2YC1C

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 65
sequence length 65
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2yc1C00
1P0AA 1I2UA 1OMYA 1ZYWA 2KPYA 2KBJA 2NY9X 2YEOA 2GL1A 4AAZA 1KV0A 2E0HA 1ZU3A 2KBHA 2B68A 2LJMA 1MYNA 1T0ZA 1BCGA 2A7TA 1PX9A 2KGQA 2I61A 4AEIA 1LQIA 1TI5A 1AYJA 1SN1A 1CN2A 1WMTA 1C56A 1SNBA 3E7RL 1NH5A 1I2VA 2E3FA 2LJ7A 2KYQA 4HE7A 2N2QA 1PTXA 1SN4A 1NRAA 4AB0A 1BMRA 1T7AA 1SEGA 2N66A 1BRZA 1C55A 1DQ7A 2KSKA 1GPTA 1T7EA 1L4VA 2NY8X 1ZFUA 1NPIA 5CY0A 2YC1C 1NRBA 2LT8A 1N4NA 1DJTA 2ASCA 1NE5A 1PE4A 1CHZA 2KBKA 1B7DA 1WT7A 2SN3A 4CQKA 1WWNA 1GPSA 1ZYVA 2KJAA 2N2RA 1T7BA 2LY6A 2N69A 2LR3A 4HHFA 1P00A 2LY5A 4V1DC 1AHOA 1I6GA 1FH3A 1JZBA 1BK8A 4UJ0A 1ICAA 3E7UX 1JKZA 1LQQA 4KYPA 2M8BB 1ZVEA 2LKBA 1JXCA 2BRZA 1OZZA 1B3CA 1VNAA 2B3CA 2LI7A 1ZUTA 2ATBA 1I6FA 1ZVGA 2E3GA 2YBRC 1LQHA 2MZ0A 5KK4A 1JZAA 3PSMA 1MR4A 1VNBA 1T1TA
chains in the Genus database with same CATH superfamily
1ATRA 1P0AA 1I2UA 1OMYA 4IO8A 1ZYWA 5FPNA 3A8YA 1NGIA 2KPYA 3KHWA 3D2FB 2KBJA 2NY9X 1YUWA 2YEOA 5AQNA 5AQMA 2E8AA 2GL1A 1BA1A 1NGCA 4AAZA 3L4IA 3FZFA 1HJOA 1KV0A 2E0HA 5EVZA 1S3XA 1ZU3A 2KBHA 2B68A 3ATVA 5AQLA 2LJMA 4H5TA 5AQXA 3KOWA 1MYNA 1T0ZA 1BCGA 2A7TA 2QWNA 4GNIA 1PX9A 1NGFA 2KGQA 2E88A 5FPMA 2I61A 4AEIA 1LQIA 3CW4A 3GDQA 5AQUA 1TI5A 5AQZA 5F2RA 2YIOA 1SN1A 1AYJA 1CN2A 1WMTA 5AQWA 1C56A 1SNBA 3E7RL 5AQYA 2GMOA 2V7ZA 1NH5A 3KOZA 2E3FA 4H5RA 1I2VA 2LJ7A 2VY6A 2KYQA 4HE7A 2N2QA 4UAEF 3D2EA 1PTXA 1SN4A 1NRAA 4AB0A 5AR0A 1BMRA 1BUPA 4UAFE 1T7AA 1SEGA 4H5WA 1NGGA 1GPSA 2BUPA 2N66A 2YILA 1BRZA 5AQSA 1C55A 1DQ7A 1KAXA 5AQFA 5F0XA 2D56A 2KSKA 2G2KA 1KAZA 5AQQA 1NGHA 1GPTA 3IUCA 1T7EA 2QWMA 1BA0A 3KP1A 1L4VA 2NY8X 1ZFUA 3C7NA 1NPIA 4UADE 5CY0A 1QQMA 4H5VA 3JXUA 2YC1C 1NRBA 2LT8A 1DKGD 1N4NA 5BPNA 1DJTA 2ASCA 2QWRA 3FZHA 3LDNA 5F1XA 1NE5A 2QWPA 3KOYA 3LDPA 1HPMA 1PE4A 1CHZA 2KBKA 3ATUA 3HSCA 1B7DA 1WT7A 2SN3A 3QFPA 4H5NA 4KBOA 5AQPA 5AQTA 1WWNA 2QWLA 1XRSB 1HX1A 3SF4D 1ZYVA 2KJAA 2N2RA 1NGJA 1T7BA 2LY6A 2N69A 3KC6A 3L56A 3LDOA 5AQKA 3CQXA 2LR3A 4HHFA 3FE1A 4HWIA 2MN5A 1P00A 3C7NB 5AQGA 2LY5A 4V1DC 2YIPA 3QI7A 4CQKA 1POIA 4FSVA 5FPDA 3AY9A 