;  4HE7 A;  2LI7 A;  1B7D A;  1I2U A; 
#chains in the Genus database with same CATH topology
 1BUP A;  3KC6 A;  3LDP A;  3L56 A;  2YIL A;  2QWO A;  1ZUT A;  5AQR A;  1JZA A;  5AQK A;  3KP0 A;  3QFP A;  1I6F A;  5KK4 A;  5FPD A;  2I61 A;  1WWN A;  3C7N A;  1AYJ A;  2MBK A;  4IO8 A;  5AQQ A;  3FE1 A;  1VNA A;  1QQN A;  2LR3 A;  1CN2 A;  1NGC A;  1NPI A;  2QWN A;  4UAD E;  1NGD A;  1SEG A;  3SF4 D;  1B3C A;  1JZB A;  2E3F A;  1LQQ A;  3D2F B;  1NGG A;  1BA0 A;  1ZU3 A;  1ZVE A;  2JDQ D;  2LY6 A;  1T0Z A;  1P0A A;  2QWR A;  3BK3 C;  1VNB A;  4KBO A;  5AQH A;  5BPL A;  1GPT A;  1KAX A;  1N4N A;  3KVG A;  5AQJ A;  5BN8 A;  5FPE A;  5FPM A;  3LDN A;  1ICA A;  5EX5 A;  1T7A A;  3L6Q A;  3GL1 A;  2G2K A;  1ZYV A;  3QML A;  5AQX A;  1OMY A;  1T7B A;  1TI5 A;  1WT7 A;  2NY9 X;  2SN3 A;  2V7Z A;  3D2E B;  3E7R L;  3KOW A;  5EVZ A;  5F2R A;  1I6G A;  3CQX A;  2KBJ A;  2KBH A;  2E8A A;  1ZFU A;  2QWP A;  2D56 A;  5AQO A;  4UJ0 A;  1P00 A;  5EXW A;  1I2V A;  1K8B A;  1PX9 A;  4AB0 A;  2NY8 X;  2E0H A;  1GPS A;  3KOZ A;  1HJO A;  5AQL A;  2KHO A;  1QQM A;  5AQG A;  2B68 A;  2N2R A;  3FZH A;  2YEO A;  1SNB A;  3LDO A;  2YBR C;  3JXU A;  5BPN A;  4V1D C;  3KP1 A;  5F0X A;  4UAE F;  3FZL A;  2KJA A;  1OZZ A;  1NGJ A;  3GKU A;  1NE5 A;  1ZYW A;  2MN5 A;  2GMO A;  3KOX A;  3QFU A;  4AEI A;  2QWM A;  2MZ0 A;  1BK8 A;  2E3G A;  3LDQ A;  3E7U X;  2N69 A;  1POI A;  1YUW A;  4KYP A;  4HHF A;  2M8B B;  4FL9 A;  5AQU A;  2ATB A;  1JXC A;  1NGE A;  2LY5 A;  3HSC A;  4AAZ A;  2K35 A;  2ASC A;  3ATU A;  2B3C A;  3C7N B;  3PSM A;  1SN1 A;  3LDL A;  3M3Z A;  4H5N A;  5FPN A;  1NGI A;  4H5R A;  5F1X A;  1ATR A;  1DQ7 A;  4HWI A;  1L4V A;  5CY0 A;  3CW4 A;  1ZVG A;  4FSV A;  2LKB A;  1KV0 A;  1DKG D;  1NH5 A;  2QWL A;  1NGB A;  2KGQ A;  2QXL A;  5AQT A;  1XRS B;  2YC1 C;  3D2F A;  1PE4 A;  1T1T A;  1KAZ A;  1HX1 A;  1UGL A;  2E88 A;  4H5V A;  4H5W A;  1BA1 A;  2N2Q A;  1S3X A;  3GDQ A;  1LQI A;  2KYQ A;  5BPM A;  1PTX A;  1MR4 A;  2KBK A;  4UAF E;  5AQM A;  2LN8 A;  1NGF A;  3R2V A;  5AQV A;  1BRZ A;  1HPM A;  2KPY A;  2N66 A;  3A8Y A;  2QW9 A;  1T7E A;  2YIP A;  3FZF A;  1C55 A;  2GL1 A;  2VY6 A;  3KHW A;  1NGA A;  1JKZ A;  1C56 A;  2LT8 A;  3D2E A;  3FZM A;  5AQF A;  1BMR A;  1DJT A;  5AQI A;  2BRZ A;  2KSK A;  1FH3 A;  1ATS A;  5AQW A;  2A7T A;  1CHZ A;  1WMT A;  5BN9 A;  1AHO A;  2QWQ A;  1BCG A;  3QI7 A;  1NGH A;  5AQS A;  4GNI A;  1NRB A;  3L4I A;  1SN4 A;  3ATV A;  2LJ7 A;  5AR0 A;  1LQH A;  1KAY A;  3IUC A;  5AQZ A;  1QQO A;  1NRA A;  1MYN A;  3AY9 A;  3FZK A;  3KOY A;  2LJM A;  5AQN A;  4HE7 A;  5AQY A;  2BUP A;  5AQP A;  2YIO A;  3I33 A;  4CQK A;  5EY4 A;  2LI7 A;  1B7D A;  1I2U A;  4H5T A;  2E2F A; 
#chains in the Genus database with same CATH homology
 1ZUT A;  1JZA A;  1I6F A;  5KK4 A;  2I61 A;  1WWN A;  1AYJ A;  1CN2 A;  1VNA A;  2LR3 A;  1NPI A;  1SEG A;  1B3C A;  1JZB A;  2E3F A;  1LQQ A;  1ZU3 A;  1ZVE A;  4CQK A;  2LY6 A;  1T0Z A;  1P0A A;  1GPT A;  1VNB A;  1N4N A;  1ICA A;  1T7A A;  1ZYV A;  1OMY A;  1T7B A;  1TI5 A;  1WT7 A;  2NY9 X;  2SN3 A;  3E7R L;  2KBJ A;  2KBH A;  1ZFU A;  4UJ0 A;  1P00 A;  1I2V A;  1PX9 A;  4AB0 A;  2NY8 X;  2E0H A;  1GPS A;  2B68 A;  2N2R A;  2YEO A;  1SNB A;  2YBR C;  4V1D C;  2KJA A;  1OZZ A;  1NE5 A;  1ZYW A;  4AEI A;  2MZ0 A;  1BK8 A;  2E3G A;  3E7U X;  2N69 A;  4KYP A;  4HHF A;  2M8B B;  2ATB A;  1JXC A;  2LY5 A;  4AAZ A;  2ASC A;  2B3C A;  3PSM A;  1SN1 A;  1DQ7 A;  1L4V A;  5CY0 A;  1ZVG A;  2LKB A;  1KV0 A;  1NH5 A;  2KGQ A;  2YC1 C;  1PE4 A;  1T1T A;  2N2Q A;  1LQI A;  2KYQ A;  1I6G A;  1PTX A;  1MR4 A;  2KBK A;  1BRZ A;  2KPY A;  2N66 A;  1T7E A;  1C55 A;  2GL1 A;  1JKZ A;  1C56 A;  2LT8 A;  1BMR A;  1DJT A;  2BRZ A;  2KSK A;  1FH3 A;  2A7T A;  1CHZ A;  1WMT A;  1AHO A;  1BCG A;  1NRB A;  1SN4 A;  2LJ7 A;  1LQH A;  1NRA A;  1MYN A;  2LJM A;  4HE7 A;  2LI7 A;  1B7D A;  1I2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...