2N69A

Nmr structure of non-sweet mutant (ins18ri19) of sweet protein brazzein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb
source organism Pentadiplandra brazzeana
molecule tags Plant protein
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n69A00
2M8BB 2KJAA 1N4NA 2NY9X 1SNBA 2LR3A 1OZZA 1JKZA 1ZYVA 2N66A 1C56A 3E7UX 2LY5A 2NY8X 2B3CA 2MZ0A 1OMYA 2ASCA 2KYQA 5KK4A 1ZUTA 2BRZA 1ZU3A 2N2QA 1PE4A 2KPYA 1PX9A 2LT8A 4KYPA 2YBRC 1I6GA 1NH5A 2KSKA 1B3CA 5CY0A 1JZAA 1P00A 1AHOA 1BK8A 1NPIA 1VNAA 1NRAA 2LKBA 4CQKA 1L4VA 2E0HA 2YC1C 1T7EA 2SN3A 1WWNA 2LY6A 2YEOA 1ZVEA 2A7TA 1CHZA 1P0AA 1PTXA 1GPSA 2B68A 2GL1A 1NE5A 1I2VA 3PSMA 1VNBA 2ATBA 2LJ7A 1T7AA 2E3GA 2E3FA 1BRZA 1ZVGA 1T7BA 1ZFUA 3E7RL 4V1DC 1LQHA 1I2UA 1MYNA 1AYJA 2LJMA 1KV0A 1C55A 2LI7A 1WMTA 1LQQA 4HE7A 1ZYWA 2N69A 1ICAA 1JXCA 2KBHA 1SN1A 1DQ7A 2N2RA 1CN2A 1T1TA 2KBJA 4AB0A 1DJTA 4AEIA 1LQIA 1NRBA 1I6FA 1TI5A 1WT7A 2I61A 1BMRA 1BCGA 1GPTA 2KGQA 1B7DA 1SN4A 4HHFA 2KBKA 1JZBA 1SEGA 1T0ZA 1MR4A 4AAZA 1FH3A 4UJ0A
chains in the Genus database with same CATH superfamily
2M8BB 2KJAA 3GDQA 1N4NA 5EX5A 3LDOA 2NY9X 3KHWA 1SNBA 3FZKA 2LR3A 1OZZA 1JKZA 3BK3C 5AQMA 2KHOA 5AQWA 5FPNA 1ZYVA 2N66A 1KAZA 2YIOA 1C56A 3IUCA 2V7ZA 2LN8A 3E7UX 3FZMA 3D2FB 5EVZA 1BA0A 2LY5A 2NY8X 2B3CA 2MZ0A 3FZHA 3KVGA 3KOZA 4H5NA 1OMYA 3QFUA 1BA1A 2ASCA 1NGEA 3LDQA 3GL1A 5F0XA 5AQNA 2YILA 3JXUA 5AQPA 2KYQA 3CQXA 5KK4A 1ZUTA 4UAEF 3HSCA 5AQSA 2QWPA 2QWRA 2BRZA 5BPLA 2E88A 1ZU3A 2N2QA 1XRSB 1PE4A 1UGLA 2KPYA 5AQQA 1PX9A 2LT8A 4KYPA 2YBRC 1I6GA 1NH5A 5AQJA 2KSKA 2BUPA 5AQOA 1B3CA 4H5VA 3KOWA 1JZAA 1P00A 1QQMA 3I33A 1AHOA 2QWNA 5CY0A 1HPMA 1NPIA 1VNAA 3ATVA 4AAZA 1BK8A 1NRAA 2LKBA 4CQKA 1L4VA 2E0HA 2YC1C 3QMLA 5AQRA 1T7EA 2QWMA 2SN3A 3L4IA 1KAYA 5AQLA 1NGIA 5F2RA 1WWNA 3QFPA 2LY6A 2VY6A 1NGBA 2YEOA 5AQZA 1HX1A 1ZVEA 1NGAA 2E2FA 2QWLA 3C7NB 2YIPA 3FZFA 3C7NA 2A7TA 1CHZA 5EY4A 5AQUA 5BN9A 1P0AA 3D2EB 1PTXA 3R2VA 5AR0A 1GPSA 4KBOA 2B68A 2GL1A 1NE5A 3KOXA 3D2EA 5AQFA 2MBKA 1BUPA 1I2VA 3LDPA 3PSMA 5BN8A 5FPEA 3GKUA 1VNBA 2ATBA 3L56A 3M3ZA 2GMOA 1K8BA 5FPDA 2QWQA 4IO8A 2LJ7A 3QI7A 1T7AA 2E3GA 1NGDA 1S3XA 2E3FA 1BRZA 1ZVGA 1T7BA 1ZFUA 3KOYA 4H5WA 3E7RL 