1OZZA

Nmr structure of antifungal defensin ard1 from archaeoprepona demophon
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
b'DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords defensin ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 7
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ozzA00
2E3GA 1T7EA 2N66A 2YC1C 4V1DC 1C55A 2KPYA 1B3CA 1I6FA 1T7AA 4AB0A 1AHOA 1OZZA 1N4NA 1WMTA 1DJTA 1SNBA 1I2UA 2LY6A 1NRBA 1P00A 1JZAA 2LJMA 2SN3A 2ATBA 1TI5A 2NY9X 1NH5A 2M8BB 2N2QA 2N69A 2LR3A 2E0HA 1PTXA 2ASCA 1AYJA 2LI7A 1VNBA 2YBRC 4HE7A 1JKZA 1VNAA 1BMRA 1NE5A 1PE4A 1GPSA 1SN1A 2E3FA 1FH3A 1LQQA 1PX9A 2LKBA 1JZBA 2A7TA 1B7DA 1ZVEA 2B68A 2N2RA 1OMYA 1LQHA 2I61A 1L4VA 1BK8A 1GPTA 5KK4A 1MYNA 4HHFA 4UJ0A 2LJ7A 1ICAA 3PSMA 1ZVGA 1DQ7A 1BRZA 1T1TA 2MZ0A 2LT8A 2YEOA 4AAZA 1KV0A 1ZYVA 1P0AA 2KYQA 1CN2A 2KGQA 1ZU3A 5CY0A 4KYPA 2KJAA 1C56A 1I6GA 1T0ZA 2BRZA 1NRAA 3E7UX 1WWNA 4AEIA 2KSKA 2GL1A 2NY8X 1JXCA 1MR4A 1SN4A 1SEGA 1NPIA 1CHZA 2KBHA 1I2VA 1T7BA 2KBKA 2LY5A 1WT7A 3E7RL 4CQKA 2B3CA 1ZUTA 1ZFUA 1ZYWA 2KBJA 1BCGA 1LQIA
chains in the Genus database with same CATH superfamily
1KAZA 5FPMA 2E3GA 1T7EA 1DKGD 3CW4A 2N66A 3M3ZA 2YC1C 4V1DC 4UADE 1LQIA 1C55A 2QWLA 3LDNA 2KPYA 5BPNA 1B3CA 3HSCA 1QQNA 1I6FA 1T7AA 4AB0A 1AHOA 1OZZA 1NGEA 1N4NA 1NGDA 1WMTA 4UAFE 3KP0A 3L4IA 5EX5A 1DJTA 2E88A 5EXWA 1SNBA 1HPMA 1I2UA 2LY6A 1NRBA 1P00A 1JZAA 2LJMA 1BA0A 2SN3A 2ATBA 1TI5A 3QMLA 4GNIA 2NY9X 1NH5A 4HWIA 2M8BB 1ATSA 2N2QA 3ATUA 2N69A 1NGCA 2LR3A 3IUCA 2E0HA 5AQGA 1PTXA 2ASCA 1AYJA 3KOZA 1XRSB 2LI7A 5AQVA 1VNBA 2YBRC 4HE7A 3C7NB 4H5WA 5FPNA 1VNAA 1NGGA 5BN9A 1BMRA 1JKZA 5AR0A 5F1XA 2D56A 4H5VA 5AQWA 1NGAA 5F0XA 1NE5A 3GL1A 3CQXA 4UAEF 3GKUA 1PE4A 3L56A 1GPSA 3D2EA 1HX1A 1SN1A 2E3FA 2KHOA 1POIA 2V7ZA 2GMOA 1FH3A 1LQQA 5AQSA 1PX9A 2LKBA 2QW9A 5AQOA 1S3XA 1JZBA 5AQNA 1KAYA 5FPDA 2A7TA 3LDOA 1B7DA 1ZVEA 2B68A 3AY9A 1BUPA 2N2RA 1OMYA 1LQHA 2I61A 1L4VA 2QXLA 5AQYA 1BK8A 3D2FA 1UGLA 4H5RA 5BPLA 1GPTA 5KK4A 1MYNA 4HHFA 2VY6A 4UJ0A 3KP1A 3KC6A 5AQLA 2LJ7A 1ICAA 3BK3C 2MBKA 3PSMA 1ZVGA 4FSVA 1DQ7A 1BRZA 1T1TA 2MZ0A 2LT8A 2QWNA 2YEOA 5AQMA 5BPMA 1K8BA 5AQFA 3D2EB 1NGBA 3A8YA 4AAZA 1KV0A 1ZYVA 2QWQA 1P0AA 