2LR3A

Solution structure of the anti-fungal defensin def4 (mtr_8g070770) from medicago truncatula (barrel clover)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
47
structure length
47
Chain Sequence
RTCESQSHKFKGPCASDHNCASVCQTERFSGGRCRGFRRRCFCTTHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin
publication title Structural and Functional Studies of a Phosphatidic Acid-Binding Antifungal Plant Defensin MtDef4: Identification of an RGFRRR Motif Governing Fungal Cell Entry.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Antifungal protein
total genus 12
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2lr3A00
1SEGA 1I6FA 3E7RL 4UJ0A 1BMRA 1ZU3A 2YEOA 1AHOA 1T7AA 1DJTA 1FH3A 1AYJA 1B3CA 1T1TA 2GL1A 1JZBA 1LQQA 2KBJA 1BRZA 1WWNA 1NH5A 2E0HA 1T0ZA 1T7EA 1I2VA 1CHZA 1NRBA 1PX9A 1JKZA 2A7TA 1VNAA 1BCGA 1ZVEA 1L4VA 1SN1A 1VNBA 1JXCA 2M8BB 1ZUTA 2LR3A 2N2RA 2LKBA 1C55A 2KPYA 1WT7A 2BRZA 1T7BA 1P0AA 1OZZA 2LT8A 1N4NA 2LJMA 1NPIA 2N2QA 1LQHA 1NE5A 1CN2A 4HE7A 4AB0A 2N69A 2YC1C 1JZAA 2KBHA 1TI5A 1ZYWA 4CQKA 3PSMA 2LJ7A 1C56A 2LY6A 4HHFA 2E3GA 1P00A 1ICAA 1BK8A 2N66A 1I2UA 1NRAA 4V1DC 2KGQA 1ZYVA 2B3CA 5KK4A 1MYNA 1I6GA 2MZ0A 1ZFUA 1PE4A 1DQ7A 2LI7A 2KBKA 1KV0A 3E7UX 5CY0A 2NY9X 2YBRC 2KJAA 2B68A 2NY8X 1B7DA 4AAZA 1WMTA 1LQIA 1ZVGA 2SN3A 1MR4A 2KSKA 1OMYA 1SN4A 4AEIA 2ATBA 2I61A 1GPSA 2E3FA 1PTXA 2ASCA 1SNBA 1GPTA 4KYPA 2LY5A 2KYQA
chains in the Genus database with same CATH superfamily
1SEGA 3KP1A 2YIOA 1I6FA 5AQFA 3E7RL 2VY6A 2QXLA 4UJ0A 1ZU3A 2YEOA 1AHOA 1T7AA 1BMRA 1DJTA 1FH3A 4GNIA 3D2EB 3ATUA 1AYJA 1B3CA 5AQPA 4H5TA 1QQOA 3FZLA 3GL1A 1T1TA 1KAXA 2GL1A 1JZBA 1LQQA 2BUPA 2KBJA 1BRZA 1WWNA 1NH5A 2E0HA 2GMOA 1HJOA 5AQYA 3FZKA 1UGLA 1T0ZA 5AQNA 4UADE 1NGDA 5AQKA 5F0XA 2D56A 5FPDA 1KAZA 2QWNA 3KC6A 1T7EA 2E2FA 1I2VA 5EVZA 3QFUA 2QWMA 4FSVA 1CHZA 1NRBA 1PX9A 5AQQA 1JKZA 2A7TA 1YUWA 2JDQD 3BK3C 1VNAA 1KAYA 3LDQA 5AR0A 5BPLA 2QWOA 2MBKA 5BPNA 5AQVA 5F1XA 1BCGA 3KP0A 1ZVEA 2MN5A 3L6QA 2YILA 1NGJA 1QQMA 1L4VA 3QFPA 5EX5A 1NGFA 1SN1A 5AQIA 1VNBA 1HX1A 1JXCA 3D2FA 2M8BB 3FZMA 1ZUTA 2LR3A 2N2RA 4H5NA 2LKBA 1C55A 2KPYA 5AQRA 1WT7A 5AQUA 2BRZA 1T7BA 1P0AA 3C7NB 5F2RA 2E8AA 3D2EA 1OZZA 1BUPA 2LT8A 3LDLA 1N4NA 2LJMA 3KOYA 2YIPA 1NPIA 1HPMA 2G2KA 2N2QA 5BN9A 1LQHA 