3KC6A 4V1DC 1LQHA 5AQGA 2QWOA 5F1XA 1NGCA 1YUWA 1I2UA 1MYNA 4H5RA 1AYJA 2LJMA 3AY9A 3KP1A 1KV0A 5AQKA 1C55A 2LI7A 1WMTA 1HJOA 5AQYA 2JDQD 1LQQA 4HE7A 1ZYWA 2N69A 1QQNA 4FSVA 5BPNA 1JXCA 1DQ7A 1SN1A 2KBHA 2MN5A 2N2RA 1ATSA 1ICAA 3LDLA 1CN2A 1T1TA 2KBJA 4AB0A 3FZLA 5AQXA 4HWIA 5FPMA 1DKGD 1DJTA 1NGGA 5AQIA 2D56A 3SF4D 1POIA 3A8YA 5AQHA 5AQTA 5BPMA 4AEIA 1LQIA 1ATRA 1I6FA 1NGFA 1NRBA 1TI5A 1WT7A 3L6QA 2I61A 1KAXA 4FL9A 2QXLA 3D2FA 1BMRA 4UJ0A 3ATUA 1BCGA 1GPTA 5EXWA 1NGJA 2K35A 2KGQA 5AQVA 1B7DA 1QQOA 2QW9A 4UAFE 1NGHA 1SN4A 3LDNA 4HHFA 4UADE 2KBKA 4H5TA 1JZBA 1SEGA 3FE1A 1T0ZA 2G2KA 2E8AA 1MR4A 3CW4A 4GNIA 1FH3A 3KP0A
chains in the Genus database with same CATH topology
2M8BB 2KJAA 1N4NA 2NY9X 1SNBA 2LR3A 1OZZA 1JKZA 1ZYVA 2N66A 1C56A 3E7UX 2LY5A 2NY8X 2B3CA 2MZ0A 1OMYA 2ASCA 2KYQA 5KK4A 1ZUTA 2BRZA 1ZU3A 2N2QA 1PE4A 2KPYA 1PX9A 2LT8A 4KYPA 2YBRC 1I6GA 1NH5A 2KSKA 1B3CA 5CY0A 1JZAA 1P00A 1AHOA 1BK8A 1NPIA 1VNAA 1NRAA 2LKBA 4CQKA 1L4VA 2E0HA 2YC1C 1T7EA 2SN3A 1WWNA 2LY6A 2YEOA 1ZVEA 2A7TA 1CHZA 1P0AA 1PTXA 1GPSA 2B68A 2GL1A 1NE5A 1I2VA 3PSMA 1VNBA 2ATBA 2LJ7A 1T7AA 2E3GA 2E3FA 1BRZA 1ZVGA 1T7BA 1ZFUA 3E7RL 4V1DC 1LQHA 1I2UA 1MYNA 1AYJA 2LJMA 1KV0A 1C55A 2LI7A 1WMTA 1LQQA 4HE7A 1ZYWA 2N69A 1ICAA 1JXCA 2KBHA 1SN1A 1DQ7A 2N2RA 1CN2A 1T1TA 2KBJA 4AB0A 1DJTA 4AEIA 1LQIA 1NRBA 1I6FA 1TI5A 1WT7A 2I61A 1BMRA 1BCGA 1GPTA 2KGQA 1B7DA 1SN4A 4HHFA 2KBKA 1JZBA 1SEGA 1T0ZA 1MR4A 4AAZA 1FH3A 4UJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8B B;  2KJA A;  1N4N A;  2NY9 X;  1SNB A;  2LR3 A;  1OZZ A;  1JKZ A;  1ZYV A;  2N66 A;  1C56 A;  3E7U X;  2LY5 A;  2NY8 X;  2B3C A;  2MZ0 A;  1OMY A;  2ASC A;  2KYQ A;  5KK4 A;  1ZUT A;  2BRZ A;  1ZU3 A;  2N2Q A;  1PE4 A;  2KPY A;  1PX9 A;  2LT8 A;  4KYP A;  2YBR C;  1I6G A;  1NH5 A;  2KSK A;  1B3C A;  5CY0 A;  1JZA A;  1P00 A;  1AHO A;  1BK8 A;  1NPI A;  1VNA A;  1NRA A;  2LKB A;  4CQK A;  1L4V A;  2E0H A;  2YC1 C;  1T7E A;  2SN3 A;  1WWN A;  2LY6 A;  2YEO A;  1ZVE A;  2A7T A;  1CHZ A;  1P0A A;  1PTX A;  1GPS A;  2B68 A;  2GL1 A;  1NE5 A;  1I2V A;  3PSM A;  1VNB A;  2ATB A;  2LJ7 A;  1T7A A;  2E3G A;  2E3F A;  1BRZ A;  1ZVG A;  1T7B A;  1ZFU