2N66A

Nmr structure of sweeter mutant (d40k) of sweet protein brazzein,
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb
source organism Pentadiplandra brazzeana
molecule tags Plant protein
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n66A00
4AAZA 1C55A 5KK4A 2LT8A 1JKZA 1ZVGA 2B68A 1OMYA 2NY9X 1KV0A 2N69A 2SN3A 1NRAA 1AYJA 1WMTA 1JZBA 2MZ0A 1WT7A 4UJ0A 1ZVEA 2YC1C 2A7TA 2KPYA 1B7DA 2LY6A 2E3GA 1MR4A 2M8BB 1B3CA 1P00A 1BMRA 1SN1A 1AHOA 1PTXA 1I2VA 2ASCA 2KGQA 1LQQA 1NH5A 1N4NA 2KBKA 1WWNA 1ICAA 1PX9A 2GL1A 1SEGA 2YBRC 2LY5A 2KBJA 1I6GA 1T7EA 2N66A 1NRBA 1L4VA 2LKBA 2BRZA 2I61A 1I2UA 1LQHA 1VNBA 2LI7A 1BK8A 4CQKA 2KJAA 1T7AA 1ZYVA 3E7UX 1P0AA 1ZFUA 1SN4A 1NE5A 1I6FA 2KYQA 1ZU3A 1FH3A 1CHZA 2B3CA 1BCGA 3E7RL 5CY0A 1GPTA 1VNAA 2KBHA 2KSKA 4V1DC 2NY8X 2LR3A 1ZUTA 1MYNA 1DJTA 1DQ7A 1SNBA 1BRZA 2LJ7A 2ATBA 1PE4A 3PSMA 1T0ZA 1JZAA 4AB0A 1ZYWA 2N2QA 1JXCA 2YEOA 1NPIA 4KYPA 1OZZA 4AEIA 2LJMA 4HHFA 1T1TA 1C56A 1LQIA 1T7BA 2E0HA 2E3FA 1TI5A 2N2RA 1GPSA 1CN2A 4HE7A
chains in the Genus database with same CATH superfamily
3I33A 3IUCA 5EY4A 3FZLA 4H5WA 4AAZA 1C55A 5KK4A 2LT8A 3D2FA 1JKZA 2E8AA 1KAYA 1UGLA 5AQGA 1ZVGA 4FSVA 2LN8A 2QWPA 2B68A 1OMYA 2NY9X 1KV0A 2N69A 2SN3A 2YIPA 3JXUA 3CQXA 5BPLA 3A8YA 1NRAA 3KOXA 3L4IA 2K35A 4H5TA 3LDNA 2QWNA 1AYJA 3QFUA 3FE1A 1NGFA 1WMTA 1JZBA 2MZ0A 1WT7A 2JDQD 4UJ0A 3HSCA 3C7NB 3LDQA 1ZVEA 1YUWA 3KOZA 3CW4A 2YC1C 2A7TA 2KPYA 5AQLA 1B7DA 2LY6A 1QQMA 4UADE 1KAXA 2E3GA 3GDQA 1DKGD 1MR4A 1BA1A 2G2KA 2M8BB 1HX1A 5FPMA 5FPEA 1B3CA 3FZHA 1I6GA 3LDPA 1P00A 4UAFE 5AQJA 1BMRA 1QQNA 3LDLA 1HJOA 1S3XA 4HWIA 1SN1A 1AHOA 2QWQA 4H5VA 5AQXA 2YIOA 1PTXA 2E2FA 1I2VA 5AQKA 2ASCA 2KGQA 2QWLA 1LQQA 1NH5A 1N4NA 2KBKA 2MBKA 3KOYA 5BN8A 1WWNA 2V7ZA 5AQOA 1ICAA 1PX9A 2GL1A 3R2VA 1ATRA 1SEGA 2BUPA 3D2FB 2YBRC 5AR0A 2LY5A 3SF4D 1KAZA 2QWRA 3KP1A 5AQWA 1POIA 3L56A 2KBJA 5BN9A 1T7EA 5BPNA 5AQQA 5AQIA 1NGJA 2N66A 3ATUA 5FPNA 5BPMA 5EVZA 1NRBA 1L4VA 3KC6A 3KHWA 2LKBA 2BRZA 1NGCA 1XRSB 2I61A 3GKUA 3L6QA 3QMLA 4H5RA 5AQSA 5F1XA 1I2UA 5AQPA 1LQHA 2QWOA 3QI7A 1VNBA 2LI7A 5F0XA 1BK8A 2QWMA 3ATVA 5AQFA 2KJAA 5AQTA 4CQKA 1T7AA 1ZYVA 3E7UX 1P0AA 1NGBA 1NGHA 3FZMA 3M3ZA 2MN5A 