1BK8A

Determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
50
structure length
50
Chain Sequence
b'LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIMICROBIAL PROTEIN 1
publication title The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance.
pubmed doi rcsb
molecule tags Plant defensin
total genus 15
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1bk8A00
1ZFUA 2I61A 1ZYWA 2LKBA 2LR3A 1I2UA 1LQQA 1T7AA 1NH5A 1ICAA 1SN4A 1WWNA 1BMRA 1PTXA 2N69A 1ZYVA 1BCGA 1P0AA 2MZ0A 4KYPA 1TI5A 3E7RL 1PX9A 1MR4A 4UJ0A 1GPTA 2NY9X 2YBRC 1I2VA 1NRAA 2LT8A 1ZVGA 2A7TA 1C55A 1OZZA 1VNAA 2B68A 2KJAA 2B3CA 2NY8X 2GL1A 1PE4A 1FH3A 2KYQA 1JZAA 1CHZA 1T1TA 2KPYA 1BK8A 1MYNA 2E3FA 3E7UX 2ATBA 5CY0A 1T0ZA 4V1DC 1NE5A 1T7BA 1LQHA 1ZUTA 2KGQA 1WT7A 1SEGA 1SN1A 1ZU3A 1VNBA 4HHFA 2E0HA 2KBHA 1DJTA 2LY5A 1AHOA 2LJMA 2ASCA 1P00A 2KBJA 1OMYA 4AB0A 1DQ7A 1T7EA 1I6GA 1JKZA 1BRZA 1NPIA 2SN3A 4AAZA 1NRBA 2N66A 2YEOA 2N2QA 1WMTA 1SNBA 2KSKA 1GPSA 2N2RA 1I6FA 5KK4A 1L4VA 2LI7A 1C56A 2M8BB 1CN2A 3PSMA 1JZBA 1B3CA 1LQIA 2YC1C 1ZVEA 1B7DA 2KBKA 1AYJA 1N4NA 2E3GA 2LY6A 1JXCA 2LJ7A 4AEIA 1KV0A 4CQKA 2BRZA 4HE7A
chains in the Genus database with same CATH superfamily
1ATRA 1ZFUA 2I61A 2YIOA 3KHWA 5EY4A 1DKGD 1ZYWA 5BPLA 1HJOA 2LKBA 2LR3A 1LQQA 1I2UA 3LDOA 2E8AA 5BN8A 5F1XA 1T7AA 4H5NA 5AQXA 1NH5A 5EXWA 5AQWA 1ICAA 5AQYA 2BUPA 1SN4A 1WWNA 3FZKA 3FZMA 1NGHA 1PTXA 3C7NA 1BMRA 2N69A 1HPMA 1BCGA 1P0AA 1ZYVA 2MZ0A 1QQOA 3D2EA 1NGFA 4KYPA 3AY9A 1TI5A 4H5RA 5BPMA 3E7RL 1K8BA 1PX9A 5AQUA 1MR4A 5AQMA 4UJ0A 1GPTA 2NY9X 3KP0A 4UAFE 2QXLA 1ATSA 5AR0A 2YBRC 3FE1A 1UGLA 1I2VA 1NRAA 2LT8A 3KOWA 4FL9A 1ZVGA 1NGDA 3QI7A 2VY6A 2A7TA 1C55A 1OZZA 1NGIA 2QW9A 5FPMA 5AQTA 2K35A 1KAYA 1VNAA 2QWOA 4H5TA 4HHFA 1NGCA 1XRSB 2B68A 1KAXA 2KJAA 5AQJA 2B3CA 2NY8X 5FPNA 2GL1A 1PE4A 1FH3A 2KYQA 4UADE 1JZAA 1CHZA 1T1TA 2KPYA 1POIA 3LDPA 1YUWA 5AQFA 1MYNA 1BK8A 5AQHA 2E3FA 1S3XA 3D2FB 3E7UX 2G2KA 3FZHA 2LN8A 2ATBA 5AQNA 1T0ZA 3GDQA 3I33A 3LDNA 5CY0A 4V1DC 5FPDA 1NE5A 5AQZA 5BPNA 5FPEA 1T7BA 1LQHA 5AQPA 1QQNA 1ZUTA 2KGQA 3KOZA 2MN5A 1WT7A 3JXUA 2QWNA 3KC6A 1QQMA 2YIPA 1SEGA 1SN1A 3A8YA 3FZFA 1ZU3A 1VNBA 5AQVA 2D56A 3LDQA 2E0HA 3HSCA 2KBHA 3CW4A 3GL1A 1DJTA 