A;  3E7R L;  4V1D C;  1LQH A;  1I2U A;  1MYN A;  1AYJ A;  2LJM A;  1KV0 A;  1C55 A;  2LI7 A;  1WMT A;  1LQQ A;  4HE7 A;  1ZYW A;  2N69 A;  1ICA A;  1JXC A;  2KBH A;  1SN1 A;  1DQ7 A;  2N2R A;  1CN2 A;  1T1T A;  2KBJ A;  4AB0 A;  1DJT A;  4AEI A;  1LQI A;  1NRB A;  1I6F A;  1TI5 A;  1WT7 A;  2I61 A;  1BMR A;  1BCG A;  1GPT A;  2KGQ A;  1B7D A;  1SN4 A;  4HHF A;  2KBK A;  1JZB A;  1SEG A;  1T0Z A;  1MR4 A;  4AAZ A;  1FH3 A;  4UJ0 A; 
#chains in the Genus database with same CATH topology
 2M8B B;  2KJA A;  3GDQ A;  1N4N A;  5EX5 A;  3LDO A;  2NY9 X;  3KHW A;  1SNB A;  3FZK A;  2LR3 A;  1OZZ A;  1JKZ A;  3BK3 C;  5AQM A;  2KHO A;  5AQW A;  5FPN A;  1ZYV A;  2N66 A;  1KAZ A;  2YIO A;  1C56 A;  3IUC A;  2V7Z A;  2LN8 A;  3E7U X;  3FZM A;  3D2F B;  5EVZ A;  1BA0 A;  2LY5 A;  2NY8 X;  2B3C A;  2MZ0 A;  3FZH A;  3KVG A;  3KOZ A;  4H5N A;  1OMY A;  3QFU A;  1BA1 A;  2ASC A;  1NGE A;  3LDQ A;  3GL1 A;  5F0X A;  5AQN A;  2YIL A;  3JXU A;  5AQP A;  2KYQ A;  3CQX A;  5KK4 A;  1ZUT A;  4UAE F;  3HSC A;  5AQS A;  2QWP A;  2QWR A;  2BRZ A;  5BPL A;  2E88 A;  1ZU3 A;  2N2Q A;  1XRS B;  1PE4 A;  1UGL A;  2KPY A;  5AQQ A;  1PX9 A;  2LT8 A;  4KYP A;  2YBR C;  1I6G A;  1NH5 A;  5AQJ A;  2KSK A;  2BUP A;  5AQO A;  1B3C A;  4H5V A;  3KOW A;  1JZA A;  1P00 A;  1QQM A;  3I33 A;  1AHO A;  2QWN A;  5CY0 A;  1HPM A;  1NPI A;  1VNA A;  3ATV A;  4AAZ A;  1BK8 A;  1NRA A;  2LKB A;  4CQK A;  1L4V A;  2E0H A;  2YC1 C;  3QML A;  5AQR A;  1T7E A;  2QWM A;  2SN3 A;  3L4I A;  1KAY A;  5AQL A;  1NGI A;  5F2R A;  1WWN A;  3QFP A;  2LY6 A;  2VY6 A;  1NGB A;  2YEO A;  5AQZ A;  1HX1 A;  1ZVE A;  1NGA A;  2E2F A;  2QWL A;  3C7N B;  2YIP A;  3FZF A;  3C7N A;  2A7T A;  1CHZ A;  5EY4 A;  5AQU A;  5BN9 A;  1P0A A;  3D2E B;  1PTX A;  3R2V A;  5AR0 A;  1GPS A;  4KBO A;  2B68 A;  2GL1 A;  1NE5 A;  3KOX A;  3D2E A;  5AQF A;  2MBK A;  1BUP A;  1I2V A;  3LDP A;  3PSM A;  5BN8 A;  5FPE A;  3GKU A;  1VNB A;  2ATB A;  3L56 A;  3M3Z A;  2GMO A;  1K8B A;  5FPD A;  2QWQ A;  4IO8 A;  2LJ7 A;  3QI7 A;  1T7A A;  2E3G A;  1NGD A;  1S3X A;  2E3F A;  1BRZ A;  1ZVG A;  1T7B A;  1ZFU A;  3KOY A;  4H5W A;  3E7R L;  3KC6 A;  4V1D C;  1LQH