1T0ZA

Structure of an excitatory insect-specific toxin with an analgesic effect on mammalian from scorpion buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
b'KKNGYAVDSSGKVAECLFNNYCNNECTKVYYADKGYCCLLKCYCFGLADDKPVLDIWDSTKNYCDVQIIDLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords insect neurotoxin
publication title Structure of an excitatory insect-specific toxin with an analgesic effect on mammals from the scorpion Buthus martensii Karsch.
pubmed doi rcsb
molecule tags Toxin
total genus 18
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t0zA00
1JXCA 1TI5A 1JZBA 2N69A 2KYQA 1ZUTA 2KJAA 1I6FA 4UJ0A 1B3CA 2YBRC 1B7DA 1ZU3A 1KV0A 1BRZA 1I2UA 1NPIA 2M8BB 1VNAA 1N4NA 2LY5A 2YC1C 1BCGA 2KBKA 1MYNA 2GL1A 2SN3A 1L4VA 1OMYA 1GPSA 1GPTA 1LQHA 2N66A 1SN1A 1WMTA 1OZZA 2ATBA 1BMRA 4KYPA 1C56A 1WT7A 2ASCA 2BRZA 2YEOA 4AB0A 1ZYWA 1NE5A 2MZ0A 2KPYA 2LY6A 1AYJA 4CQKA 1LQIA 1DJTA 1T1TA 2N2RA 3E7RL 2E3GA 2NY8X 2KBJA 1AHOA 2KBHA 1VNBA 1JKZA 1PTXA 1T7EA 1CN2A 1CHZA 1C55A 1T0ZA 1NRAA 2E3FA 4AAZA 2LKBA 1SN4A 1I2VA 1P0AA 1BK8A 4HE7A 2E0HA 2N2QA 1NRBA 1SEGA 5CY0A 1PE4A 1MR4A 2B68A 1ZYVA 1NH5A 4HHFA 2LJMA 1P00A 1JZAA 3PSMA 1T7AA 2LT8A 1ICAA 1DQ7A 1ZVEA 2NY9X 2KGQA 3E7UX 2B3CA 2KSKA 4V1DC 1WWNA 1ZVGA 2LJ7A 1FH3A 5KK4A 2I61A 1LQQA 1PX9A 2LR3A 1I6GA 1ZFUA 2A7TA 2LI7A 1T7BA 1SNBA 4AEIA
chains in the Genus database with same CATH superfamily
1NGHA 5AQZA 5AQMA 5EX5A 1JXCA 1NGBA 1TI5A 2E8AA 3ATVA 5AQGA 2JDQD 1JZBA 1S3XA 1UGLA 2QWLA 2MN5A 3FZHA 2N69A 2KYQA 1ZUTA 2KJAA 1I6FA 1BA0A 1QQNA 3KP0A 3QMLA 4UJ0A 1B3CA 2YBRC 1B7DA 2E88A 3A8YA 1HX1A 5AQFA 1QQOA 1ZU3A 2YILA 1NGFA 1KV0A 3GKUA 1BRZA 1QQMA 1NPIA 5AQYA 1I2UA 1KAXA 1VNAA 1N4NA 2LY5A 2G2KA 1KAYA 2M8BB 1BCGA 1HJOA 1NGDA 2KBKA 2QWQA 4KBOA 1MYNA 5AQOA 5AR0A 2GL1A 2SN3A 5BPLA 5BPNA 2VY6A 1L4VA 1OMYA 2LN8A 4UADE 5AQVA 3KOWA 1GPTA 1GPSA 3L56A 1LQHA 2N66A 1NGAA 1SN1A 5BN9A 1WMTA 1OZZA 2ATBA 3FZFA 3I33A 5AQUA 1BMRA 3FZKA 4KYPA 5AQSA 1C56A 1NGEA 1WT7A 2ASCA 1HPMA 2BRZA 2YEOA 5AQTA 3KOZA 3D2FA 3FE1A 2YIPA 4AB0A 2QWMA 1ATRA 1ZYWA 5AQRA 1NE5A 2MZ0A 4IO8A 2KPYA 4H5RA 3BK3C 1KAZA 2LY6A 3FZLA 3LDQA 4GNIA 5AQHA 1AYJA 4CQKA 1LQIA 1DJTA 1T1TA 2N2RA 2QWPA 3E7RL 2E3GA 3KC6A 2NY8X 5AQXA 5FPNA 2KBJA 3D2FB 1AHOA 2KBHA 3KP1A 1VNBA 1JKZA 1NGIA 1PTXA 5FPDA 3LDNA 5AQPA 1T7EA 3LDPA 1CN2A 1CHZA 1C55A 1BUPA 4H5VA 3ATUA 1NGJA 1T0ZA 1NGCA 1NRAA 3LDLA 2E3FA 3D2EA 4AAZA 2QXLA 2K35A 2LKBA 2YC1C 5AQWA 5BN8A 3IUCA 5FPMA 4FSVA 1SN4A 3FZMA 2V7ZA 3AY9A 1I2VA 5F1XA 3L6QA 4H5WA 1P0AA 2QWOA 2D56A 3QFUA 3SF4D 2YIOA 5EY4A 5BPMA 1NGGA 3QI7A 4HWIA 4HE7A 1BK8A 1ATSA 2QW9A 1BA1A 2E0HA 2N2QA 3D2EB 4UAFE 