1OZZA

Nmr structure of antifungal defensin ard1 from archaeoprepona demophon
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords defensin ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ozzA00
1AYJA 2A7TA 2LY5A 1LQIA 2LY6A 4UJ0A 2N66A 1BK8A 2YC1C 1PE4A 2SN3A 1ICAA 1ZU3A 1B7DA 2KPYA 4KYPA 1VNBA 1BRZA 1ZVGA 1SEGA 1I2VA 1TI5A 3E7RL 1ZFUA 4HHFA 1T7EA 2KJAA 1NPIA 1FH3A 1N4NA 2KSKA 1T0ZA 1I2UA 1NH5A 1SN4A 2N2RA 1B3CA 1DJTA 1WWNA 1I6FA 1P00A 1GPTA 1PX9A 4HE7A 1ZYVA 5CY0A 4CQKA 1T7AA 2NY9X 1AHOA 1LQQA 1SN1A 2KBJA 1BCGA 1NE5A 1JKZA 1WMTA 2YEOA 1MR4A 2KYQA 1CHZA 1ZYWA 1C56A 1ZVEA 1NRAA 1WT7A 1T1TA 1NRBA 1OMYA 2KBKA 2BRZA 1JZAA 1T7BA 2YBRC 1L4VA 1P0AA 2N2QA 2E3FA 1DQ7A 1SNBA 1JZBA 4AEIA 2B68A 1LQHA 2GL1A 2KBHA 2LR3A 4V1DC 2LKBA 1CN2A 4AB0A 1OZZA 1ZUTA 4AAZA 2MZ0A 1PTXA 1VNAA 2ASCA 2LJMA 3E7UX 1KV0A 1I6GA 2NY8X 1MYNA 1BMRA 2E0HA 5KK4A 2LT8A 1GPSA 2M8BB 2LI7A 2I61A 2ATBA 1C55A 2E3GA 2KGQA 2N69A 2B3CA 2LJ7A 3PSMA 1JXCA
chains in the Genus database with same CATH superfamily
5AQJA 1AYJA 2A7TA 2LY5A 1LQIA 2LY6A 5BPNA 4IO8A 2E2FA 4UJ0A 2N66A 5BPLA 1NGCA 2YC1C 3I33A 3HSCA 1BK8A 1PE4A 2SN3A 2VY6A 1ICAA 1ZU3A 2QWNA 1QQMA 2QWQA 1B7DA 2KPYA 1NGEA 4KYPA 3L4IA 3LDNA 1VNBA 1BRZA 3KVGA 2YILA 3QI7A 1KAYA 1ZVGA 5EX5A 1SEGA 5AQWA 1I2VA 1TI5A 3E7RL 1ZFUA 4HHFA 1HPMA 1T7EA 2KJAA 2E88A 1NPIA 1S3XA 1FH3A 5AR0A 2JDQD 1NGAA 5AQZA 1N4NA 2KSKA 2YIPA 3C7NB 1NGJA 1T0ZA 3D2EA 5AQFA 1NH5A 1QQOA 3LDOA 2QWLA 5AQXA 1I2UA 5AQLA 5BN8A 3FZMA 5BPMA 1SN4A 2N2RA 1XRSB 1B3CA 3BK3C 1NGHA 1DJTA 3L56A 3R2VA 1WWNA 4FL9A 1I6FA 5BN9A 3LDQA 1P00A 1GPTA 4UAEF 1PX9A 4HE7A 1ZYVA 4UAFE 5CY0A 4CQKA 2K35A 1T7AA 2QWRA 2NY9X 3ATVA 1AHOA 3GL1A 1YUWA 5AQKA 1ATSA 1LQQA 1SN1A 2KBJA 1BCGA 3FZFA 4H5VA 5AQSA 2KHOA 1KAXA 1NE5A 2LN8A 3KOXA 1JKZA 3FZHA 1WMTA 5FPMA 3IUCA 2YEOA 5FPDA 3A8YA 1MR4A 2KYQA 1CHZA 1ZYWA 1KAZA 3D2EB 5F1XA 1C56A 1ZVEA 5AQUA 1NRAA 1NGBA 1WT7A 1T1TA 2V7ZA 3LDLA 4UADE 1NRBA 1OMYA 5AQTA 3CQXA 3FZLA 3KOWA 3L6QA 5AQQA 2KBKA 2BRZA 2QXLA 1JZAA 4H5WA 1T7BA 4KBOA 3SF4D 2YBRC 1L4VA 5AQRA 5AQVA 4FSVA 1P0AA 2QWOA 2N2QA 3KC6A 2E3FA 1K8BA 1DQ7A 1SNBA 3CW4A 1JZBA 1DKGD 2QWPA 3LDPA 2MBKA 3QMLA 5EVZA 4AEIA 2B68A 