1T0ZA

Structure of an excitatory insect-specific toxin with an analgesic effect on mammalian from scorpion buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
KKNGYAVDSSGKVAECLFNNYCNNECTKVYYADKGYCCLLKCYCFGLADDKPVLDIWDSTKNYCDVQIIDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords insect neurotoxin
publication title Structure of an excitatory insect-specific toxin with an analgesic effect on mammals from the scorpion Buthus martensii Karsch.
pubmed doi rcsb
molecule tags Toxin
total genus 18
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t0zA00
1NE5A 1GPTA 1ZVGA 2KBJA 2NY9X 1NH5A 4AB0A 2MZ0A 2KBHA 1B7DA 1LQHA 1ZYVA 1WWNA 1SN4A 4KYPA 1BRZA 5KK4A 1B3CA 1OMYA 2BRZA 2LT8A 1CN2A 1JZBA 1NRAA 3E7RL 2LJ7A 4UJ0A 1NPIA 1MR4A 1I2VA 2LKBA 1BK8A 1PX9A 4HHFA 1ZVEA 1LQIA 2KYQA 2KGQA 1LQQA 2LR3A 4AEIA 2LI7A 1VNAA 3PSMA 2ASCA 1WT7A 1C55A 1I6GA 1BCGA 1DQ7A 1MYNA 1T0ZA 2E0HA 2GL1A 1AYJA 1KV0A 1PTXA 2E3FA 1TI5A 1JZAA 2I61A 1P0AA 1P00A 1PE4A 1WMTA 1GPSA 1OZZA 2N2RA 1ZUTA 1T7BA 1ZFUA 1T7AA 1SN1A 2NY8X 2YC1C 2E3GA 1T1TA 2KPYA 1SEGA 2M8BB 2ATBA 1L4VA 2A7TA 1I6FA 1ICAA 1CHZA 4V1DC 2B68A 2YEOA 1AHOA 1FH3A 1VNBA 1C56A 1BMRA 4AAZA 2SN3A 1DJTA 1ZYWA 1I2UA 2LY6A 2LJMA 1ZU3A 1NRBA 4CQKA 1SNBA 1JKZA 2KBKA 2YBRC 1N4NA 5CY0A 1T7EA 2KSKA 2KJAA 3E7UX 2N2QA 2N69A 1JXCA 2N66A 2LY5A 4HE7A 2B3CA
chains in the Genus database with same CATH superfamily
1NE5A 1GPTA 1ZVGA 2KBJA 2VY6A 2LN8A 3GDQA 3L4IA 4H5VA 2NY9X 1NH5A 4UADE 5F0XA 4AB0A 1NGHA 2MZ0A 1QQNA 1NGEA 3QI7A 2KBHA 3KP1A 4H5WA 1B7DA 1LQHA 1ZYVA 2K35A 1WWNA 1SN4A 2QWOA 2YIPA 4KYPA 3D2EA 5AQGA 1BUPA 1NGIA 1BRZA 5KK4A 1B3CA 3D2FB 3QMLA 1OMYA 2BRZA 2YILA 1XRSB 2BUPA 3BK3C 2LT8A 3C7NB 1QQOA 3FZMA 5AQNA 1BA0A 1JZBA 5FPEA 1CN2A 3KHWA 3KC6A 2G2KA 1NRAA 5AQWA 4H5RA 4FL9A 3E7RL 5AQPA 2LJ7A 4UJ0A 1NPIA 1MR4A 3A8YA 5BPLA 5AQFA 3FZLA 1I2VA 2LKBA 1BK8A 1PX9A 1S3XA 1ZVEA 3FZFA 1LQIA 4HHFA 5AQTA 5AQIA 1POIA 2QWRA 2KYQA 2KGQA 1LQQA 3KP0A 5AQUA 2LR3A 3L56A 2QWLA 3KOWA 4AEIA 2LI7A 1VNAA 3PSMA 2ASCA 3ATUA 3CQXA 3D2FA 5EY4A 3KVGA 2D56A 1WT7A 3GKUA 5AQXA 5BN8A 5FPDA 1C55A 1I6GA 1BCGA 3SF4D 2GMOA 5FPNA 4HWIA 1NGJA 3R2VA 1DQ7A 1MYNA 1T0ZA 2E0HA 2GL1A 1AYJA 1KV0A 1BA1A 1PTXA 2E2FA 2E3FA 5AQJA 1TI5A 1HX1A 1JZAA 2I61A 2JDQD 2V7ZA 5AQOA 1P0AA 