2N66A

Nmr structure of sweeter mutant (d40k) of sweet protein brazzein,
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
54
structure length
54
Chain Sequence
QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of sweeter mutant of sweet protein Brazzein
rcsb
molecule keywords Defensin-like protein
molecule tags Plant protein
source organism Pentadiplandra brazzeana
total genus 8
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2015-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2n66A00
2I61A 2KGQA 1NPIA 2LT8A 3E7RL 1ZVEA 2NY8X 1LQQA 1MYNA 1ZU3A 1T7AA 1I2UA 1JZBA 1JZAA 2GL1A 1BRZA 1PE4A 4V1DC 2N66A 1C55A 1T0ZA 2KYQA 1OZZA 2ATBA 1FH3A 3E7UX 1JXCA 1ZFUA 2LY6A 1NRBA 3PSMA 4AB0A 2A7TA 2YBRC 1AHOA 1BMRA 2N2RA 5KK4A 1WWNA 1VNBA 1PX9A 2N69A 2BRZA 1WT7A 1BCGA 1C56A 1B7DA 1SNBA 1VNAA 1L4VA 4UJ0A 2E3GA 1SN1A 2NY9X 1I6FA 1ZVGA 1TI5A 1ZUTA 2M8BB 1DJTA 1AYJA 2B68A 1WMTA 1NH5A 2SN3A 1DQ7A 1T7BA 2E3FA 2LI7A 4CQKA 4KYPA 1ICAA 1NRAA 1T1TA 2LJ7A 1CHZA 4AAZA 1SEGA 1JKZA 5CY0A 2KBKA 2KPYA 1P00A 1SN4A 1LQHA 2YC1C 2LR3A 1KV0A 2LKBA 1I2VA 2ASCA 1NE5A 4HHFA 1CN2A 1GPSA 1B3CA 2KJAA 1MR4A 1I6GA 2N2QA 4HE7A 2E0HA 1ZYVA 1ZYWA 2LJMA 1LQIA 1T7EA 2MZ0A 1N4NA 2KSKA 2LY5A 1P0AA 1BK8A 1OMYA 1GPTA 2KBJA 2KBHA 1PTXA 2YEOA 4AEIA 2B3CA
chains in the Genus database with same CATH superfamily
2I61A 2KGQA 3BK3C 1NPIA 3KHWA 4UAFE 3LDQA 2LT8A 4KBOA 3E7RL 2MBKA 1ZVEA 2BUPA 1NGDA 3FE1A 2NY8X 3FZFA 1LQQA 1MYNA 3KP0A 3L56A 4H5RA 5BN9A 5F0XA 1ZU3A 3FZHA 1KAXA 1T7AA 2E8AA 3I33A 3LDLA 5AQZA 1I2UA 5AQYA 3L6QA 1JZAA 1JZBA 2GL1A 1BRZA 1PE4A 4V1DC 2N66A 2QWLA 1C55A 1YUWA 5AQRA 5AQKA 1T0ZA 1NGGA 2KYQA 1OZZA 2QWQA 1UGLA 2ATBA 5AQLA 1FH3A 3E7UX 1JXCA 5EXWA 1KAYA 1ZFUA 1NRBA 2LY6A 2VY6A 3PSMA 4AB0A 1BUPA 2A7TA 2MN5A 2YBRC 5AQUA 1AHOA 1BMRA 2YILA 1NGHA 2N2RA 3C7NA 4FL9A 3GDQA 3KP1A 4H5VA 5KK4A 5AQVA 1WWNA 1VNBA 1PX9A 2N69A 5BPNA 5AQXA 5FPMA 1DKGD 2BRZA 5AQPA 2JDQD 3CQXA 3LDPA 5AQJA 1WT7A 1BCGA 1QQMA 3AY9A 3KVGA 3GKUA 1HPMA 4HWIA 3SF4D 1C56A 1B7DA 1SNBA 5AQHA 3KOYA 1ATRA 1VNAA 1L4VA 3D2EA 1KAZA 4H5TA 4UJ0A 2E3GA 3LDOA 1SN1A 2LN8A 4UADE 2K35A 2NY9X 3JXUA 1I6FA 1ZVGA 1ATSA 5AR0A 5BPMA 2QXLA 1TI5A 5AQTA 1ZUTA 4H5NA 2M8BB 2YIOA 1DJTA 5EVZA 1AYJA 2B68A 3A8YA 3FZLA 1NGJA 5AQQA 