1LQHA 5EY4A 2GL1A 2KBHA 2LR3A 4V1DC 2LKBA 1NGIA 1QQNA 1CN2A 2E8AA 5F2RA 3FE1A 5FPNA 4AB0A 3D2FA 3FZKA 5AQHA 1OZZA 2YIOA 1ZUTA 1NGFA 4AAZA 2MZ0A 1PTXA 1VNAA 2ASCA 1NGDA 3AY9A 3KOYA 3M3ZA 2LJMA 3E7UX 5AQIA 1KV0A 3QFPA 1I6GA 3JXUA 5AQOA 2NY8X 5AQGA 1MYNA 1UGLA 4HWIA 1HJOA 1HX1A 3ATUA 4H5RA 2E0HA 1BMRA 1ATRA 5KK4A 1POIA 2LT8A 3KHWA 1NGGA 2GMOA 5FPEA 1GPSA 5F0XA 5AQMA 2M8BB 2D56A 2LI7A 2QWMA 2I61A 3GDQA 2ATBA 1C55A 2E3GA 4H5NA 2MN5A 3D2FB 3GKUA 5EXWA 3KOZA 3KP0A 2KGQA 5AQYA 2N69A 4H5TA 4GNIA 3KP1A 5AQPA 2B3CA 2BUPA 3QFUA 3C7NA 1BUPA 1BA1A 2QW9A 1BA0A 2LJ7A 2G2KA 5AQNA 3PSMA 1JXCA
chains in the Genus database with same CATH topology
1AYJA 2A7TA 2LY5A 1LQIA 2LY6A 4UJ0A 2N66A 1BK8A 2YC1C 1PE4A 2SN3A 1ICAA 1ZU3A 1B7DA 2KPYA 4KYPA 1VNBA 1BRZA 1ZVGA 1SEGA 1I2VA 1TI5A 3E7RL 1ZFUA 4HHFA 1T7EA 2KJAA 1NPIA 1FH3A 1N4NA 2KSKA 1T0ZA 1I2UA 1NH5A 1SN4A 2N2RA 1B3CA 1DJTA 1WWNA 1I6FA 1P00A 1GPTA 1PX9A 4HE7A 1ZYVA 5CY0A 4CQKA 1T7AA 2NY9X 1AHOA 1LQQA 1SN1A 2KBJA 1BCGA 1NE5A 1JKZA 1WMTA 2YEOA 1MR4A 2KYQA 1CHZA 1ZYWA 1C56A 1ZVEA 1NRAA 1WT7A 1T1TA 1NRBA 1OMYA 2KBKA 2BRZA 1JZAA 1T7BA 2YBRC 1L4VA 1P0AA 2N2QA 2E3FA 1DQ7A 1SNBA 1JZBA 4AEIA 2B68A 1LQHA 2GL1A 2KBHA 2LR3A 4V1DC 2LKBA 1CN2A 4AB0A 1OZZA 1ZUTA 4AAZA 2MZ0A 1PTXA 1VNAA 2ASCA 2LJMA 3E7UX 1KV0A 1I6GA 2NY8X 1MYNA 1BMRA 2E0HA 5KK4A 2LT8A 1GPSA 2M8BB 2LI7A 2I61A 2ATBA 1C55A 2E3GA 2KGQA 2N69A 2B3CA 2LJ7A 3PSMA 1JXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYJ A;  2A7T A;  2LY5 A;  1LQI A;  2LY6 A;  4UJ0 A;  2N66 A;  1BK8 A;  2YC1 C;  1PE4 A;  2SN3 A;  1ICA A;  1ZU3 A;  1B7D A;  2KPY A;  4KYP A;  1VNB A;  1BRZ A;  1ZVG A;  1SEG A;  1I2V A;  1TI5 A;  3E7R L;  1ZFU A;  4HHF A;  1T7E A;  2KJA A;  1NPI A;  1FH3 A;  1N4N A;  2KSK A;  1T0Z A;  1I2U A;  1NH5 A;  1SN4 A;  2N2R A;  1B3C A;  1DJT A;  1WWN A;  1I6F A;  1P00 A;  1GPT A;  1PX9 A;  4HE7 A;  1ZYV A;  5CY0 A;  4CQK A;  1T7A A;  2NY9 X;  1AHO A;  1LQQ A;  1SN1 A;  2KBJ A;  1BCG A;  1NE5 A;  1JKZ A;  1WMT A;  2YEO A;  1MR4 A;  2KYQ A;  1CHZ A;  1ZYW A;  1C56 A;  1ZVE A;  1NRA A;  1WT7 A;  1T1T A;  1NRB A;  1OMY A;  2KBK A;  2BRZ A;  1JZA A;  1T7B A;  2YBR C;  1L4V A;  1P0A A;  