1P00A 5AQRA 3QFPA 1PE4A 5EVZA 1WMTA 1GPSA 1OZZA 5AQSA 1KAYA 2N2RA 1ZUTA 3LDOA 3M3ZA 5AQLA 5F1XA 1T7BA 1ZFUA 2E88A 1T7AA 5FPMA 1YUWA 4FSVA 1SN1A 3LDLA 2NY8X 1NGFA 2YIOA 3C7NA 5AQHA 2YC1C 5BPMA 3FE1A 2E3GA 1T1TA 2KPYA 2KHOA 1SEGA 2M8BB 2ATBA 2MN5A 1QQMA 3QFUA 1L4VA 2A7TA 1I6FA 3AY9A 4GNIA 1ICAA 1CHZA 3KOXA 4V1DC 2B68A 3FZKA 2QXLA 1HJOA 2YEOA 4H5NA 4IO8A 5AQMA 1KAXA 1NGGA 1NGAA 1NGCA 3FZHA 1AHOA 1KAZA 3HSCA 3I33A 1FH3A 5AR0A 5BN9A 1VNBA 1C56A 3CW4A 1DKGD 1BMRA 4AAZA 2SN3A 3IUCA 2QWPA 1DJTA 1ZYWA 5AQVA 5EXWA 2LY6A 2MBKA 2QWNA 1I2UA 3ATVA 3KOYA 5AQQA 5AQYA 1NGBA 3JXUA 2LJMA 1ZU3A 1ATSA 1NRBA 3KOZA 5AQKA 5AQZA 4CQKA 1SNBA 4KBOA 1K8BA 5EX5A 1JKZA 2KBKA 2YBRC 3L6QA 1N4NA 1NGDA 5CY0A 3GL1A 5F2RA 1T7EA 2KSKA 1UGLA 2KJAA 4UAEF 3E7UX 5BPNA 4UAFE 2N2QA 2QWMA 3D2EB 3LDPA 1HPMA 4H5TA 2N69A 2QWQA 1JXCA 2E8AA 3LDQA 2N66A 1ATRA 3LDNA 2LY5A 4HE7A 2B3CA 2QW9A
chains in the Genus database with same CATH topology
1NE5A 1GPTA 1ZVGA 2KBJA 2NY9X 1NH5A 4AB0A 2MZ0A 2KBHA 1B7DA 1LQHA 1ZYVA 1WWNA 1SN4A 4KYPA 1BRZA 5KK4A 1B3CA 1OMYA 2BRZA 2LT8A 1CN2A 1JZBA 1NRAA 3E7RL 2LJ7A 4UJ0A 1NPIA 1MR4A 1I2VA 2LKBA 1BK8A 1PX9A 4HHFA 1ZVEA 1LQIA 2KYQA 2KGQA 1LQQA 2LR3A 4AEIA 2LI7A 1VNAA 3PSMA 2ASCA 1WT7A 1C55A 1I6GA 1BCGA 1DQ7A 1MYNA 1T0ZA 2E0HA 2GL1A 1AYJA 1KV0A 1PTXA 2E3FA 1TI5A 1JZAA 2I61A 1P0AA 1P00A 1PE4A 1WMTA 1GPSA 1OZZA 2N2RA 1ZUTA 1T7BA 1ZFUA 1T7AA 1SN1A 2NY8X 2YC1C 2E3GA 1T1TA 2KPYA 1SEGA 2M8BB 2ATBA 1L4VA 2A7TA 1I6FA 1ICAA 1CHZA 4V1DC 2B68A 2YEOA 1AHOA 1FH3A 1VNBA 1C56A 1BMRA 4AAZA 2SN3A 1DJTA 1ZYWA 1I2UA 2LY6A 2LJMA 1ZU3A 1NRBA 4CQKA 1SNBA 1JKZA 2KBKA 2YBRC 1N4NA 5CY0A 1T7EA 2KSKA 2KJAA 3E7UX 2N2QA 2N69A 1JXCA 2N66A 2LY5A 4HE7A 2B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE5 A;  1GPT A;  1ZVG A;  2KBJ A;  2NY9 X;  1NH5 A;  4AB0 A;  2MZ0 A;  2KBH A;  1B7D A;  1LQH A;  1ZYV A;  1WWN A;  1SN4 A;  4KYP A;  1BRZ A;  5KK4 A;  1B3C A;  1OMY A;  2BRZ A;  2LT8 A;  1CN2 A;  1JZB A;  1NRA A;  3E7R L;  2LJ7 A;  4UJ0 A;  1NPI A;  1MR4 A;  1I2V A;  2LKB A;  1BK8 A;  1PX9 A;  4HHF A;  1ZVE A;  1LQI A;  2KYQ A;  2KGQ A;  1LQQ A;  2LR3 A;  4AEI A;  2LI7 A;  1VNA A;  3PSM A;  2ASC A;  1WT7 A;  1C55 A;  1I6G A;  1BCG A;  1DQ7 A;  1MYN A;  1T0Z A;  2E0H A;  2GL1 A;  1AYJ A;  1KV0 A;  