2N69A

Nmr structure of non-sweet mutant (ins18ri19) of sweet protein brazzein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
b'QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb
source organism Pentadiplandra brazzeana
molecule tags Plant protein
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n69A00
1VNAA 2A7TA 1ZU3A 2ASCA 1JZBA 2LKBA 2KJAA 1I2VA 1ZYVA 2YBRC 1T1TA 2KPYA 1JZAA 1CHZA 4AAZA 1WT7A 5KK4A 1LQIA 2N66A 4HHFA 1SNBA 2LY5A 2B68A 2E3FA 1GPTA 1VNBA 1B3CA 2ATBA 2SN3A 1KV0A 2LY6A 3E7UX 4AEIA 2MZ0A 1WMTA 2KYQA 1WWNA 2I61A 2KBKA 1BRZA 1AYJA 1JXCA 4KYPA 1OZZA 1JKZA 2B3CA 1NPIA 5CY0A 2N2QA 2NY9X 3PSMA 1ZUTA 1C56A 2KBJA 1OMYA 1PX9A 2LI7A 1I6GA 4CQKA 2GL1A 2N69A 1LQQA 1CN2A 1ZVEA 2LJ7A 1DJTA 2N2RA 4AB0A 1FH3A 1LQHA 1T7EA 1T0ZA 3E7RL 1P00A 1P0AA 4HE7A 1SN4A 2KBHA 1I6FA 2YC1C 1PTXA 1B7DA 2KGQA 1AHOA 1NRAA 2LR3A 1BMRA 1T7BA 1NRBA 1ZFUA 1SEGA 1NH5A 1C55A 1ZVGA 1N4NA 1T7AA 2BRZA 1GPSA 1MYNA 1TI5A 2E3GA 1ZYWA 1BCGA 1ICAA 1NE5A 4UJ0A 1BK8A 2KSKA 1L4VA 1I2UA 2LJMA 2LT8A 1PE4A 2YEOA 2E0HA 2NY8X 2M8BB 1DQ7A 1SN1A 4V1DC 1MR4A
chains in the Genus database with same CATH superfamily
1VNAA 2A7TA 3SF4D 5BPLA 1ZU3A 3QFUA 2ASCA 1JZBA 2LKBA 2KJAA 2MN5A 3FZKA 1I2VA 1ZYVA 3I33A 4UADE 2YBRC 1T1TA 1HPMA 2KPYA 5BN8A 1KAZA 5BPNA 1JZAA 1CHZA 4AAZA 1WT7A 2KHOA 3M3ZA 1LQIA 4FSVA 4H5NA 5AQKA 5KK4A 2N66A 4HHFA 1SNBA 5AQSA 3FZFA 2LN8A 3JXUA 2QWNA 5AQXA 2LY5A 2B68A 3QFPA 3QI7A 1DKGD 5EX5A 2E3FA 5AQIA 1BA1A 1NGFA 1GPTA 1NGGA 1VNBA 2G2KA 1B3CA 3L6QA 3KHWA 1POIA 1ATRA 2ATBA 3L56A 2SN3A 1KV0A 2E2FA 2LY6A 5AQJA 1QQOA 3KVGA 3D2FA 3E7UX 4AEIA 1S3XA 1UGLA 1NGEA 3CW4A 2QWRA 5AQFA 2MZ0A 1WMTA 2KYQA 3KOYA 4H5WA 4KBOA 1WWNA 2I61A 5AQNA 2KBKA 5EXWA 1BRZA 1AYJA 1JXCA 1BA0A 2QW9A 1OZZA 4KYPA 5EVZA 1JKZA 2B3CA 1NPIA 5CY0A 2N2QA 2NY9X 2VY6A 1ZUTA 3PSMA 1HJOA 3LDQA 3KOWA 1C56A 5AQTA 4H5TA 3FZMA 1NGDA 3LDLA 2KBJA 3AY9A 1L4VA 1OMYA 2QWMA 1PX9A 5FPMA 2LI7A 3KOXA 1I6GA 1NGBA 4CQKA 3GL1A 2GL1A 2N69A 4UAEF 1LQQA 2K35A 3GKUA 3KOZA 1CN2A 3FZLA 3A8YA 1ZVEA 5AQUA 2LJ7A 1DJTA 1NGCA 2N2RA 3D2EA 2YIPA 1ATSA 1XRSB 1LQHA 2E8AA 5AQPA 4AB0A 1FH3A 1T7EA 3IUCA 1NGIA 5AQGA 1BUPA 3D2FB 1YUWA 5AQOA 5F2RA 1T0ZA 3E7RL 3L4IA 4UAFE 3QMLA 3C7NA 