1WMTA 2QWNA 5EY4A 5F2RA 1NH5A 2SN3A 3R2VA 1DQ7A 5BN8A 1T7BA 3L4IA 4FSVA 1QQNA 2E3FA 3FZMA 2LI7A 5AQIA 2QWPA 4CQKA 1POIA 3QFUA 4KYPA 1ICAA 3KC6A 1NRAA 2QWOA 5AQOA 1T1TA 2QW9A 5AQFA 5AQWA 4H5WA 1NGCA 2LJ7A 1CHZA 4AAZA 5AQGA 1SEGA 2D56A 3C7NB 1NGAA 1NGIA 2E88A 3D2FB 5AQMA 1JKZA 5AQSA 5CY0A 5FPDA 1BA1A 5F1XA 2QWRA 3LDNA 4IO8A 2KBKA 3HSCA 1S3XA 1P00A 2KPYA 1SN4A 1HJOA 1LQHA 2KHOA 2YC1C 1HX1A 2LR3A 3IUCA 1KV0A 2LKBA 3QFPA 1I2VA 3M3ZA 5BPLA 3D2EB 2ASCA 4GNIA 1NE5A 3KOWA 4HHFA 1CN2A 1GPSA 3QMLA 1B3CA 2E2FA 2KJAA 1MR4A 5FPNA 1NGFA 1I6GA 2N2QA 2G2KA 2V7ZA 4HE7A 3D2FA 1XRSB 5FPEA 2E0HA 3GL1A 1NGBA 1ZYVA 1ZYWA 2QWMA 3KOZA 2LJMA 4UAEF 1K8BA 2YIPA 1LQIA 1T7EA 2MZ0A 3QI7A 2GMOA 5EX5A 1N4NA 3ATUA 5AQNA 1BA0A 2KSKA 1QQOA 2LY5A 1P0AA 1BK8A 1OMYA 1GPTA 2KBJA 3CW4A 3KOXA 2KBHA 1PTXA 2YEOA 4AEIA 3FZKA 2B3CA 3ATVA 1NGEA
chains in the Genus database with same CATH topology
2I61A 2KGQA 1NPIA 2LT8A 3E7RL 1ZVEA 2NY8X 1LQQA 1MYNA 1ZU3A 1T7AA 1I2UA 1JZBA 1JZAA 2GL1A 1BRZA 1PE4A 4V1DC 2N66A 1C55A 1T0ZA 2KYQA 1OZZA 2ATBA 1FH3A 3E7UX 1JXCA 1ZFUA 2LY6A 1NRBA 3PSMA 4AB0A 2A7TA 2YBRC 1AHOA 1BMRA 2N2RA 5KK4A 1WWNA 1VNBA 1PX9A 2N69A 2BRZA 1WT7A 1BCGA 1C56A 1B7DA 1SNBA 1VNAA 1L4VA 4UJ0A 2E3GA 1SN1A 2NY9X 1I6FA 1ZVGA 1TI5A 1ZUTA 2M8BB 1DJTA 1AYJA 2B68A 1WMTA 1NH5A 2SN3A 1DQ7A 1T7BA 2E3FA 2LI7A 4CQKA 4KYPA 1ICAA 1NRAA 1T1TA 2LJ7A 1CHZA 4AAZA 1SEGA 1JKZA 5CY0A 2KBKA 2KPYA 1P00A 1SN4A 1LQHA 2YC1C 2LR3A 1KV0A 2LKBA 1I2VA 2ASCA 1NE5A 4HHFA 1CN2A 1GPSA 1B3CA 2KJAA 1MR4A 1I6GA 2N2QA 4HE7A 2E0HA 1ZYVA 1ZYWA 2LJMA 1LQIA 1T7EA 2MZ0A 1N4NA 2KSKA 2LY5A 1P0AA 1BK8A 1OMYA 1GPTA 2KBJA 2KBHA 1PTXA 2YEOA 4AEIA 2B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I61 A;  2KGQ A;  1NPI A;  2LT8 A;  3E7R L;  1ZVE A;  2NY8 X;  1LQQ A;  1MYN A;  1ZU3 A;  1T7A A;  1I2U A;  1JZB A;  1JZA A;  2GL1 A;  1BRZ A;  1PE4 A;  4V1D C;  2N66 A;  1C55 A;  1T0Z A;  2KYQ A;  1OZZ A;  2ATB A;  1FH3 A;  3E7U X;  1JXC A;  1ZFU A;  2LY6 A;  1NRB A;  3PSM A;  4AB0 A;  2A7T A;  2YBR C;  1AHO A;  1BMR A;  2N2R A;  5KK4 A;  1WWN A;  1VNB A;  1PX9 A;  2N69 A;  2BRZ A;  1WT7 A;  1BCG A;  1C56 A;  1B7D A;  1SNB A;  1VNA A;  1L4V A;  4UJ0 A;  2E3G A;  1SN1 A;  2NY9 X;  1I6F A;  1ZVG A;  1TI5 A;  1ZUT A;  2M8B B;  