2QWLA 1NE5A 1NGCA 1CN2A 3LDPA 4HE7A 4AB0A 2N69A 2YC1C 1JZAA 1S3XA 2KBHA 4UAFE 5EXWA 1NGEA 1TI5A 1ZYWA 3IUCA 4CQKA 3HSCA 5AQHA 2QWPA 3PSMA 2LJ7A 3ATVA 4UAEF 4H5VA 1C56A 4HWIA 2LY6A 1NGGA 4HHFA 5FPMA 1XRSB 2E3GA 5AQTA 3L4IA 1P00A 1NGAA 3QI7A 1ICAA 3KVGA 1BK8A 2N66A 3FZFA 1QQNA 3FE1A 1NRAA 3R2VA 5AQGA 1ATSA 2KGQA 4V1DC 5BN8A 1ZYVA 2LN8A 2B3CA 5AQSA 4IO8A 5AQZA 5KK4A 1MYNA 3FZHA 4H5WA 1I6GA 2E88A 3I33A 3C7NA 2MZ0A 5AQMA 1ATRA 2V7ZA 1ZFUA 1PE4A 1DQ7A 4H5RA 2LI7A 2K35A 2KBKA 3KHWA 4FL9A 5FPEA 4KBOA 5AQJA 5AQOA 1KV0A 1K8BA 3E7UX 5CY0A 3D2FB 1BA1A 1NGHA 2NY9X 3CW4A 2YBRC 3LDOA 3QMLA 2QWQA 2KJAA 3GKUA 2B68A 2NY8X 2QW9A 1B7DA 3AY9A 3L56A 4AAZA 1WMTA 1LQIA 1ZVGA 2QWRA 3JXUA 2SN3A 1MR4A 1I2UA 1BA0A 2KSKA 1DKGD 1OMYA 1SN4A 5BPMA 3KOZA 4AEIA 3A8YA 2ATBA 2I61A 3KOWA 3LDNA 5AQXA 1GPSA 1POIA 1NGBA 3SF4D 2E3FA 1PTXA 2ASCA 1SNBA 3GDQA 5FPNA 4KYPA 1GPTA 2KHOA 1NGIA 3M3ZA 5AQWA 3KOXA 2LY5A 5EY4A 3CQXA 2KYQA 5AQLA
chains in the Genus database with same CATH topology
1SEGA 1I6FA 3E7RL 4UJ0A 1BMRA 1ZU3A 2YEOA 1AHOA 1T7AA 1DJTA 1FH3A 1AYJA 1B3CA 1T1TA 2GL1A 1JZBA 1LQQA 2KBJA 1BRZA 1WWNA 1NH5A 2E0HA 1T0ZA 1T7EA 1I2VA 1CHZA 1NRBA 1PX9A 1JKZA 2A7TA 1VNAA 1BCGA 1ZVEA 1L4VA 1SN1A 1VNBA 1JXCA 2M8BB 1ZUTA 2LR3A 2N2RA 2LKBA 1C55A 2KPYA 1WT7A 2BRZA 1T7BA 1P0AA 1OZZA 2LT8A 1N4NA 2LJMA 1NPIA 2N2QA 1LQHA 1NE5A 1CN2A 4HE7A 4AB0A 2N69A 2YC1C 1JZAA 2KBHA 1TI5A 1ZYWA 4CQKA 3PSMA 2LJ7A 1C56A 2LY6A 4HHFA 2E3GA 1P00A 1ICAA 1BK8A 2N66A 1I2UA 1NRAA 4V1DC 2KGQA 1ZYVA 2B3CA 5KK4A 1MYNA 1I6GA 2MZ0A 1ZFUA 1PE4A 1DQ7A 2LI7A 2KBKA 1KV0A 3E7UX 5CY0A 2NY9X 2YBRC 2KJAA 2B68A 2NY8X 1B7DA 4AAZA 1WMTA 1LQIA 1ZVGA 2SN3A 1MR4A 2KSKA 1OMYA 1SN4A 4AEIA 2ATBA 2I61A 1GPSA 2E3FA 1PTXA 2ASCA 1SNBA 1GPTA 4KYPA 2LY5A 2KYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEG A;  1I6F A;  3E7R L;  4UJ0 A;  1BMR A;  1ZU3 A;  2YEO A;  1AHO A;  1T7A A;  1DJT A;  1FH3 A;  1AYJ A;  1B3C A;  1T1T A;  2GL1 A;  1JZB A;  1LQQ A;  2KBJ A;  1BRZ A;  1WWN A;  1NH5 A;  2E0H A;  1T0Z A;  1T7E A;  1I2V A;  1CHZ A;  1NRB A;  1PX9 A;  1JKZ A;  2A7T A;  1VNA A;  1BCG A;  1ZVE A;  1L4V A;  1SN1 A;  1VNB A;  1JXC A;  2M8B B;  1ZUT A;  2LR3 A;  2N2R A;  2LKB A;  1C55 A;  2KPY A;  1WT7 A;  2BRZ A;  1T7B A;  1P0A A;  1OZZ A;  2LT8 A;  1N4N A;  2LJM A;  