2N2Q A;  2E3F A;  1DQ7 A;  1SNB A;  1JZB A;  4AEI A;  2B68 A;  1LQH A;  2GL1 A;  2KBH A;  2LR3 A;  4V1D C;  2LKB A;  1CN2 A;  4AB0 A;  1OZZ A;  1ZUT A;  4AAZ A;  2MZ0 A;  1PTX A;  1VNA A;  2ASC A;  2LJM A;  3E7U X;  1KV0 A;  1I6G A;  2NY8 X;  1MYN A;  1BMR A;  2E0H A;  5KK4 A;  2LT8 A;  1GPS A;  2M8B B;  2LI7 A;  2I61 A;  2ATB A;  1C55 A;  2E3G A;  2KGQ A;  2N69 A;  2B3C A;  2LJ7 A;  3PSM A;  1JXC A; 
#chains in the Genus database with same CATH topology
 5AQJ A;  1AYJ A;  2A7T A;  2LY5 A;  1LQI A;  2LY6 A;  5BPN A;  4IO8 A;  2E2F A;  4UJ0 A;  2N66 A;  5BPL A;  1NGC A;  2YC1 C;  3I33 A;  3HSC A;  1BK8 A;  1PE4 A;  2SN3 A;  2VY6 A;  1ICA A;  1ZU3 A;  2QWN A;  1QQM A;  2QWQ A;  1B7D A;  2KPY A;  1NGE A;  4KYP A;  3L4I A;  3LDN A;  1VNB A;  1BRZ A;  3KVG A;  2YIL A;  3QI7 A;  1KAY A;  1ZVG A;  5EX5 A;  1SEG A;  5AQW A;  1I2V A;  1TI5 A;  3E7R L;  1ZFU A;  4HHF A;  1HPM A;  1T7E A;  2KJA A;  2E88 A;  1NPI A;  1S3X A;  1FH3 A;  5AR0 A;  2JDQ D;  1NGA A;  5AQZ A;  1N4N A;  2KSK A;  2YIP A;  3C7N B;  1NGJ A;  1T0Z A;  3D2E A;  5AQF A;  1NH5 A;  1QQO A;  3LDO A;  2QWL A;  5AQX A;  1I2U A;  5AQL A;  5BN8 A;  3FZM A;  5BPM A;  1SN4 A;  2N2R A;  1XRS B;  1B3C A;  3BK3 C;  1NGH A;  1DJT A;  3L56 A;  3R2V A;  1WWN A;  4FL9 A;  1I6F A;  5BN9 A;  3LDQ A;  1P00 A;  1GPT A;  4UAE F;  1PX9 A;  4HE7 A;  1ZYV A;  4UAF E;  5CY0 A;  4CQK A;  2K35 A;  1T7A A;  2QWR A;  2NY9 X;  3ATV A;  1AHO A;  3GL1 A;  1YUW A;  5AQK A;  1ATS A;  1LQQ A;  1SN1 A;  2KBJ A;  1BCG A;  3FZF A;  4H5V A;  5AQS A;  2KHO A;  1KAX A;  1NE5 A;  2LN8 A;  3KOX A;  1JKZ A;  3FZH A;  1WMT A;  5FPM A;  3IUC A;  2YEO A;  5FPD A;  3A8Y A;  1MR4 A;  2KYQ A;  1CHZ A;  1ZYW A;  1KAZ A;  3D2E B;  5F1X A;  1C56 A;  1ZVE A;  5AQU A;  1NRA A;  1NGB A;  1WT7 A;  1T1T A;  2V7Z A;  3LDL A;  4UAD E;  1NRB A;  1OMY A;  5AQT A;  3CQX A;  3FZL A;  3KOW A;  3L6Q A;  5AQQ A;  2KBK A;  2BRZ A;  2QXL A;  1JZA A;  4H5W A;  1T7B A;  4KBO A;  3SF4 D;  2YBR C;  1L4V A;  5AQR A;  5AQV A;  4FSV A;  1P0A A;  2QWO A;  2N2Q A;  3KC6 A;  2E3F A;  1K8B A;  1DQ7 A;  1SNB A;  3CW4 A;  1JZB A;  1DKG D;  2QWP A;  3LDP A;  2MBK A;  3QML A;  