2MN5A 1ATRA 1NGJA 4KBOA 2E8AA 2QWPA 3R2VA 4FL9A 1NGFA 2KYQA 1CN2A 3KVGA 2KGQA 5AQQA 1ZU3A 3QI7A 3LDQA 4KYPA 2KJAA 5CY0A 2BUPA 5AQKA 1C56A 3SF4D 3KOWA 1I6GA 3KOXA 1T0ZA 2YIPA 3LDPA 2BRZA 1NRAA 3E7UX 3FZMA 1WWNA 1YUWA 2YIOA 2KSKA 3FZKA 3I33A 5AQHA 4AEIA 2GL1A 2NY8X 1JXCA 1HJOA 1MR4A 1SN4A 1SEGA 3QFUA 1KAXA 2QWRA 3FZHA 5AQRA 2K35A 3C7NA 3L6QA 5AQTA 1NPIA 1CHZA 3FZLA 5AQPA 2JDQD 2KBHA 5AQZA 2YILA 3FE1A 1I2VA 1T7BA 2E2FA 2KBKA 4IO8A 5AQJA 5AQXA 2LY5A 3ATVA 1BA1A 3KHWA 3KOYA 1QQMA 2LN8A 1WT7A 5EVZA 5F2RA 5FPEA 3E7RL 5AQIA 4CQKA 2B3CA 3JXUA 2QWOA 4H5NA 1ZUTA 2QWMA 3LDLA 3FZFA 1ZFUA 3QFPA 1ZYWA 4H5TA 1NGHA 2G2KA 2KBJA 5EY4A 1BCGA 5AQUA 5BN8A 1QQOA 1NGIA 3D2FB 3GDQA
chains in the Genus database with same CATH topology
2E3GA 1T7EA 2N66A 2YC1C 4V1DC 1C55A 2KPYA 1B3CA 1I6FA 1T7AA 4AB0A 1AHOA 1OZZA 1N4NA 1WMTA 1DJTA 1SNBA 1I2UA 2LY6A 1NRBA 1P00A 1JZAA 2LJMA 2SN3A 2ATBA 1TI5A 2NY9X 1NH5A 2M8BB 2N2QA 2N69A 2LR3A 2E0HA 1PTXA 2ASCA 1AYJA 2LI7A 1VNBA 2YBRC 4HE7A 1JKZA 1VNAA 1BMRA 1NE5A 1PE4A 1GPSA 1SN1A 2E3FA 1FH3A 1LQQA 1PX9A 2LKBA 1JZBA 2A7TA 1B7DA 1ZVEA 2B68A 2N2RA 1OMYA 1LQHA 2I61A 1L4VA 1BK8A 1GPTA 5KK4A 1MYNA 4HHFA 4UJ0A 2LJ7A 1ICAA 3PSMA 1ZVGA 1DQ7A 1BRZA 1T1TA 2MZ0A 2LT8A 2YEOA 4AAZA 1KV0A 1ZYVA 1P0AA 2KYQA 1CN2A 2KGQA 1ZU3A 5CY0A 4KYPA 2KJAA 1C56A 1I6GA 1T0ZA 2BRZA 1NRAA 3E7UX 1WWNA 4AEIA 2KSKA 2GL1A 2NY8X 1JXCA 1MR4A 1SN4A 1SEGA 1NPIA 1CHZA 2KBHA 1I2VA 1T7BA 2KBKA 2LY5A 1WT7A 3E7RL 4CQKA 2B3CA 1ZUTA 1ZFUA 1ZYWA 2KBJA 1BCGA 1LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3G A;  1T7E A;  2N66 A;  2YC1 C;  4V1D C;  1C55 A;  2KPY A;  1B3C A;  1I6F A;  1T7A A;  4AB0 A;  1AHO A;  1OZZ A;  1N4N A;  1WMT A;  1DJT A;  1SNB A;  1I2U A;  2LY6 A;  1NRB A;  1P00 A;  1JZA A;  2LJM A;  2SN3 A;  2ATB A;  1TI5 A;  2NY9 X;  1NH5 A;  2M8B B;  2N2Q A;  2N69 A;  2LR3 A;  2E0H A;  1PTX A;  2ASC A;  1AYJ A;  2LI7 A;  1VNB A;  2YBR C;  4HE7 A;  1JKZ A;  1VNA A;  1BMR A;  1NE5 A;  1PE4 A;  1GPS A;  1SN1 A;  2E3F A;  1FH3 A;  1LQQ A;  1PX9 A;  2LKB A;  1JZB A;  2A7T A;  1B7D A;  1ZVE A;  2B68 A;  2N2R A;  1OMY A;  1LQH A;  2I61 A;  1L4V A;  1BK8 A;  1GPT A;  5KK4 A;  1MYN A;  4HHF A;  4UJ0 A;  2LJ7 A;  1ICA