1NPI A;  2N2Q A;  1LQH A;  1NE5 A;  1CN2 A;  4HE7 A;  4AB0 A;  2N69 A;  2YC1 C;  1JZA A;  2KBH A;  1TI5 A;  1ZYW A;  4CQK A;  3PSM A;  2LJ7 A;  1C56 A;  2LY6 A;  4HHF A;  2E3G A;  1P00 A;  1ICA A;  1BK8 A;  2N66 A;  1I2U A;  1NRA A;  4V1D C;  2KGQ A;  1ZYV A;  2B3C A;  5KK4 A;  1MYN A;  1I6G A;  2MZ0 A;  1ZFU A;  1PE4 A;  1DQ7 A;  2LI7 A;  2KBK A;  1KV0 A;  3E7U X;  5CY0 A;  2NY9 X;  2YBR C;  2KJA A;  2B68 A;  2NY8 X;  1B7D A;  4AAZ A;  1WMT A;  1LQI A;  1ZVG A;  2SN3 A;  1MR4 A;  2KSK A;  1OMY A;  1SN4 A;  4AEI A;  2ATB A;  2I61 A;  1GPS A;  2E3F A;  1PTX A;  2ASC A;  1SNB A;  1GPT A;  4KYP A;  2LY5 A;  2KYQ A; 
#chains in the Genus database with same CATH topology
 1SEG A;  3KP1 A;  2YIO A;  1I6F A;  5AQF A;  3E7R L;  2VY6 A;  2QXL A;  4UJ0 A;  1ZU3 A;  2YEO A;  1AHO A;  1T7A A;  1BMR A;  1DJT A;  1FH3 A;  4GNI A;  3D2E B;  3ATU A;  1AYJ A;  1B3C A;  5AQP A;  4H5T A;  1QQO A;  3FZL A;  3GL1 A;  1T1T A;  1KAX A;  2GL1 A;  1JZB A;  1LQQ A;  2BUP A;  2KBJ A;  1BRZ A;  1WWN A;  1NH5 A;  2E0H A;  2GMO A;  1HJO A;  5AQY A;  3FZK A;  1UGL A;  1T0Z A;  5AQN A;  4UAD E;  1NGD A;  5AQK A;  5F0X A;  2D56 A;  5FPD A;  1KAZ A;  2QWN A;  3KC6 A;  1T7E A;  2E2F A;  1I2V A;  5EVZ A;  3QFU A;  2QWM A;  4FSV A;  1CHZ A;  1NRB A;  1PX9 A;  5AQQ A;  1JKZ A;  2A7T A;  1YUW A;  2JDQ D;  3BK3 C;  1VNA A;  1KAY A;  3LDQ A;  5AR0 A;  5BPL A;  2QWO A;  2MBK A;  5BPN A;  5AQV A;  5F1X A;  1BCG A;  3KP0 A;  1ZVE A;  2MN5 A;  3L6Q A;  2YIL A;  1NGJ A;  1QQM A;  1L4V A;  3QFP A;  5EX5 A;  1NGF A;  1SN1 A;  5AQI A;  1VNB A;  1HX1 A;  1JXC A;  3D2F A;  2M8B B;  3FZM A;  1ZUT A;  2LR3 A;  2N2R A;  4H5N A;  2LKB A;  1C55 A;  2KPY A;  5AQR A;  1WT7 A;  5AQU A;  2BRZ A;  1T7B A;  1P0A A;  3C7N B;  5F2R A;  2E8A A;  3D2E A;  1OZZ A;  1BUP A;  2LT8 A;  3LDL A;  1N4N A;  2LJM A;  3KOY A;  2YIP A;  1NPI A;  1HPM A;  2G2K A;  2N2Q A;  5BN9 A;  1LQH A;  2QWL A;  1NE5 A;  1NGC A;  1CN2 A;  3LDP A;  4HE7 A;  4AB0 A;  2N69 A;  2YC1 C;  1JZA A;  1S3X A;  2KBH A;  4UAF E;  5EXW A;  1NGE A;  1TI5 A;  1ZYW A;  3IUC A;  4CQK A;  3HSC A;  5AQH A;  2QWP A;  3PSM A;  2LJ7 A;  3ATV A;  4UAE F;  4H5V A;  1C56 A;  4HWI A;  2LY6 A;  1NGG A;  4HHF A;  5FPM A;  1XRS B;  2E3G A;  5AQT A;  3L4I A;  1P00 A;  1NGA A;  3QI7 