1P00A 1P0AA 2D56A 3C7NB 1QQNA 3GDQA 4H5RA 2GMOA 4HE7A 1SN4A 2KBHA 5BPMA 1I6FA 2YILA 3BK3C 2YC1C 3LDPA 5AQYA 1PTXA 4GNIA 5AQQA 5AR0A 5F1XA 1K8BA 3KC6A 2QWOA 1B7DA 2BUPA 2KGQA 1AHOA 1NRAA 2QWLA 1NGJA 3LDNA 2LR3A 5AQLA 3KP0A 5FPEA 2QWPA 1BMRA 1T7BA 1NRBA 2JDQD 5AQVA 1ZFUA 5FPNA 1SEGA 1NGAA 5AQZA 1NH5A 4H5VA 1NGHA 2YIOA 1ZVGA 3D2EB 1C55A 2QXLA 5AQWA 1N4NA 1T7AA 3CQXA 3FZHA 2MBKA 2BRZA 5AQRA 1GPSA 1MYNA 5F0XA 1TI5A 4FL9A 3R2VA 2E3GA 1ZYWA 3ATVA 1BCGA 3KP1A 1QQMA 1ICAA 1NE5A 5AQHA 4UJ0A 5EY4A 3ATUA 2KSKA 4IO8A 3FE1A 5FPDA 1BK8A 1HX1A 2LJMA 3HSCA 2LT8A 4HWIA 5BN9A 5AQMA 1I2UA 1PE4A 2E88A 2E0HA 2YEOA 3LDOA 2V7ZA 1KAYA 2NY8X 2M8BB 1DQ7A 1SN1A 2QWQA 1KAXA 4V1DC 1MR4A
chains in the Genus database with same CATH topology
1VNAA 2A7TA 1ZU3A 2ASCA 1JZBA 2LKBA 2KJAA 1I2VA 1ZYVA 2YBRC 1T1TA 2KPYA 1JZAA 1CHZA 4AAZA 1WT7A 5KK4A 1LQIA 2N66A 4HHFA 1SNBA 2LY5A 2B68A 2E3FA 1GPTA 1VNBA 1B3CA 2ATBA 2SN3A 1KV0A 2LY6A 3E7UX 4AEIA 2MZ0A 1WMTA 2KYQA 1WWNA 2I61A 2KBKA 1BRZA 1AYJA 1JXCA 4KYPA 1OZZA 1JKZA 2B3CA 1NPIA 5CY0A 2N2QA 2NY9X 3PSMA 1ZUTA 1C56A 2KBJA 1OMYA 1PX9A 2LI7A 1I6GA 4CQKA 2GL1A 2N69A 1LQQA 1CN2A 1ZVEA 2LJ7A 1DJTA 2N2RA 4AB0A 1FH3A 1LQHA 1T7EA 1T0ZA 3E7RL 1P00A 1P0AA 4HE7A 1SN4A 2KBHA 1I6FA 2YC1C 1PTXA 1B7DA 2KGQA 1AHOA 1NRAA 2LR3A 1BMRA 1T7BA 1NRBA 1ZFUA 1SEGA 1NH5A 1C55A 1ZVGA 1N4NA 1T7AA 2BRZA 1GPSA 1MYNA 1TI5A 2E3GA 1ZYWA 1BCGA 1ICAA 1NE5A 4UJ0A 1BK8A 2KSKA 1L4VA 1I2UA 2LJMA 2LT8A 1PE4A 2YEOA 2E0HA 2NY8X 2M8BB 1DQ7A 1SN1A 4V1DC 1MR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VNA A;  2A7T A;  1ZU3 A;  2ASC A;  1JZB A;  2LKB A;  2KJA A;  1I2V A;  1ZYV A;  2YBR C;  1T1T A;  2KPY A;  1JZA A;  1CHZ A;  4AAZ A;  1WT7 A;  5KK4 A;  1LQI A;  2N66 A;  4HHF A;  1SNB A;  2LY5 A;  2B68 A;  2E3F A;  1GPT A;  1VNB A;  1B3C A;  2ATB A;  2SN3 A;  1KV0 A;  2LY6 A;  3E7U X;  4AEI A;  2MZ0 A;  1WMT A;  2KYQ A;  1WWN A;  2I61 A;  2KBK A;  1BRZ A;  1AYJ A;  1JXC A;  4KYP A;  1OZZ A;  1JKZ A;  2B3C A;  1NPI A;  5CY0 A;  2N2Q A;  2NY9 X;  3PSM A;  1ZUT A;  1C56 A;  2KBJ A;  1OMY A;  1PX9 A;  2LI7 A;  1I6G A;  4CQK A;  2GL1 A;  2N69 A;  1LQQ A;  1CN2 A;  1ZVE A;  2LJ7 A;  1DJT A;  2N2R A;  4AB0 A;  1FH3 A;  1LQH