3L6QA 2LY5A 4FSVA 1AHOA 2JDQD 2LJMA 1NGEA 3SF4D 3GKUA 2ASCA 5AQLA 1P00A 4UAEF 5AQQA 2QWLA 2KBJA 3FZLA 1NGGA 1OMYA 4AB0A 3D2FA 1BA1A 1DQ7A 2QWPA 1T7EA 1I6GA 1JKZA 3R2VA 2YILA 1BRZA 1NPIA 2E88A 4H5VA 2SN3A 4GNIA 3L4IA 4AAZA 5F2RA 5AQRA 3CQXA 1NRBA 2GMOA 2N66A 2QWRA 2YEOA 1BA0A 2N2QA 1WMTA 1SNBA 2KSKA 5AQKA 5EVZA 1GPSA 3L56A 3KVGA 1BUPA 3M3ZA 3ATVA 5AQOA 2N2RA 1I6FA 3ATUA 5KK4A 3KOXA 5AQSA 2E2FA 4IO8A 1L4VA 2LI7A 2MBKA 5AQGA 1C56A 2M8BB 3BK3C 3C7NB 1CN2A 3KOYA 3PSMA 5F0XA 1JZBA 5AQIA 3IUCA 5BN9A 3D2EB 1NGAA 1KAZA 2V7ZA 1NGBA 4KBOA 1B3CA 1LQIA 2YC1C 3LDLA 1NGJA 2QWQA 1ZVEA 1HX1A 3QFUA 2KHOA 1B7DA 2KBKA 3KP1A 1N4NA 2E3GA 1AYJA 2LY6A 1JXCA 5EX5A 2LJ7A 4HWIA 1KV0A 4H5WA 4AEIA 4CQKA 2BRZA 2QWMA 4HE7A 3QMLA 3QFPA
chains in the Genus database with same CATH topology
1ZFUA 2I61A 1ZYWA 2LKBA 2LR3A 1I2UA 1LQQA 1T7AA 1NH5A 1ICAA 1SN4A 1WWNA 1BMRA 1PTXA 2N69A 1ZYVA 1BCGA 1P0AA 2MZ0A 4KYPA 1TI5A 3E7RL 1PX9A 1MR4A 4UJ0A 1GPTA 2NY9X 2YBRC 1I2VA 1NRAA 2LT8A 1ZVGA 2A7TA 1C55A 1OZZA 1VNAA 2B68A 2KJAA 2B3CA 2NY8X 2GL1A 1PE4A 1FH3A 2KYQA 1JZAA 1CHZA 1T1TA 2KPYA 1BK8A 1MYNA 2E3FA 3E7UX 2ATBA 5CY0A 1T0ZA 4V1DC 1NE5A 1T7BA 1LQHA 1ZUTA 2KGQA 1WT7A 1SEGA 1SN1A 1ZU3A 1VNBA 4HHFA 2E0HA 2KBHA 1DJTA 2LY5A 1AHOA 2LJMA 2ASCA 1P00A 2KBJA 1OMYA 4AB0A 1DQ7A 1T7EA 1I6GA 1JKZA 1BRZA 1NPIA 2SN3A 4AAZA 1NRBA 2N66A 2YEOA 2N2QA 1WMTA 1SNBA 2KSKA 1GPSA 2N2RA 1I6FA 5KK4A 1L4VA 2LI7A 1C56A 2M8BB 1CN2A 3PSMA 1JZBA 1B3CA 1LQIA 2YC1C 1ZVEA 1B7DA 2KBKA 1AYJA 1N4NA 2E3GA 2LY6A 1JXCA 2LJ7A 4AEIA 1KV0A 4CQKA 2BRZA 4HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZFU A;  2I61 A;  1ZYW A;  2LKB A;  2LR3 A;  1I2U A;  1LQQ A;  1T7A A;  1NH5 A;  1ICA A;  1SN4 A;  1WWN A;  1BMR A;  1PTX A;  2N69 A;  1ZYV A;  1BCG A;  1P0A A;  2MZ0 A;  4KYP A;  1TI5 A;  3E7R L;  1PX9 A;  1MR4 A;  4UJ0 A;  1GPT A;  2NY9 X;  2YBR C;  1I2V A;  1NRA A;  2LT8 A;  1ZVG A;  2A7T A;  1C55 A;  1OZZ A;  1VNA A;  2B68 A;  2KJA A;  2B3C A;  2NY8 X;  2GL1 A;  1PE4 A;  1FH3 A;  2KYQ A;  1JZA A;  1CHZ A;  1T1T A;  2KPY A;  1BK8 A;  1MYN A;  2E3F A;  3E7U X;  2ATB A;  5CY0 A;  1T0Z A;  4V1D C;  1NE5 A;  1T7B A;  1LQH A;  1ZUT A;  2KGQ A;  1WT7 A;  1SEG A;  1SN1 A;  1ZU3 A;  1VNB A;  