1ZFUA 3KVGA 2D56A 1SN4A 2VY6A 1NE5A 2YILA 1I6FA 5AQHA 2KYQA 1ZU3A 1FH3A 3C7NA 3LDOA 1CHZA 1K8BA 1NGIA 2B3CA 1BCGA 3E7RL 5CY0A 1GPTA 1VNAA 2KBHA 2KSKA 3D2EA 4V1DC 2NY8X 3GL1A 2LR3A 4IO8A 5EXWA 1NGEA 2QW9A 1ZUTA 1MYNA 1NGGA 1DJTA 4H5NA 3KOWA 1QQOA 1DQ7A 5AQZA 1SNBA 5AQYA 1BA0A 2LJ7A 1BRZA 1NGDA 2ATBA 3FZKA 1PE4A 5AQMA 2QXLA 3KP0A 3QFPA 3PSMA 2E88A 1T0ZA 5AQRA 4KBOA 5F2RA 3BK3C 1JZAA 1BUPA 5AQNA 1ZYWA 1NGAA 3FZFA 4AB0A 2N2QA 1JXCA 3AY9A 2YEOA 4GNIA 1NPIA 5EX5A 4KYPA 1OZZA 4AEIA 2LJMA 4HHFA 1HPMA 1C56A 1T1TA 1ATSA 1LQIA 1T7BA 2E0HA 2E3FA 1TI5A 2N2RA 3D2EB 1GPSA 2GMOA 4FL9A 5FPDA 1CN2A 5AQVA 4HE7A 4UAEF 5AQUA 2KHOA
chains in the Genus database with same CATH topology
4AAZA 1C55A 5KK4A 2LT8A 1JKZA 1ZVGA 2B68A 1OMYA 2NY9X 1KV0A 2N69A 2SN3A 1NRAA 1AYJA 1WMTA 1JZBA 2MZ0A 1WT7A 4UJ0A 1ZVEA 2YC1C 2A7TA 2KPYA 1B7DA 2LY6A 2E3GA 1MR4A 2M8BB 1B3CA 1P00A 1BMRA 1SN1A 1AHOA 1PTXA 1I2VA 2ASCA 2KGQA 1LQQA 1NH5A 1N4NA 2KBKA 1WWNA 1ICAA 1PX9A 2GL1A 1SEGA 2YBRC 2LY5A 2KBJA 1I6GA 1T7EA 2N66A 1NRBA 1L4VA 2LKBA 2BRZA 2I61A 1I2UA 1LQHA 1VNBA 2LI7A 1BK8A 4CQKA 2KJAA 1T7AA 1ZYVA 3E7UX 1P0AA 1ZFUA 1SN4A 1NE5A 1I6FA 2KYQA 1ZU3A 1FH3A 1CHZA 2B3CA 1BCGA 3E7RL 5CY0A 1GPTA 1VNAA 2KBHA 2KSKA 4V1DC 2NY8X 2LR3A 1ZUTA 1MYNA 1DJTA 1DQ7A 1SNBA 1BRZA 2LJ7A 2ATBA 1PE4A 3PSMA 1T0ZA 1JZAA 4AB0A 1ZYWA 2N2QA 1JXCA 2YEOA 1NPIA 4KYPA 1OZZA 4AEIA 2LJMA 4HHFA 1T1TA 1C56A 1LQIA 1T7BA 2E0HA 2E3FA 1TI5A 2N2RA 1GPSA 1CN2A 4HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAZ A;  1C55 A;  5KK4 A;  2LT8 A;  1JKZ A;  1ZVG A;  2B68 A;  1OMY A;  2NY9 X;  1KV0 A;  2N69 A;  2SN3 A;  1NRA A;  1AYJ A;  1WMT A;  1JZB A;  2MZ0 A;  1WT7 A;  4UJ0 A;  1ZVE A;  2YC1 C;  2A7T A;  2KPY A;  1B7D A;  2LY6 A;  2E3G A;  1MR4 A;  2M8B B;  1B3C A;  1P00 A;  1BMR A;  1SN1 A;  1AHO A;  1PTX A;  1I2V A;  2ASC A;  2KGQ A;  1LQQ A;  1NH5 A;  1N4N A;  2KBK A;  1WWN A;  1ICA A;  1PX9 A;  2GL1 A;  1SEG A;  2YBR C;  2LY5 A;  2KBJ A;  1I6G A;  1T7E A;  2N66 A;  1NRB A;  1L4V A;  2LKB A;  2BRZ A;  2I61 A;  1I2U A;  1LQH A;  1VNB A;  2LI7 A;  1BK8 A;  4CQK A;  2KJA A;  1T7A A;  1ZYV A;  3E7U X;  1P0A A;  1ZFU A;  1SN4 A;  1NE5 A;  1I6F A;  2KYQ A;  