1PTX A;  2E3F A;  1TI5 A;  1JZA A;  2I61 A;  1P0A A;  1P00 A;  1PE4 A;  1WMT A;  1GPS A;  1OZZ A;  2N2R A;  1ZUT A;  1T7B A;  1ZFU A;  1T7A A;  1SN1 A;  2NY8 X;  2YC1 C;  2E3G A;  1T1T A;  2KPY A;  1SEG A;  2M8B B;  2ATB A;  1L4V A;  2A7T A;  1I6F A;  1ICA A;  1CHZ A;  4V1D C;  2B68 A;  2YEO A;  1AHO A;  1FH3 A;  1VNB A;  1C56 A;  1BMR A;  4AAZ A;  2SN3 A;  1DJT A;  1ZYW A;  1I2U A;  2LY6 A;  2LJM A;  1ZU3 A;  1NRB A;  4CQK A;  1SNB A;  1JKZ A;  2KBK A;  2YBR C;  1N4N A;  5CY0 A;  1T7E A;  2KSK A;  2KJA A;  3E7U X;  2N2Q A;  2N69 A;  1JXC A;  2N66 A;  2LY5 A;  4HE7 A;  2B3C A; 
#chains in the Genus database with same CATH topology
 1NE5 A;  1GPT A;  1ZVG A;  2KBJ A;  2VY6 A;  2LN8 A;  3GDQ A;  3L4I A;  4H5V A;  2NY9 X;  1NH5 A;  4UAD E;  5F0X A;  4AB0 A;  1NGH A;  2MZ0 A;  1QQN A;  1NGE A;  3QI7 A;  2KBH A;  3KP1 A;  4H5W A;  1B7D A;  1LQH A;  1ZYV A;  2K35 A;  1WWN A;  1SN4 A;  2QWO A;  2YIP A;  4KYP A;  3D2E A;  5AQG A;  1BUP A;  1NGI A;  1BRZ A;  5KK4 A;  1B3C A;  3D2F B;  3QML A;  1OMY A;  2BRZ A;  2YIL A;  1XRS B;  2BUP A;  3BK3 C;  2LT8 A;  3C7N B;  1QQO A;  3FZM A;  5AQN A;  1BA0 A;  1JZB A;  5FPE A;  1CN2 A;  3KHW A;  3KC6 A;  2G2K A;  1NRA A;  5AQW A;  4H5R A;  4FL9 A;  3E7R L;  5AQP A;  2LJ7 A;  4UJ0 A;  1NPI A;  1MR4 A;  3A8Y A;  5BPL A;  5AQF A;  3FZL A;  1I2V A;  2LKB A;  1BK8 A;  1PX9 A;  1S3X A;  1ZVE A;  3FZF A;  1LQI A;  4HHF A;  5AQT A;  5AQI A;  1POI A;  2QWR A;  2KYQ A;  2KGQ A;  1LQQ A;  3KP0 A;  5AQU A;  2LR3 A;  3L56 A;  2QWL A;  3KOW A;  4AEI A;  2LI7 A;  1VNA A;  3PSM A;  2ASC A;  3ATU A;  3CQX A;  3D2F A;  5EY4 A;  3KVG A;  2D56 A;  1WT7 A;  3GKU A;  5AQX A;  5BN8 A;  5FPD A;  1C55 A;  1I6G A;  1BCG A;  3SF4 D;  2GMO A;  5FPN A;  4HWI A;  1NGJ A;  3R2V A;  1DQ7 A;  1MYN A;  1T0Z A;  2E0H A;  2GL1 A;  1AYJ A;  1KV0 A;  1BA1 A;  1PTX A;  2E2F A;  2E3F A;  5AQJ A;  1TI5 A;  1HX1 A;  1JZA A;  2I61 A;  2JDQ D;  2V7Z A;  5AQO A;  1P0A A;  1P00 A;  5AQR A;  3QFP A;  1PE4 A;  5EVZ A;  1WMT A;  1GPS A;  1OZZ A;  5AQS A;  1KAY A;  2N2R A;  1ZUT A;  3LDO A;  3M3Z A;  5AQL A;  5F1X A;  1T7B A;  1ZFU A;  2E88 A;  1T7A A;  5FPM A;  1YUW A;  4FSV A;  1SN1 A;  3LDL A;  2NY8 X;  1NGF A;  2YIO A;  3C7N A;  5AQH A;  2YC1 C;  5BPM A;  