1AHOA 3KOXA 5BN9A 1I6GA 5AQVA 5BPLA 1QQOA 1UGLA 1FH3A 1JZBA 3QFUA 1NGEA 1BK8A 4UJ0A 3D2EB 1ICAA 3M3ZA 3E7UX 5AQIA 2QW9A 1ATSA 5EXWA 5AQJA 3FZLA 3GL1A 1JKZA 1LQQA 4KYPA 1NGAA 2QWQA 2LN8A 2M8BB 1ZVEA 5AQHA 3QMLA 5BPMA 2JDQD 5FPEA 2E2FA 5AQRA 3FZMA 2LKBA 3FZKA 3LDLA 5EX5A 5AQOA 3BK3C 1JXCA 2BRZA 1OZZA 5BN8A 3D2FA 1B3CA 4FL9A 2QWOA 5EY4A 1VNAA 3KP0A 2B3CA 3I33A 1K8BA 3KVGA 2LI7A 2KHOA 3GKUA 1ZUTA 2ATBA 1I6FA 1ZVGA 1KAYA 1QQNA 2E3GA 2YBRC 1LQHA 2MZ0A 2QXLA 5KK4A 1JZAA 3PSMA 1NGDA 1MR4A 1NGBA 2K35A 3LDQA 3R2VA 3L6QA 2MBKA 1VNBA 1T1TA
chains in the Genus database with same CATH topology
1P0AA 1I2UA 1OMYA 1ZYWA 2KPYA 2KBJA 2NY9X 2YEOA 2GL1A 4AAZA 1KV0A 2E0HA 1ZU3A 2KBHA 2B68A 2LJMA 1MYNA 1T0ZA 1BCGA 2A7TA 1PX9A 2KGQA 2I61A 4AEIA 1LQIA 1TI5A 1AYJA 1SN1A 1CN2A 1WMTA 1C56A 1SNBA 3E7RL 1NH5A 1I2VA 2E3FA 2LJ7A 2KYQA 4HE7A 2N2QA 1PTXA 1SN4A 1NRAA 4AB0A 1BMRA 1T7AA 1SEGA 2N66A 1BRZA 1C55A 1DQ7A 2KSKA 1GPTA 1T7EA 1L4VA 2NY8X 1ZFUA 1NPIA 5CY0A 2YC1C 1NRBA 2LT8A 1N4NA 1DJTA 2ASCA 1NE5A 1PE4A 1CHZA 2KBKA 1B7DA 1WT7A 2SN3A 4CQKA 1WWNA 1GPSA 1ZYVA 2KJAA 2N2RA 1T7BA 2LY6A 2N69A 2LR3A 4HHFA 1P00A 2LY5A 4V1DC 1AHOA 1I6GA 1FH3A 1JZBA 1BK8A 4UJ0A 1ICAA 3E7UX 1JKZA 1LQQA 4KYPA 2M8BB 1ZVEA 2LKBA 1JXCA 2BRZA 1OZZA 1B3CA 1VNAA 2B3CA 2LI7A 1ZUTA 2ATBA 1I6FA 1ZVGA 2E3GA 2YBRC 1LQHA 2MZ0A 5KK4A 1JZAA 3PSMA 1MR4A 1VNBA 1T1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0A A;  1I2U A;  1OMY A;  1ZYW A;  2KPY A;  2KBJ A;  2NY9 X;  2YEO A;  2GL1 A;  4AAZ A;  1KV0 A;  2E0H A;  1ZU3 A;  2KBH A;  2B68 A;  2LJM A;  1MYN A;  1T0Z A;  1BCG A;  2A7T A;  1PX9 A;  2KGQ A;  2I61 A;  4AEI A;  1LQI A;  1TI5 A;  1AYJ A;  1SN1 A;  1CN2 A;  1WMT A;  1C56 A;  1SNB A;  3E7R L;  1NH5 A;  1I2V A;  2E3F A;  2LJ7 A;  2KYQ A;  4HE7 A;  2N2Q A;  1PTX A;  1SN4 A;  1NRA A;  4AB0 A;  1BMR A;  1T7A A;  1SEG A;  2N66 A;  1BRZ A;  1C55 A;  1DQ7 A;  2KSK A;  1GPT A;  1T7E A;  1L4V A;  2NY8 X;  1ZFU A;  1NPI A;  5CY0 A;  2YC1 C;  1NRB A;  2LT8 A;  1N4N A;  1DJT A;  2ASC A;  1NE5 A;  1PE4 A;  1CHZ A;  2KBK A;  1B7D A;  1WT7 A;  2SN3 A;  4CQK A;  1WWN A;  1GPS A;  1ZYV A;  2KJA A;  2N2R A;  1T7B A;  2LY6 