A;  1ICA A;  3KVG A;  1BK8 A;  2N66 A;  3FZF A;  1QQN A;  3FE1 A;  1NRA A;  3R2V A;  5AQG A;  1ATS A;  2KGQ A;  4V1D C;  5BN8 A;  1ZYV A;  2LN8 A;  2B3C A;  5AQS A;  4IO8 A;  5AQZ A;  5KK4 A;  1MYN A;  3FZH A;  4H5W A;  1I6G A;  2E88 A;  3I33 A;  3C7N A;  2MZ0 A;  5AQM A;  1ATR A;  2V7Z A;  1ZFU A;  1PE4 A;  1DQ7 A;  4H5R A;  2LI7 A;  2K35 A;  2KBK A;  3KHW A;  4FL9 A;  5FPE A;  4KBO A;  5AQJ A;  5AQO A;  1KV0 A;  1K8B A;  3E7U X;  5CY0 A;  3D2F B;  1BA1 A;  1NGH A;  2NY9 X;  3CW4 A;  2YBR C;  3LDO A;  3QML A;  2QWQ A;  2KJA A;  3GKU A;  2B68 A;  2NY8 X;  2QW9 A;  1B7D A;  3AY9 A;  3L56 A;  4AAZ A;  1WMT A;  1LQI A;  1ZVG A;  2QWR A;  3JXU A;  2SN3 A;  1MR4 A;  1I2U A;  1BA0 A;  2KSK A;  1DKG D;  1OMY A;  1SN4 A;  5BPM A;  3KOZ A;  4AEI A;  3A8Y A;  2ATB A;  2I61 A;  3KOW A;  3LDN A;  5AQX A;  1GPS A;  1POI A;  1NGB A;  3SF4 D;  2E3F A;  1PTX A;  2ASC A;  1SNB A;  3GDQ A;  5FPN A;  4KYP A;  1GPT A;  2KHO A;  1NGI A;  3M3Z A;  5AQW A;  3KOX A;  2LY5 A;  5EY4 A;  3CQX A;  2KYQ A;  5AQL A; 
#chains in the Genus database with same CATH homology
 1SEG A;  1I6F A;  3E7R L;  4UJ0 A;  1BMR A;  1ZU3 A;  2YEO A;  1AHO A;  1T7A A;  1DJT A;  1FH3 A;  1AYJ A;  1B3C A;  1T1T A;  2GL1 A;  1JZB A;  1LQQ A;  2KBJ A;  1BRZ A;  1WWN A;  1NH5 A;  2E0H A;  1T0Z A;  1T7E A;  1I2V A;  1CHZ A;  1NRB A;  1PX9 A;  1JKZ A;  2A7T A;  1VNA A;  1BCG A;  1ZVE A;  1L4V A;  1SN1 A;  1VNB A;  1JXC A;  2M8B B;  1ZUT A;  2LR3 A;  2N2R A;  2LKB A;  1C55 A;  2KPY A;  1WT7 A;  2BRZ A;  1T7B A;  1P0A A;  1OZZ A;  2LT8 A;  1N4N A;  2LJM A;  1NPI A;  2N2Q A;  1LQH A;  1NE5 A;  1CN2 A;  4HE7 A;  4AB0 A;  2N69 A;  2YC1 C;  1JZA A;  2KBH A;  1TI5 A;  1ZYW A;  4CQK A;  3PSM A;  2LJ7 A;  1C56 A;  2LY6 A;  4HHF A;  2E3G A;  1P00 A;  1ICA A;  1BK8 A;  2N66 A;  1I2U A;  1NRA A;  4V1D C;  2KGQ A;  1ZYV A;  2B3C A;  5KK4 A;  1MYN A;  1I6G A;  2MZ0 A;  1ZFU A;  1PE4 A;  1DQ7 A;  2LI7 A;  2KBK A;  1KV0 A;  3E7U X;  5CY0 A;  2NY9 X;  2YBR C;  2KJA A;  2B68 A;  2NY8 X;  1B7D A;  4AAZ A;  1WMT A;  1LQI A;  1ZVG A;  2SN3 A;  1MR4 A;  2KSK A;  1OMY A;  1SN4 A;  4AEI A;  2ATB A;  2I61 A;  1GPS A;  2E3F A;  1PTX A;  2ASC A;  1SNB A;  1GPT A;  4KYP A;  2LY5 A;  2KYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...