3FE1 A;  2E3G A;  1T1T A;  2KPY A;  2KHO A;  1SEG A;  2M8B B;  2ATB A;  2MN5 A;  1QQM A;  3QFU A;  1L4V A;  2A7T A;  1I6F A;  3AY9 A;  4GNI A;  1ICA A;  1CHZ A;  3KOX A;  4V1D C;  2B68 A;  3FZK A;  2QXL A;  1HJO A;  2YEO A;  4H5N A;  4IO8 A;  5AQM A;  1KAX A;  1NGG A;  1NGA A;  1NGC A;  3FZH A;  1AHO A;  1KAZ A;  3HSC A;  3I33 A;  1FH3 A;  5AR0 A;  5BN9 A;  1VNB A;  1C56 A;  3CW4 A;  1DKG D;  1BMR A;  4AAZ A;  2SN3 A;  3IUC A;  2QWP A;  1DJT A;  1ZYW A;  5AQV A;  5EXW A;  2LY6 A;  2MBK A;  2QWN A;  1I2U A;  3ATV A;  3KOY A;  5AQQ A;  5AQY A;  1NGB A;  3JXU A;  2LJM A;  1ZU3 A;  1ATS A;  1NRB A;  3KOZ A;  5AQK A;  5AQZ A;  4CQK A;  1SNB A;  4KBO A;  1K8B A;  5EX5 A;  1JKZ A;  2KBK A;  2YBR C;  3L6Q A;  1N4N A;  1NGD A;  5CY0 A;  3GL1 A;  5F2R A;  1T7E A;  2KSK A;  1UGL A;  2KJA A;  4UAE F;  3E7U X;  5BPN A;  4UAF E;  2N2Q A;  2QWM A;  3D2E B;  3LDP A;  1HPM A;  4H5T A;  2N69 A;  2QWQ A;  1JXC A;  2E8A A;  3LDQ A;  2N66 A;  1ATR A;  3LDN A;  2LY5 A;  4HE7 A;  2B3C A;  2QW9 A; 
#chains in the Genus database with same CATH homology
 1NE5 A;  1GPT A;  1ZVG A;  2KBJ A;  2NY9 X;  1NH5 A;  4AB0 A;  2MZ0 A;  2KBH A;  1B7D A;  1LQH A;  1ZYV A;  1WWN A;  1SN4 A;  4KYP A;  1BRZ A;  5KK4 A;  1B3C A;  1OMY A;  2BRZ A;  2LT8 A;  1CN2 A;  1JZB A;  1NRA A;  3E7R L;  2LJ7 A;  4UJ0 A;  1NPI A;  1MR4 A;  1I2V A;  2LKB A;  1BK8 A;  1PX9 A;  4HHF A;  1ZVE A;  1LQI A;  2KYQ A;  2KGQ A;  1LQQ A;  2LR3 A;  4AEI A;  2LI7 A;  1VNA A;  3PSM A;  2ASC A;  1WT7 A;  1C55 A;  1I6G A;  1BCG A;  1DQ7 A;  1MYN A;  1T0Z A;  2E0H A;  2GL1 A;  1AYJ A;  1KV0 A;  1PTX A;  2E3F A;  1TI5 A;  1JZA A;  2I61 A;  1P0A A;  1P00 A;  1PE4 A;  1WMT A;  1GPS A;  1OZZ A;  2N2R A;  1ZUT A;  1T7B A;  1ZFU A;  1T7A A;  1SN1 A;  2NY8 X;  2YC1 C;  2E3G A;  1T1T A;  2KPY A;  1SEG A;  2M8B B;  2ATB A;  1L4V A;  2A7T A;  1I6F A;  1ICA A;  1CHZ A;  4V1D C;  2B68 A;  2YEO A;  1AHO A;  1FH3 A;  1VNB A;  1C56 A;  1BMR A;  4AAZ A;  2SN3 A;  1DJT A;  1ZYW A;  1I2U A;  2LY6 A;  2LJM A;  1ZU3 A;  1NRB A;  4CQK A;  1SNB A;  1JKZ A;  2KBK A;  2YBR C;  1N4N A;  5CY0 A;  1T7E A;  2KSK A;  2KJA A;  3E7U X;  2N2Q A;  2N69 A;  1JXC A;  2N66 A;  2LY5 A;  4HE7 A;  2B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...