A;  2N69 A;  2LR3 A;  4HHF A;  1P00 A;  2LY5 A;  4V1D C;  1AHO A;  1I6G A;  1FH3 A;  1JZB A;  1BK8 A;  4UJ0 A;  1ICA A;  3E7U X;  1JKZ A;  1LQQ A;  4KYP A;  2M8B B;  1ZVE A;  2LKB A;  1JXC A;  2BRZ A;  1OZZ A;  1B3C A;  1VNA A;  2B3C A;  2LI7 A;  1ZUT A;  2ATB A;  1I6F A;  1ZVG A;  2E3G A;  2YBR C;  1LQH A;  2MZ0 A;  5KK4 A;  1JZA A;  3PSM A;  1MR4 A;  1VNB A;  1T1T A; 
#chains in the Genus database with same CATH topology
 1ATR A;  1P0A A;  1I2U A;  1OMY A;  4IO8 A;  1ZYW A;  5FPN A;  3A8Y A;  1NGI A;  2KPY A;  3KHW A;  3D2F B;  2KBJ A;  2NY9 X;  1YUW A;  2YEO A;  5AQN A;  5AQM A;  2E8A A;  2GL1 A;  1BA1 A;  1NGC A;  4AAZ A;  3L4I A;  3FZF A;  1HJO A;  1KV0 A;  2E0H A;  5EVZ A;  1S3X A;  1ZU3 A;  2KBH A;  2B68 A;  3ATV A;  5AQL A;  2LJM A;  4H5T A;  5AQX A;  3KOW A;  1MYN A;  1T0Z A;  1BCG A;  2A7T A;  2QWN A;  4GNI A;  1PX9 A;  1NGF A;  2KGQ A;  2E88 A;  5FPM A;  2I61 A;  4AEI A;  1LQI A;  3CW4 A;  3GDQ A;  5AQU A;  1TI5 A;  5AQZ A;  5F2R A;  2YIO A;  1SN1 A;  1AYJ A;  1CN2 A;  1WMT A;  5AQW A;  1C56 A;  1SNB A;  3E7R L;  5AQY A;  2GMO A;  2V7Z A;  1NH5 A;  3KOZ A;  2E3F A;  4H5R A;  1I2V A;  2LJ7 A;  2VY6 A;  2KYQ A;  4HE7 A;  2N2Q A;  4UAE F;  3D2E A;  1PTX A;  1SN4 A;  1NRA A;  4AB0 A;  5AR0 A;  1BMR A;  1BUP A;  4UAF E;  1T7A A;  1SEG A;  4H5W A;  1NGG A;  1GPS A;  2BUP A;  2N66 A;  2YIL A;  1BRZ A;  5AQS A;  1C55 A;  1DQ7 A;  1KAX A;  5AQF A;  5F0X A;  2D56 A;  2KSK A;  2G2K A;  1KAZ A;  5AQQ A;  1NGH A;  1GPT A;  3IUC A;  1T7E A;  2QWM A;  1BA0 A;  3KP1 A;  1L4V A;  2NY8 X;  1ZFU A;  3C7N A;  1NPI A;  4UAD E;  5CY0 A;  1QQM A;  4H5V A;  3JXU A;  2YC1 C;  1NRB A;  2LT8 A;  1DKG D;  1N4N A;  5BPN A;  1DJT A;  2ASC A;  2QWR A;  3FZH A;  3LDN A;  5F1X A;  1NE5 A;  2QWP A;  3KOY A;  3LDP A;  1HPM A;  1PE4 A;  1CHZ A;  2KBK A;  3ATU A;  3HSC A;  1B7D A;  1WT7 A;  2SN3 A;  3QFP A;  4H5N A;  4KBO A;  5AQP A;  5AQT A;  1WWN A;  2QWL A;  1XRS B;  1HX1 A;  3SF4 D;  1ZYV A;  2KJA A;  2N2R A;  1NGJ A;  1T7B A;  2LY6 A;  2N69 A;  3KC6 A;  3L56 A;  3LDO A;  5AQK A;  3CQX A;  2LR3 A;  4HHF A;  3FE1 A;  4HWI A;  2MN5 A;  1P00 A;  3C7N B;  5AQG A;  