1ZU3 A;  1FH3 A;  1CHZ A;  2B3C A;  1BCG A;  3E7R L;  5CY0 A;  1GPT A;  1VNA A;  2KBH A;  2KSK A;  4V1D C;  2NY8 X;  2LR3 A;  1ZUT A;  1MYN A;  1DJT A;  1DQ7 A;  1SNB A;  1BRZ A;  2LJ7 A;  2ATB A;  1PE4 A;  3PSM A;  1T0Z A;  1JZA A;  4AB0 A;  1ZYW A;  2N2Q A;  1JXC A;  2YEO A;  1NPI A;  4KYP A;  1OZZ A;  4AEI A;  2LJM A;  4HHF A;  1T1T A;  1C56 A;  1LQI A;  1T7B A;  2E0H A;  2E3F A;  1TI5 A;  2N2R A;  1GPS A;  1CN2 A;  4HE7 A; 
#chains in the Genus database with same CATH topology
 3I33 A;  3IUC A;  5EY4 A;  3FZL A;  4H5W A;  4AAZ A;  1C55 A;  5KK4 A;  2LT8 A;  3D2F A;  1JKZ A;  2E8A A;  1KAY A;  1UGL A;  5AQG A;  1ZVG A;  4FSV A;  2LN8 A;  2QWP A;  2B68 A;  1OMY A;  2NY9 X;  1KV0 A;  2N69 A;  2SN3 A;  2YIP A;  3JXU A;  3CQX A;  5BPL A;  3A8Y A;  1NRA A;  3KOX A;  3L4I A;  2K35 A;  4H5T A;  3LDN A;  2QWN A;  1AYJ A;  3QFU A;  3FE1 A;  1NGF A;  1WMT A;  1JZB A;  2MZ0 A;  1WT7 A;  2JDQ D;  4UJ0 A;  3HSC A;  3C7N B;  3LDQ A;  1ZVE A;  1YUW A;  3KOZ A;  3CW4 A;  2YC1 C;  2A7T A;  2KPY A;  5AQL A;  1B7D A;  2LY6 A;  1QQM A;  4UAD E;  1KAX A;  2E3G A;  3GDQ A;  1DKG D;  1MR4 A;  1BA1 A;  2G2K A;  2M8B B;  1HX1 A;  5FPM A;  5FPE A;  1B3C A;  3FZH A;  1I6G A;  3LDP A;  1P00 A;  4UAF E;  5AQJ A;  1BMR A;  1QQN A;  3LDL A;  1HJO A;  1S3X A;  4HWI A;  1SN1 A;  1AHO A;  2QWQ A;  4H5V A;  5AQX A;  2YIO A;  1PTX A;  2E2F A;  1I2V A;  5AQK A;  2ASC A;  2KGQ A;  2QWL A;  1LQQ A;  1NH5 A;  1N4N A;  2KBK A;  2MBK A;  3KOY A;  5BN8 A;  1WWN A;  2V7Z A;  5AQO A;  1ICA A;  1PX9 A;  2GL1 A;  3R2V A;  1ATR A;  1SEG A;  2BUP A;  3D2F B;  2YBR C;  5AR0 A;  2LY5 A;  3SF4 D;  1KAZ A;  2QWR A;  3KP1 A;  5AQW A;  1POI A;  3L56 A;  2KBJ A;  5BN9 A;  1T7E A;  5BPN A;  5AQQ A;  5AQI A;  1NGJ A;  2N66 A;  3ATU A;  5FPN A;  5BPM A;  5EVZ A;  1NRB A;  1L4V A;  3KC6 A;  3KHW A;  2LKB A;  2BRZ A;  1NGC A;  1XRS B;  2I61 A;  3GKU A;  3L6Q A;  3QML A;  4H5R A;  5AQS A;  5F1X A;  1I2U A;  5AQP A;  1LQH A;  2QWO A;  3QI7 A;  1VNB A;  2LI7 A;  5F0X A;  1BK8 A;  2QWM A;  3ATV A;  5AQF A;  2KJA A;  5AQT A;  4CQK A;  1T7A A;  1ZYV A;  3E7U X;  1P0A A;  1NGB A;  1NGH A;  3FZM A;  3M3Z A;  2MN5 A;  1ZFU A;  3KVG