1DJT A;  1AYJ A;  2B68 A;  1WMT A;  1NH5 A;  2SN3 A;  1DQ7 A;  1T7B A;  2E3F A;  2LI7 A;  4CQK A;  4KYP A;  1ICA A;  1NRA A;  1T1T A;  2LJ7 A;  1CHZ A;  4AAZ A;  1SEG A;  1JKZ A;  5CY0 A;  2KBK A;  2KPY A;  1P00 A;  1SN4 A;  1LQH A;  2YC1 C;  2LR3 A;  1KV0 A;  2LKB A;  1I2V A;  2ASC A;  1NE5 A;  4HHF A;  1CN2 A;  1GPS A;  1B3C A;  2KJA A;  1MR4 A;  1I6G A;  2N2Q A;  4HE7 A;  2E0H A;  1ZYV A;  1ZYW A;  2LJM A;  1LQI A;  1T7E A;  2MZ0 A;  1N4N A;  2KSK A;  2LY5 A;  1P0A A;  1BK8 A;  1OMY A;  1GPT A;  2KBJ A;  2KBH A;  1PTX A;  2YEO A;  4AEI A;  2B3C A; 
#chains in the Genus database with same CATH topology
 2I61 A;  2KGQ A;  3BK3 C;  1NPI A;  3KHW A;  4UAF E;  3LDQ A;  2LT8 A;  4KBO A;  3E7R L;  2MBK A;  1ZVE A;  2BUP A;  1NGD A;  3FE1 A;  2NY8 X;  3FZF A;  1LQQ A;  1MYN A;  3KP0 A;  3L56 A;  4H5R A;  5BN9 A;  5F0X A;  1ZU3 A;  3FZH A;  1KAX A;  1T7A A;  2E8A A;  3I33 A;  3LDL A;  5AQZ A;  1I2U A;  5AQY A;  3L6Q A;  1JZA A;  1JZB A;  2GL1 A;  1BRZ A;  1PE4 A;  4V1D C;  2N66 A;  2QWL A;  1C55 A;  1YUW A;  5AQR A;  5AQK A;  1T0Z A;  1NGG A;  2KYQ A;  1OZZ A;  2QWQ A;  1UGL A;  2ATB A;  5AQL A;  1FH3 A;  3E7U X;  1JXC A;  5EXW A;  1KAY A;  1ZFU A;  1NRB A;  2LY6 A;  2VY6 A;  3PSM A;  4AB0 A;  1BUP A;  2A7T A;  2MN5 A;  2YBR C;  5AQU A;  1AHO A;  1BMR A;  2YIL A;  1NGH A;  2N2R A;  3C7N A;  4FL9 A;  3GDQ A;  3KP1 A;  4H5V A;  5KK4 A;  5AQV A;  1WWN A;  1VNB A;  1PX9 A;  2N69 A;  5BPN A;  5AQX A;  5FPM A;  1DKG D;  2BRZ A;  5AQP A;  2JDQ D;  3CQX A;  3LDP A;  5AQJ A;  1WT7 A;  1BCG A;  1QQM A;  3AY9 A;  3KVG A;  3GKU A;  1HPM A;  4HWI A;  3SF4 D;  1C56 A;  1B7D A;  1SNB A;  5AQH A;  3KOY A;  1ATR A;  1VNA A;  1L4V A;  3D2E A;  1KAZ A;  4H5T A;  4UJ0 A;  2E3G A;  3LDO A;  1SN1 A;  2LN8 A;  4UAD E;  2K35 A;  2NY9 X;  3JXU A;  1I6F A;  1ZVG A;  1ATS A;  5AR0 A;  5BPM A;  2QXL A;  1TI5 A;  5AQT A;  1ZUT A;  4H5N A;  2M8B B;  2YIO A;  1DJT A;  5EVZ A;  1AYJ A;  2B68 A;  3A8Y A;  3FZL A;  1NGJ A;  5AQQ A;  1WMT A;  2QWN A;  5EY4 A;  5F2R A;  1NH5 A;  2SN3 A;  3R2V A;  1DQ7 A;  5BN8 A;  1T7B A;  3L4I A;  4FSV A;  1QQN A;  2E3F A;  3FZM A;  2LI7 A;  5AQI A;  2QWP A;  4CQK A;  1POI A;  3QFU A;  4KYP A;  1ICA A;  3KC6 A;  1NRA A;  2QWO A;  5AQO