A;  1T7E A;  1T0Z A;  3E7R L;  1P00 A;  1P0A A;  4HE7 A;  1SN4 A;  2KBH A;  1I6F A;  2YC1 C;  1PTX A;  1B7D A;  2KGQ A;  1AHO A;  1NRA A;  2LR3 A;  1BMR A;  1T7B A;  1NRB A;  1ZFU A;  1SEG A;  1NH5 A;  1C55 A;  1ZVG A;  1N4N A;  1T7A A;  2BRZ A;  1GPS A;  1MYN A;  1TI5 A;  2E3G A;  1ZYW A;  1BCG A;  1ICA A;  1NE5 A;  4UJ0 A;  1BK8 A;  2KSK A;  1L4V A;  1I2U A;  2LJM A;  2LT8 A;  1PE4 A;  2YEO A;  2E0H A;  2NY8 X;  2M8B B;  1DQ7 A;  1SN1 A;  4V1D C;  1MR4 A; 
#chains in the Genus database with same CATH topology
 1VNA A;  2A7T A;  3SF4 D;  5BPL A;  1ZU3 A;  3QFU A;  2ASC A;  1JZB A;  2LKB A;  2KJA A;  2MN5 A;  3FZK A;  1I2V A;  1ZYV A;  3I33 A;  4UAD E;  2YBR C;  1T1T A;  1HPM A;  2KPY A;  5BN8 A;  1KAZ A;  5BPN A;  1JZA A;  1CHZ A;  4AAZ A;  1WT7 A;  2KHO A;  3M3Z A;  1LQI A;  4FSV A;  4H5N A;  5AQK A;  5KK4 A;  2N66 A;  4HHF A;  1SNB A;  5AQS A;  3FZF A;  2LN8 A;  3JXU A;  2QWN A;  5AQX A;  2LY5 A;  2B68 A;  3QFP A;  3QI7 A;  1DKG D;  5EX5 A;  2E3F A;  5AQI A;  1BA1 A;  1NGF A;  1GPT A;  1NGG A;  1VNB A;  2G2K A;  1B3C A;  3L6Q A;  3KHW A;  1POI A;  1ATR A;  2ATB A;  3L56 A;  2SN3 A;  1KV0 A;  2E2F A;  2LY6 A;  5AQJ A;  1QQO A;  3KVG A;  3D2F A;  3E7U X;  4AEI A;  1S3X A;  1UGL A;  1NGE A;  3CW4 A;  2QWR A;  5AQF A;  2MZ0 A;  1WMT A;  2KYQ A;  3KOY A;  4H5W A;  4KBO A;  1WWN A;  2I61 A;  5AQN A;  2KBK A;  5EXW A;  1BRZ A;  1AYJ A;  1JXC A;  1BA0 A;  2QW9 A;  1OZZ A;  4KYP A;  5EVZ A;  1JKZ A;  2B3C A;  1NPI A;  5CY0 A;  2N2Q A;  2NY9 X;  2VY6 A;  1ZUT A;  3PSM A;  1HJO A;  3LDQ A;  3KOW A;  1C56 A;  5AQT A;  4H5T A;  3FZM A;  1NGD A;  3LDL A;  2KBJ A;  3AY9 A;  1L4V A;  1OMY A;  2QWM A;  1PX9 A;  5FPM A;  2LI7 A;  3KOX A;  1I6G A;  1NGB A;  4CQK A;  3GL1 A;  2GL1 A;  2N69 A;  4UAE F;  1LQQ A;  2K35 A;  3GKU A;  3KOZ A;  1CN2 A;  3FZL A;  3A8Y A;  1ZVE A;  5AQU A;  2LJ7 A;  1DJT A;  1NGC A;  2N2R A;  3D2E A;  2YIP A;  1ATS A;  1XRS B;  1LQH A;  2E8A A;  5AQP A;  4AB0 A;  1FH3 A;  1T7E A;  3IUC A;  1NGI A;  5AQG A;  1BUP A;  3D2F B;  1YUW A;  5AQO A;  5F2R A;  1T0Z A;  3E7R L;  3L4I A;  4UAF E;  3QML A;  3C7N A;  1P00 A;  1P0A A;  2D56 A;  3C7N B;  1QQN A;  3GDQ A;  4H5R A;  2GMO A;  