A;  2D56 A;  1SN4 A;  2VY6 A;  1NE5 A;  2YIL A;  1I6F A;  5AQH A;  2KYQ A;  1ZU3 A;  1FH3 A;  3C7N A;  3LDO A;  1CHZ A;  1K8B A;  1NGI A;  2B3C A;  1BCG A;  3E7R L;  5CY0 A;  1GPT A;  1VNA A;  2KBH A;  2KSK A;  3D2E A;  4V1D C;  2NY8 X;  3GL1 A;  2LR3 A;  4IO8 A;  5EXW A;  1NGE A;  2QW9 A;  1ZUT A;  1MYN A;  1NGG A;  1DJT A;  4H5N A;  3KOW A;  1QQO A;  1DQ7 A;  5AQZ A;  1SNB A;  5AQY A;  1BA0 A;  2LJ7 A;  1BRZ A;  1NGD A;  2ATB A;  3FZK A;  1PE4 A;  5AQM A;  2QXL A;  3KP0 A;  3QFP A;  3PSM A;  2E88 A;  1T0Z A;  5AQR A;  4KBO A;  5F2R A;  3BK3 C;  1JZA A;  1BUP A;  5AQN A;  1ZYW A;  1NGA A;  3FZF A;  4AB0 A;  2N2Q A;  1JXC A;  3AY9 A;  2YEO A;  4GNI A;  1NPI A;  5EX5 A;  4KYP A;  1OZZ A;  4AEI A;  2LJM A;  4HHF A;  1HPM A;  1C56 A;  1T1T A;  1ATS A;  1LQI A;  1T7B A;  2E0H A;  2E3F A;  1TI5 A;  2N2R A;  3D2E B;  1GPS A;  2GMO A;  4FL9 A;  5FPD A;  1CN2 A;  5AQV A;  4HE7 A;  4UAE F;  5AQU A;  2KHO A; 
#chains in the Genus database with same CATH homology
 4AAZ A;  1C55 A;  5KK4 A;  2LT8 A;  1JKZ A;  1ZVG A;  2B68 A;  1OMY A;  2NY9 X;  1KV0 A;  2N69 A;  2SN3 A;  1NRA A;  1AYJ A;  1WMT A;  1JZB A;  2MZ0 A;  1WT7 A;  4UJ0 A;  1ZVE A;  2YC1 C;  2A7T A;  2KPY A;  1B7D A;  2LY6 A;  2E3G A;  1MR4 A;  2M8B B;  1B3C A;  1P00 A;  1BMR A;  1SN1 A;  1AHO A;  1PTX A;  1I2V A;  2ASC A;  2KGQ A;  1LQQ A;  1NH5 A;  1N4N A;  2KBK A;  1WWN A;  1ICA A;  1PX9 A;  2GL1 A;  1SEG A;  2YBR C;  2LY5 A;  2KBJ A;  1I6G A;  1T7E A;  2N66 A;  1NRB A;  1L4V A;  2LKB A;  2BRZ A;  2I61 A;  1I2U A;  1LQH A;  1VNB A;  2LI7 A;  1BK8 A;  4CQK A;  2KJA A;  1T7A A;  1ZYV A;  3E7U X;  1P0A A;  1ZFU A;  1SN4 A;  1NE5 A;  1I6F A;  2KYQ A;  1ZU3 A;  1FH3 A;  1CHZ A;  2B3C A;  1BCG A;  3E7R L;  5CY0 A;  1GPT A;  1VNA A;  2KBH A;  2KSK A;  4V1D C;  2NY8 X;  2LR3 A;  1ZUT A;  1MYN A;  1DJT A;  1DQ7 A;  1SNB A;  1BRZ A;  2LJ7 A;  2ATB A;  1PE4 A;  3PSM A;  1T0Z A;  1JZA A;  4AB0 A;  1ZYW A;  2N2Q A;  1JXC A;  2YEO A;  1NPI A;  4KYP A;  1OZZ A;  4AEI A;  2LJM A;  4HHF A;  1T1T A;  1C56 A;  1LQI A;  1T7B A;  2E0H A;  2E3F A;  1TI5 A;  2N2R A;  1GPS A;  1CN2 A;  4HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...