4HHF A;  2E0H A;  2KBH A;  1DJT A;  2LY5 A;  1AHO A;  2LJM A;  2ASC A;  1P00 A;  2KBJ A;  1OMY A;  4AB0 A;  1DQ7 A;  1T7E A;  1I6G A;  1JKZ A;  1BRZ A;  1NPI A;  2SN3 A;  4AAZ A;  1NRB A;  2N66 A;  2YEO A;  2N2Q A;  1WMT A;  1SNB A;  2KSK A;  1GPS A;  2N2R A;  1I6F A;  5KK4 A;  1L4V A;  2LI7 A;  1C56 A;  2M8B B;  1CN2 A;  3PSM A;  1JZB A;  1B3C A;  1LQI A;  2YC1 C;  1ZVE A;  1B7D A;  2KBK A;  1AYJ A;  1N4N A;  2E3G A;  2LY6 A;  1JXC A;  2LJ7 A;  4AEI A;  1KV0 A;  4CQK A;  2BRZ A;  4HE7 A; 
#chains in the Genus database with same CATH topology
 1ATR A;  1ZFU A;  2I61 A;  2YIO A;  3KHW A;  5EY4 A;  1DKG D;  1ZYW A;  5BPL A;  1HJO A;  2LKB A;  2LR3 A;  1LQQ A;  1I2U A;  3LDO A;  2E8A A;  5BN8 A;  5F1X A;  1T7A A;  4H5N A;  5AQX A;  1NH5 A;  5EXW A;  5AQW A;  1ICA A;  5AQY A;  2BUP A;  1SN4 A;  1WWN A;  3FZK A;  3FZM A;  1NGH A;  1PTX A;  3C7N A;  1BMR A;  2N69 A;  1HPM A;  1BCG A;  1P0A A;  1ZYV A;  2MZ0 A;  1QQO A;  3D2E A;  1NGF A;  4KYP A;  3AY9 A;  1TI5 A;  4H5R A;  5BPM A;  3E7R L;  1K8B A;  1PX9 A;  5AQU A;  1MR4 A;  5AQM A;  4UJ0 A;  1GPT A;  2NY9 X;  3KP0 A;  4UAF E;  2QXL A;  1ATS A;  5AR0 A;  2YBR C;  3FE1 A;  1UGL A;  1I2V A;  1NRA A;  2LT8 A;  3KOW A;  4FL9 A;  1ZVG A;  1NGD A;  3QI7 A;  2VY6 A;  2A7T A;  1C55 A;  1OZZ A;  1NGI A;  2QW9 A;  5FPM A;  5AQT A;  2K35 A;  1KAY A;  1VNA A;  2QWO A;  4H5T A;  4HHF A;  1NGC A;  1XRS B;  2B68 A;  1KAX A;  2KJA A;  5AQJ A;  2B3C A;  2NY8 X;  5FPN A;  2GL1 A;  1PE4 A;  1FH3 A;  2KYQ A;  4UAD E;  1JZA A;  1CHZ A;  1T1T A;  2KPY A;  1POI A;  3LDP A;  1YUW A;  5AQF A;  1MYN A;  1BK8 A;  5AQH A;  2E3F A;  1S3X A;  3D2F B;  3E7U X;  2G2K A;  3FZH A;  2LN8 A;  2ATB A;  5AQN A;  1T0Z A;  3GDQ A;  3I33 A;  3LDN A;  5CY0 A;  4V1D C;  5FPD A;  1NE5 A;  5AQZ A;  5BPN A;  5FPE A;  1T7B A;  1LQH A;  5AQP A;  1QQN A;  1ZUT A;  2KGQ A;  3KOZ A;  2MN5 A;  1WT7 A;  3JXU A;  2QWN A;  3KC6 A;  1QQM A;  2YIP A;  1SEG A;  1SN1 A;  3A8Y A;  3FZF A;  1ZU3 A;  1VNB A;  5AQV A;  2D56 A;  3LDQ A;  2E0H A;  3HSC A;  2KBH A;  3CW4 A;  3GL1 A;  1DJT A;  3L6Q A;  2LY5 A;  4FSV A;  1AHO A;  2JDQ D;  2LJM A;  1NGE A;  3SF4 D;  3GKU A;  2ASC A;  5AQL A;  1P00 A;  4UAE F;  5AQQ A;  