A;  5AQG A;  2QWO A;  5F1X A;  1NGC A;  1YUW A;  1I2U A;  1MYN A;  4H5R A;  1AYJ A;  2LJM A;  3AY9 A;  3KP1 A;  1KV0 A;  5AQK A;  1C55 A;  2LI7 A;  1WMT A;  1HJO A;  5AQY A;  2JDQ D;  1LQQ A;  4HE7 A;  1ZYW A;  2N69 A;  1QQN A;  4FSV A;  5BPN A;  1JXC A;  1DQ7 A;  1SN1 A;  2KBH A;  2MN5 A;  2N2R A;  1ATS A;  1ICA A;  3LDL A;  1CN2 A;  1T1T A;  2KBJ A;  4AB0 A;  3FZL A;  5AQX A;  4HWI A;  5FPM A;  1DKG D;  1DJT A;  1NGG A;  5AQI A;  2D56 A;  3SF4 D;  1POI A;  3A8Y A;  5AQH A;  5AQT A;  5BPM A;  4AEI A;  1LQI A;  1ATR A;  1I6F A;  1NGF A;  1NRB A;  1TI5 A;  1WT7 A;  3L6Q A;  2I61 A;  1KAX A;  4FL9 A;  2QXL A;  3D2F A;  1BMR A;  4UJ0 A;  3ATU A;  1BCG A;  1GPT A;  5EXW A;  1NGJ A;  2K35 A;  2KGQ A;  5AQV A;  1B7D A;  1QQO A;  2QW9 A;  4UAF E;  1NGH A;  1SN4 A;  3LDN A;  4HHF A;  4UAD E;  2KBK A;  4H5T A;  1JZB A;  1SEG A;  3FE1 A;  1T0Z A;  2G2K A;  2E8A A;  1MR4 A;  3CW4 A;  4GNI A;  1FH3 A;  3KP0 A; 
#chains in the Genus database with same CATH homology
 2M8B B;  2KJA A;  1N4N A;  2NY9 X;  1SNB A;  2LR3 A;  1OZZ A;  1JKZ A;  1ZYV A;  2N66 A;  1C56 A;  3E7U X;  2LY5 A;  2NY8 X;  2B3C A;  2MZ0 A;  1OMY A;  2ASC A;  2KYQ A;  5KK4 A;  1ZUT A;  2BRZ A;  1ZU3 A;  2N2Q A;  1PE4 A;  2KPY A;  1PX9 A;  2LT8 A;  4KYP A;  2YBR C;  1I6G A;  1NH5 A;  2KSK A;  1B3C A;  5CY0 A;  1JZA A;  1P00 A;  1AHO A;  1BK8 A;  1NPI A;  1VNA A;  1NRA A;  2LKB A;  4CQK A;  1L4V A;  2E0H A;  2YC1 C;  1T7E A;  2SN3 A;  1WWN A;  2LY6 A;  2YEO A;  1ZVE A;  2A7T A;  1CHZ A;  1P0A A;  1PTX A;  1GPS A;  2B68 A;  2GL1 A;  1NE5 A;  1I2V A;  3PSM A;  1VNB A;  2ATB A;  2LJ7 A;  1T7A A;  2E3G A;  2E3F A;  1BRZ A;  1ZVG A;  1T7B A;  1ZFU A;  3E7R L;  4V1D C;  1LQH A;  1I2U A;  1MYN A;  1AYJ A;  2LJM A;  1KV0 A;  1C55 A;  2LI7 A;  1WMT A;  1LQQ A;  4HE7 A;  1ZYW A;  2N69 A;  1ICA A;  1JXC A;  2KBH A;  1SN1 A;  1DQ7 A;  2N2R A;  1CN2 A;  1T1T A;  2KBJ A;  4AB0 A;  1DJT A;  4AEI A;  1LQI A;  1NRB A;  1I6F A;  1TI5 A;  1WT7 A;  2I61 A;  1BMR A;  1BCG A;  1GPT A;  2KGQ A;  1B7D A;  1SN4 A;  4HHF A;  2KBK A;  1JZB A;  1SEG A;  1T0Z A;  1MR4 A;  4AAZ A;  1FH3 A;  4UJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...