A;  3PSM A;  1ZVG A;  1DQ7 A;  1BRZ A;  1T1T A;  2MZ0 A;  2LT8 A;  2YEO A;  4AAZ A;  1KV0 A;  1ZYV A;  1P0A A;  2KYQ A;  1CN2 A;  2KGQ A;  1ZU3 A;  5CY0 A;  4KYP A;  2KJA A;  1C56 A;  1I6G A;  1T0Z A;  2BRZ A;  1NRA A;  3E7U X;  1WWN A;  4AEI A;  2KSK A;  2GL1 A;  2NY8 X;  1JXC A;  1MR4 A;  1SN4 A;  1SEG A;  1NPI A;  1CHZ A;  2KBH A;  1I2V A;  1T7B A;  2KBK A;  2LY5 A;  1WT7 A;  3E7R L;  4CQK A;  2B3C A;  1ZUT A;  1ZFU A;  1ZYW A;  2KBJ A;  1BCG A;  1LQI A; 
#chains in the Genus database with same CATH topology
 1KAZ A;  5FPM A;  2E3G A;  1T7E A;  1DKG D;  3CW4 A;  2N66 A;  3M3Z A;  2YC1 C;  4V1D C;  4UAD E;  1LQI A;  1C55 A;  2QWL A;  3LDN A;  2KPY A;  5BPN A;  1B3C A;  3HSC A;  1QQN A;  1I6F A;  1T7A A;  4AB0 A;  1AHO A;  1OZZ A;  1NGE A;  1N4N A;  1NGD A;  1WMT A;  4UAF E;  3KP0 A;  3L4I A;  5EX5 A;  1DJT A;  2E88 A;  5EXW A;  1SNB A;  1HPM A;  1I2U A;  2LY6 A;  1NRB A;  1P00 A;  1JZA A;  2LJM A;  1BA0 A;  2SN3 A;  2ATB A;  1TI5 A;  3QML A;  4GNI A;  2NY9 X;  1NH5 A;  4HWI A;  2M8B B;  1ATS A;  2N2Q A;  3ATU A;  2N69 A;  1NGC A;  2LR3 A;  3IUC A;  2E0H A;  5AQG A;  1PTX A;  2ASC A;  1AYJ A;  3KOZ A;  1XRS B;  2LI7 A;  5AQV A;  1VNB A;  2YBR C;  4HE7 A;  3C7N B;  4H5W A;  5FPN A;  1VNA A;  1NGG A;  5BN9 A;  1BMR A;  1JKZ A;  5AR0 A;  5F1X A;  2D56 A;  4H5V A;  5AQW A;  1NGA A;  5F0X A;  1NE5 A;  3GL1 A;  3CQX A;  4UAE F;  3GKU A;  1PE4 A;  3L56 A;  1GPS A;  3D2E A;  1HX1 A;  1SN1 A;  2E3F A;  2KHO A;  1POI A;  2V7Z A;  2GMO A;  1FH3 A;  1LQQ A;  5AQS A;  1PX9 A;  2LKB A;  2QW9 A;  5AQO A;  1S3X A;  1JZB A;  5AQN A;  1KAY A;  5FPD A;  2A7T A;  3LDO A;  1B7D A;  1ZVE A;  2B68 A;  3AY9 A;  1BUP A;  2N2R A;  1OMY A;  1LQH A;  2I61 A;  1L4V A;  2QXL A;  5AQY A;  1BK8 A;  3D2F A;  1UGL A;  4H5R A;  5BPL A;  1GPT A;  5KK4 A;  1MYN A;  4HHF A;  2VY6 A;  4UJ0 A;  3KP1 A;  3KC6 A;  5AQL A;  2LJ7 A;  1ICA A;  3BK3 C;  2MBK A;  3PSM A;  1ZVG A;  4FSV A;  1DQ7 A;  1BRZ A;  1T1T A;  2MZ0 A;  2LT8 A;  2QWN A;  2YEO A;  5AQM A;  5BPM A;  1K8B A;  5AQF A;  3D2E B;  1NGB A;  3A8Y A;  4AAZ A;  1KV0 A;  1ZYV A;  2QWQ A;  1P0A A;  2MN5 A;  1ATR A;  1NGJ A;  4KBO A;  2E8A A;  2QWP A;  3R2V A;  4FL9 A;  