2QWL A;  2KBJ A;  3FZL A;  1NGG A;  1OMY A;  4AB0 A;  3D2F A;  1BA1 A;  1DQ7 A;  2QWP A;  1T7E A;  1I6G A;  1JKZ A;  3R2V A;  2YIL A;  1BRZ A;  1NPI A;  2E88 A;  4H5V A;  2SN3 A;  4GNI A;  3L4I A;  4AAZ A;  5F2R A;  5AQR A;  3CQX A;  1NRB A;  2GMO A;  2N66 A;  2QWR A;  2YEO A;  1BA0 A;  2N2Q A;  1WMT A;  1SNB A;  2KSK A;  5AQK A;  5EVZ A;  1GPS A;  3L56 A;  3KVG A;  1BUP A;  3M3Z A;  3ATV A;  5AQO A;  2N2R A;  1I6F A;  3ATU A;  5KK4 A;  3KOX A;  5AQS A;  2E2F A;  4IO8 A;  1L4V A;  2LI7 A;  2MBK A;  5AQG A;  1C56 A;  2M8B B;  3BK3 C;  3C7N B;  1CN2 A;  3KOY A;  3PSM A;  5F0X A;  1JZB A;  5AQI A;  3IUC A;  5BN9 A;  3D2E B;  1NGA A;  1KAZ A;  2V7Z A;  1NGB A;  4KBO A;  1B3C A;  1LQI A;  2YC1 C;  3LDL A;  1NGJ A;  2QWQ A;  1ZVE A;  1HX1 A;  3QFU A;  2KHO A;  1B7D A;  2KBK A;  3KP1 A;  1N4N A;  2E3G A;  1AYJ A;  2LY6 A;  1JXC A;  5EX5 A;  2LJ7 A;  4HWI A;  1KV0 A;  4H5W A;  4AEI A;  4CQK A;  2BRZ A;  2QWM A;  4HE7 A;  3QML A;  3QFP A; 
#chains in the Genus database with same CATH homology
 1ZFU A;  2I61 A;  1ZYW A;  2LKB A;  2LR3 A;  1I2U A;  1LQQ A;  1T7A A;  1NH5 A;  1ICA A;  1SN4 A;  1WWN A;  1BMR A;  1PTX A;  2N69 A;  1ZYV A;  1BCG A;  1P0A A;  2MZ0 A;  4KYP A;  1TI5 A;  3E7R L;  1PX9 A;  1MR4 A;  4UJ0 A;  1GPT A;  2NY9 X;  2YBR C;  1I2V A;  1NRA A;  2LT8 A;  1ZVG A;  2A7T A;  1C55 A;  1OZZ A;  1VNA A;  2B68 A;  2KJA A;  2B3C A;  2NY8 X;  2GL1 A;  1PE4 A;  1FH3 A;  2KYQ A;  1JZA A;  1CHZ A;  1T1T A;  2KPY A;  1BK8 A;  1MYN A;  2E3F A;  3E7U X;  2ATB A;  5CY0 A;  1T0Z A;  4V1D C;  1NE5 A;  1T7B A;  1LQH A;  1ZUT A;  2KGQ A;  1WT7 A;  1SEG A;  1SN1 A;  1ZU3 A;  1VNB A;  4HHF A;  2E0H A;  2KBH A;  1DJT A;  2LY5 A;  1AHO A;  2LJM A;  2ASC A;  1P00 A;  2KBJ A;  1OMY A;  4AB0 A;  1DQ7 A;  1T7E A;  1I6G A;  1JKZ A;  1BRZ A;  1NPI A;  2SN3 A;  4AAZ A;  1NRB A;  2N66 A;  2YEO A;  2N2Q A;  1WMT A;  1SNB A;  2KSK A;  1GPS A;  2N2R A;  1I6F A;  5KK4 A;  1L4V A;  2LI7 A;  1C56 A;  2M8B B;  1CN2 A;  3PSM A;  1JZB A;  1B3C A;  1LQI A;  2YC1 C;  1ZVE A;  1B7D A;  2KBK A;  1AYJ A;  1N4N A;  2E3G A;  2LY6 A;  1JXC A;  2LJ7 A;  4AEI A;  1KV0 A;  4CQK A;  2BRZ A;  4HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...