5EVZ A;  4AEI A;  2B68 A;  1LQH A;  5EY4 A;  2GL1 A;  2KBH A;  2LR3 A;  4V1D C;  2LKB A;  1NGI A;  1QQN A;  1CN2 A;  2E8A A;  5F2R A;  3FE1 A;  5FPN A;  4AB0 A;  3D2F A;  3FZK A;  5AQH A;  1OZZ A;  2YIO A;  1ZUT A;  1NGF A;  4AAZ A;  2MZ0 A;  1PTX A;  1VNA A;  2ASC A;  1NGD A;  3AY9 A;  3KOY A;  3M3Z A;  2LJM A;  3E7U X;  5AQI A;  1KV0 A;  3QFP A;  1I6G A;  3JXU A;  5AQO A;  2NY8 X;  5AQG A;  1MYN A;  1UGL A;  4HWI A;  1HJO A;  1HX1 A;  3ATU A;  4H5R A;  2E0H A;  1BMR A;  1ATR A;  5KK4 A;  1POI A;  2LT8 A;  3KHW A;  1NGG A;  2GMO A;  5FPE A;  1GPS A;  5F0X A;  5AQM A;  2M8B B;  2D56 A;  2LI7 A;  2QWM A;  2I61 A;  3GDQ A;  2ATB A;  1C55 A;  2E3G A;  4H5N A;  2MN5 A;  3D2F B;  3GKU A;  5EXW A;  3KOZ A;  3KP0 A;  2KGQ A;  5AQY A;  2N69 A;  4H5T A;  4GNI A;  3KP1 A;  5AQP A;  2B3C A;  2BUP A;  3QFU A;  3C7N A;  1BUP A;  1BA1 A;  2QW9 A;  1BA0 A;  2LJ7 A;  2G2K A;  5AQN A;  3PSM A;  1JXC A; 
#chains in the Genus database with same CATH homology
 1AYJ A;  2A7T A;  2LY5 A;  1LQI A;  2LY6 A;  4UJ0 A;  2N66 A;  1BK8 A;  2YC1 C;  1PE4 A;  2SN3 A;  1ICA A;  1ZU3 A;  1B7D A;  2KPY A;  4KYP A;  1VNB A;  1BRZ A;  1ZVG A;  1SEG A;  1I2V A;  1TI5 A;  3E7R L;  1ZFU A;  4HHF A;  1T7E A;  2KJA A;  1NPI A;  1FH3 A;  1N4N A;  2KSK A;  1T0Z A;  1I2U A;  1NH5 A;  1SN4 A;  2N2R A;  1B3C A;  1DJT A;  1WWN A;  1I6F A;  1P00 A;  1GPT A;  1PX9 A;  4HE7 A;  1ZYV A;  5CY0 A;  4CQK A;  1T7A A;  2NY9 X;  1AHO A;  1LQQ A;  1SN1 A;  2KBJ A;  1BCG A;  1NE5 A;  1JKZ A;  1WMT A;  2YEO A;  1MR4 A;  2KYQ A;  1CHZ A;  1ZYW A;  1C56 A;  1ZVE A;  1NRA A;  1WT7 A;  1T1T A;  1NRB A;  1OMY A;  2KBK A;  2BRZ A;  1JZA A;  1T7B A;  2YBR C;  1L4V A;  1P0A A;  2N2Q A;  2E3F A;  1DQ7 A;  1SNB A;  1JZB A;  4AEI A;  2B68 A;  1LQH A;  2GL1 A;  2KBH A;  2LR3 A;  4V1D C;  2LKB A;  1CN2 A;  4AB0 A;  1OZZ A;  1ZUT A;  4AAZ A;  2MZ0 A;  1PTX A;  1VNA A;  2ASC A;  2LJM A;  3E7U X;  1KV0 A;  1I6G A;  2NY8 X;  1MYN A;  1BMR A;  2E0H A;  5KK4 A;  2LT8 A;  1GPS A;  2M8B B;  2LI7 A;  2I61 A;  2ATB A;  1C55 A;  2E3G A;  2KGQ A;  2N69 A;  2B3C A;  2LJ7 A;  3PSM A;  1JXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...