4HE7 A;  1SN4 A;  2KBH A;  5BPM A;  1I6F A;  2YIL A;  3BK3 C;  2YC1 C;  3LDP A;  5AQY A;  1PTX A;  4GNI A;  5AQQ A;  5AR0 A;  5F1X A;  1K8B A;  3KC6 A;  2QWO A;  1B7D A;  2BUP A;  2KGQ A;  1AHO A;  1NRA A;  2QWL A;  1NGJ A;  3LDN A;  2LR3 A;  5AQL A;  3KP0 A;  5FPE A;  2QWP A;  1BMR A;  1T7B A;  1NRB A;  2JDQ D;  5AQV A;  1ZFU A;  5FPN A;  1SEG A;  1NGA A;  5AQZ A;  1NH5 A;  4H5V A;  1NGH A;  2YIO A;  1ZVG A;  3D2E B;  1C55 A;  2QXL A;  5AQW A;  1N4N A;  1T7A A;  3CQX A;  3FZH A;  2MBK A;  2BRZ A;  5AQR A;  1GPS A;  1MYN A;  5F0X A;  1TI5 A;  4FL9 A;  3R2V A;  2E3G A;  1ZYW A;  3ATV A;  1BCG A;  3KP1 A;  1QQM A;  1ICA A;  1NE5 A;  5AQH A;  4UJ0 A;  5EY4 A;  3ATU A;  2KSK A;  4IO8 A;  3FE1 A;  5FPD A;  1BK8 A;  1HX1 A;  2LJM A;  3HSC A;  2LT8 A;  4HWI A;  5BN9 A;  5AQM A;  1I2U A;  1PE4 A;  2E88 A;  2E0H A;  2YEO A;  3LDO A;  2V7Z A;  1KAY A;  2NY8 X;  2M8B B;  1DQ7 A;  1SN1 A;  2QWQ A;  1KAX A;  4V1D C;  1MR4 A; 
#chains in the Genus database with same CATH homology
 1VNA A;  2A7T A;  1ZU3 A;  2ASC A;  1JZB A;  2LKB A;  2KJA A;  1I2V A;  1ZYV A;  2YBR C;  1T1T A;  2KPY A;  1JZA A;  1CHZ A;  4AAZ A;  1WT7 A;  5KK4 A;  1LQI A;  2N66 A;  4HHF A;  1SNB A;  2LY5 A;  2B68 A;  2E3F A;  1GPT A;  1VNB A;  1B3C A;  2ATB A;  2SN3 A;  1KV0 A;  2LY6 A;  3E7U X;  4AEI A;  2MZ0 A;  1WMT A;  2KYQ A;  1WWN A;  2I61 A;  2KBK A;  1BRZ A;  1AYJ A;  1JXC A;  4KYP A;  1OZZ A;  1JKZ A;  2B3C A;  1NPI A;  5CY0 A;  2N2Q A;  2NY9 X;  3PSM A;  1ZUT A;  1C56 A;  2KBJ A;  1OMY A;  1PX9 A;  2LI7 A;  1I6G A;  4CQK A;  2GL1 A;  2N69 A;  1LQQ A;  1CN2 A;  1ZVE A;  2LJ7 A;  1DJT A;  2N2R A;  4AB0 A;  1FH3 A;  1LQH A;  1T7E A;  1T0Z A;  3E7R L;  1P00 A;  1P0A A;  4HE7 A;  1SN4 A;  2KBH A;  1I6F A;  2YC1 C;  1PTX A;  1B7D A;  2KGQ A;  1AHO A;  1NRA A;  2LR3 A;  1BMR A;  1T7B A;  1NRB A;  1ZFU A;  1SEG A;  1NH5 A;  1C55 A;  1ZVG A;  1N4N A;  1T7A A;  2BRZ A;  1GPS A;  1MYN A;  1TI5 A;  2E3G A;  1ZYW A;  1BCG A;  1ICA A;  1NE5 A;  4UJ0 A;  1BK8 A;  2KSK A;  1L4V A;  1I2U A;  2LJM A;  2LT8 A;  1PE4 A;  2YEO A;  2E0H A;  2NY8 X;  2M8B B;  1DQ7 A;  1SN1 A;  4V1D C;  1MR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...