A;  1T1T A;  2QW9 A;  5AQF A;  5AQW A;  4H5W A;  1NGC A;  2LJ7 A;  1CHZ A;  4AAZ A;  5AQG A;  1SEG A;  2D56 A;  3C7N B;  1NGA A;  1NGI A;  2E88 A;  3D2F B;  5AQM A;  1JKZ A;  5AQS A;  5CY0 A;  5FPD A;  1BA1 A;  5F1X A;  2QWR A;  3LDN A;  4IO8 A;  2KBK A;  3HSC A;  1S3X A;  1P00 A;  2KPY A;  1SN4 A;  1HJO A;  1LQH A;  2KHO A;  2YC1 C;  1HX1 A;  2LR3 A;  3IUC A;  1KV0 A;  2LKB A;  3QFP A;  1I2V A;  3M3Z A;  5BPL A;  3D2E B;  2ASC A;  4GNI A;  1NE5 A;  3KOW A;  4HHF A;  1CN2 A;  1GPS A;  3QML A;  1B3C A;  2E2F A;  2KJA A;  1MR4 A;  5FPN A;  1NGF A;  1I6G A;  2N2Q A;  2G2K A;  2V7Z A;  4HE7 A;  3D2F A;  1XRS B;  5FPE A;  2E0H A;  3GL1 A;  1NGB A;  1ZYV A;  1ZYW A;  2QWM A;  3KOZ A;  2LJM A;  4UAE F;  1K8B A;  2YIP A;  1LQI A;  1T7E A;  2MZ0 A;  3QI7 A;  2GMO A;  5EX5 A;  1N4N A;  3ATU A;  5AQN A;  1BA0 A;  2KSK A;  1QQO A;  2LY5 A;  1P0A A;  1BK8 A;  1OMY A;  1GPT A;  2KBJ A;  3CW4 A;  3KOX A;  2KBH A;  1PTX A;  2YEO A;  4AEI A;  3FZK A;  2B3C A;  3ATV A;  1NGE A; 
#chains in the Genus database with same CATH homology
 2I61 A;  2KGQ A;  1NPI A;  2LT8 A;  3E7R L;  1ZVE A;  2NY8 X;  1LQQ A;  1MYN A;  1ZU3 A;  1T7A A;  1I2U A;  1JZB A;  1JZA A;  2GL1 A;  1BRZ A;  1PE4 A;  4V1D C;  2N66 A;  1C55 A;  1T0Z A;  2KYQ A;  1OZZ A;  2ATB A;  1FH3 A;  3E7U X;  1JXC A;  1ZFU A;  2LY6 A;  1NRB A;  3PSM A;  4AB0 A;  2A7T A;  2YBR C;  1AHO A;  1BMR A;  2N2R A;  5KK4 A;  1WWN A;  1VNB A;  1PX9 A;  2N69 A;  2BRZ A;  1WT7 A;  1BCG A;  1C56 A;  1B7D A;  1SNB A;  1VNA A;  1L4V A;  4UJ0 A;  2E3G A;  1SN1 A;  2NY9 X;  1I6F A;  1ZVG A;  1TI5 A;  1ZUT A;  2M8B B;  1DJT A;  1AYJ A;  2B68 A;  1WMT A;  1NH5 A;  2SN3 A;  1DQ7 A;  1T7B A;  2E3F A;  2LI7 A;  4CQK A;  4KYP A;  1ICA A;  1NRA A;  1T1T A;  2LJ7 A;  1CHZ A;  4AAZ A;  1SEG A;  1JKZ A;  5CY0 A;  2KBK A;  2KPY A;  1P00 A;  1SN4 A;  1LQH A;  2YC1 C;  2LR3 A;  1KV0 A;  2LKB A;  1I2V A;  2ASC A;  1NE5 A;  4HHF A;  1CN2 A;  1GPS A;  1B3C A;  2KJA A;  1MR4 A;  1I6G A;  2N2Q A;  4HE7 A;  2E0H A;  1ZYV A;  1ZYW A;  2LJM A;  1LQI A;  1T7E A;  2MZ0 A;  1N4N A;  2KSK A;  2LY5 A;  1P0A A;  1BK8 A;  1OMY A;  1GPT A;  2KBJ A;  2KBH A;  1PTX A;  2YEO A;  4AEI A;  2B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...