1NGF A;  2KYQ A;  1CN2 A;  3KVG A;  2KGQ A;  5AQQ A;  1ZU3 A;  3QI7 A;  3LDQ A;  4KYP A;  2KJA A;  5CY0 A;  2BUP A;  5AQK A;  1C56 A;  3SF4 D;  3KOW A;  1I6G A;  3KOX A;  1T0Z A;  2YIP A;  3LDP A;  2BRZ A;  1NRA A;  3E7U X;  3FZM A;  1WWN A;  1YUW A;  2YIO A;  2KSK A;  3FZK A;  3I33 A;  5AQH A;  4AEI A;  2GL1 A;  2NY8 X;  1JXC A;  1HJO A;  1MR4 A;  1SN4 A;  1SEG A;  3QFU A;  1KAX A;  2QWR A;  3FZH A;  5AQR A;  2K35 A;  3C7N A;  3L6Q A;  5AQT A;  1NPI A;  1CHZ A;  3FZL A;  5AQP A;  2JDQ D;  2KBH A;  5AQZ A;  2YIL A;  3FE1 A;  1I2V A;  1T7B A;  2E2F A;  2KBK A;  4IO8 A;  5AQJ A;  5AQX A;  2LY5 A;  3ATV A;  1BA1 A;  3KHW A;  3KOY A;  1QQM A;  2LN8 A;  1WT7 A;  5EVZ A;  5F2R A;  5FPE A;  3E7R L;  5AQI A;  4CQK A;  2B3C A;  3JXU A;  2QWO A;  4H5N A;  1ZUT A;  2QWM A;  3LDL A;  3FZF A;  1ZFU A;  3QFP A;  1ZYW A;  4H5T A;  1NGH A;  2G2K A;  2KBJ A;  5EY4 A;  1BCG A;  5AQU A;  5BN8 A;  1QQO A;  1NGI A;  3D2F B;  3GDQ A; 
#chains in the Genus database with same CATH homology
 2E3G A;  1T7E A;  2N66 A;  2YC1 C;  4V1D C;  1C55 A;  2KPY A;  1B3C A;  1I6F A;  1T7A A;  4AB0 A;  1AHO A;  1OZZ A;  1N4N A;  1WMT A;  1DJT A;  1SNB A;  1I2U A;  2LY6 A;  1NRB A;  1P00 A;  1JZA A;  2LJM A;  2SN3 A;  2ATB A;  1TI5 A;  2NY9 X;  1NH5 A;  2M8B B;  2N2Q A;  2N69 A;  2LR3 A;  2E0H A;  1PTX A;  2ASC A;  1AYJ A;  2LI7 A;  1VNB A;  2YBR C;  4HE7 A;  1JKZ A;  1VNA A;  1BMR A;  1NE5 A;  1PE4 A;  1GPS A;  1SN1 A;  2E3F A;  1FH3 A;  1LQQ A;  1PX9 A;  2LKB A;  1JZB A;  2A7T A;  1B7D A;  1ZVE A;  2B68 A;  2N2R A;  1OMY A;  1LQH A;  2I61 A;  1L4V A;  1BK8 A;  1GPT A;  5KK4 A;  1MYN A;  4HHF A;  4UJ0 A;  2LJ7 A;  1ICA A;  3PSM A;  1ZVG A;  1DQ7 A;  1BRZ A;  1T1T A;  2MZ0 A;  2LT8 A;  2YEO A;  4AAZ A;  1KV0 A;  1ZYV A;  1P0A A;  2KYQ A;  1CN2 A;  2KGQ A;  1ZU3 A;  5CY0 A;  4KYP A;  2KJA A;  1C56 A;  1I6G A;  1T0Z A;  2BRZ A;  1NRA A;  3E7U X;  1WWN A;  4AEI A;  2KSK A;  2GL1 A;  2NY8 X;  1JXC A;  1MR4 A;  1SN4 A;  1SEG A;  1NPI A;  1CHZ A;  2KBH A;  1I2V A;  1T7B A;  2KBK A;  2LY5 A;  1WT7 A;  3E7R L;  4CQK A;  2B3C A;  1ZUT A;  1ZFU A;  1ZYW A;  2KBJ A;  1BCG A;  1LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...