2LY5 A;  4V1D C;  2YIP A;  3QI7 A;  4CQK A;  1POI A;  4FSV A;  5FPD A;  3AY9 A;  1AHO A;  3KOX A;  5BN9 A;  1I6G A;  5AQV A;  5BPL A;  1QQO A;  1UGL A;  1FH3 A;  1JZB A;  3QFU A;  1NGE A;  1BK8 A;  4UJ0 A;  3D2E B;  1ICA A;  3M3Z A;  3E7U X;  5AQI A;  2QW9 A;  1ATS A;  5EXW A;  5AQJ A;  3FZL A;  3GL1 A;  1JKZ A;  1LQQ A;  4KYP A;  1NGA A;  2QWQ A;  2LN8 A;  2M8B B;  1ZVE A;  5AQH A;  3QML A;  5BPM A;  2JDQ D;  5FPE A;  2E2F A;  5AQR A;  3FZM A;  2LKB A;  3FZK A;  3LDL A;  5EX5 A;  5AQO A;  3BK3 C;  1JXC A;  2BRZ A;  1OZZ A;  5BN8 A;  3D2F A;  1B3C A;  4FL9 A;  2QWO A;  5EY4 A;  1VNA A;  3KP0 A;  2B3C A;  3I33 A;  1K8B A;  3KVG A;  2LI7 A;  2KHO A;  3GKU A;  1ZUT A;  2ATB A;  1I6F A;  1ZVG A;  1KAY A;  1QQN A;  2E3G A;  2YBR C;  1LQH A;  2MZ0 A;  2QXL A;  5KK4 A;  1JZA A;  3PSM A;  1NGD A;  1MR4 A;  1NGB A;  2K35 A;  3LDQ A;  3R2V A;  3L6Q A;  2MBK A;  1VNB A;  1T1T A; 
#chains in the Genus database with same CATH homology
 1P0A A;  1I2U A;  1OMY A;  1ZYW A;  2KPY A;  2KBJ A;  2NY9 X;  2YEO A;  2GL1 A;  4AAZ A;  1KV0 A;  2E0H A;  1ZU3 A;  2KBH A;  2B68 A;  2LJM A;  1MYN A;  1T0Z A;  1BCG A;  2A7T A;  1PX9 A;  2KGQ A;  2I61 A;  4AEI A;  1LQI A;  1TI5 A;  1AYJ A;  1SN1 A;  1CN2 A;  1WMT A;  1C56 A;  1SNB A;  3E7R L;  1NH5 A;  1I2V A;  2E3F A;  2LJ7 A;  2KYQ A;  4HE7 A;  2N2Q A;  1PTX A;  1SN4 A;  1NRA A;  4AB0 A;  1BMR A;  1T7A A;  1SEG A;  2N66 A;  1BRZ A;  1C55 A;  1DQ7 A;  2KSK A;  1GPT A;  1T7E A;  1L4V A;  2NY8 X;  1ZFU A;  1NPI A;  5CY0 A;  2YC1 C;  1NRB A;  2LT8 A;  1N4N A;  1DJT A;  2ASC A;  1NE5 A;  1PE4 A;  1CHZ A;  2KBK A;  1B7D A;  1WT7 A;  2SN3 A;  4CQK A;  1WWN A;  1GPS A;  1ZYV A;  2KJA A;  2N2R A;  1T7B A;  2LY6 A;  2N69 A;  2LR3 A;  4HHF A;  1P00 A;  2LY5 A;  4V1D C;  1AHO A;  1I6G A;  1FH3 A;  1JZB A;  1BK8 A;  4UJ0 A;  1ICA A;  3E7U X;  1JKZ A;  1LQQ A;  4KYP A;  2M8B B;  1ZVE A;  2LKB A;  1JXC A;  2BRZ A;  1OZZ A;  1B3C A;  1VNA A;  2B3C A;  2LI7 A;  1ZUT A;  2ATB A;  1I6F A;  1ZVG A;  2E3G A;  2YBR C;  1LQH A;  2MZ0 A;  5KK4 A;  1JZA A;  3PSM A;  1MR4 A;  1VNB A;  1T1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...