3GL1A 3KHWA 1NRBA 3HSCA 3KOXA 5AQJA 1SEGA 5CY0A 3C7NA 1PE4A 1MR4A 2B68A 4H5TA 1ZYVA 5FPEA 1DKGD 1NH5A 2QWNA 4HHFA 4UAEF 2LJMA 1P00A 1JZAA 3LDOA 3PSMA 5AQIA 1T7AA 3R2VA 3KOYA 2LT8A 1ICAA 2GMOA 1DQ7A 1ZVEA 3KVGA 3M3ZA 1XRSB 2NY9X 4H5NA 2KGQA 2MBKA 1POIA 5AQNA 3L4IA 3E7UX 3C7NB 5F0XA 2B3CA 2KSKA 3CW4A 4V1DC 1WWNA 1ZVGA 3GDQA 2LJ7A 1FH3A 3JXUA 5KK4A 2I61A 1LQQA 1PX9A 2E2FA 2LR3A 2KHOA 1YUWA 5AQLA 5EXWA 2QWRA 5AQKA 5AQQA 5EVZA 1I6GA 4FL9A 2BUPA 3QFPA 1ZFUA 2A7TA 3CQXA 2LI7A 5F2RA 1T7BA 1SNBA 4AEIA 1K8BA
chains in the Genus database with same CATH topology
1JXCA 1TI5A 1JZBA 2N69A 2KYQA 1ZUTA 2KJAA 1I6FA 4UJ0A 1B3CA 2YBRC 1B7DA 1ZU3A 1KV0A 1BRZA 1I2UA 1NPIA 2M8BB 1VNAA 1N4NA 2LY5A 2YC1C 1BCGA 2KBKA 1MYNA 2GL1A 2SN3A 1L4VA 1OMYA 1GPSA 1GPTA 1LQHA 2N66A 1SN1A 1WMTA 1OZZA 2ATBA 1BMRA 4KYPA 1C56A 1WT7A 2ASCA 2BRZA 2YEOA 4AB0A 1ZYWA 1NE5A 2MZ0A 2KPYA 2LY6A 1AYJA 4CQKA 1LQIA 1DJTA 1T1TA 2N2RA 3E7RL 2E3GA 2NY8X 2KBJA 1AHOA 2KBHA 1VNBA 1JKZA 1PTXA 1T7EA 1CN2A 1CHZA 1C55A 1T0ZA 1NRAA 2E3FA 4AAZA 2LKBA 1SN4A 1I2VA 1P0AA 1BK8A 4HE7A 2E0HA 2N2QA 1NRBA 1SEGA 5CY0A 1PE4A 1MR4A 2B68A 1ZYVA 1NH5A 4HHFA 2LJMA 1P00A 1JZAA 3PSMA 1T7AA 2LT8A 1ICAA 1DQ7A 1ZVEA 2NY9X 2KGQA 3E7UX 2B3CA 2KSKA 4V1DC 1WWNA 1ZVGA 2LJ7A 1FH3A 5KK4A 2I61A 1LQQA 1PX9A 2LR3A 1I6GA 1ZFUA 2A7TA 2LI7A 1T7BA 1SNBA 4AEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXC A;  1TI5 A;  1JZB A;  2N69 A;  2KYQ A;  1ZUT A;  2KJA A;  1I6F A;  4UJ0 A;  1B3C A;  2YBR C;  1B7D A;  1ZU3 A;  1KV0 A;  1BRZ A;  1I2U A;  1NPI A;  2M8B B;  1VNA A;  1N4N A;  2LY5 A;  2YC1 C;  1BCG A;  2KBK A;  1MYN A;  2GL1 A;  2SN3 A;  1L4V A;  1OMY A;  1GPS A;  1GPT A;  1LQH A;  2N66 A;  1SN1 A;  1WMT A;  1OZZ A;  2ATB A;  1BMR A;  4KYP A;  1C56 A;  1WT7 A;  2ASC A;  2BRZ A;  2YEO A;  4AB0 A;  1ZYW A;  1NE5 A;  2MZ0 A;  2KPY A;  2LY6 A;  1AYJ A;  4CQK A;  1LQI A;  1DJT A;  1T1T A;  2N2R A;  3E7R L;  2E3G A;  2NY8 X;  2KBJ A;  1AHO A;  2KBH A;  1VNB A;  1JKZ A;  1PTX A;  1T7E A;  1CN2 A;  1CHZ A;  1C55 A;  1T0Z A;  1NRA A;  2E3F A;  4AAZ A;  2LKB A;  1SN4 A;  1I2V A;  1P0A A;  1BK8 A;  4HE7 A;  2E0H A;  2N2Q A;  1NRB A;  1SEG A;  5CY0 A;  1PE4 A;  1MR4 A;  2B68 A;  1ZYV A;  1NH5 A;  4HHF A;  2LJM A;  1P00 A;  1JZA A;  3PSM A;  1T7A A;  2LT8 A;  1ICA A;  1DQ7 A;  1ZVE A;  2NY9 X;  2KGQ A;  3E7U X;  2B3C A;  2KSK A;  4V1D C;  1WWN A;  1ZVG A;  2LJ7 A;  1FH3 A;  5KK4 A;  2I61 A;  1LQQ A;  1PX9 A;  2LR3 A;  1I6G A;  1ZFU A;  2A7T A;  2LI7 A;  1T7B A;  1SNB A;  4AEI A; 
#chains in the Genus database with same CATH topology
 1NGH A;  5AQZ A;  5AQM A;  5EX5 A;  1JXC A;  1NGB A;  1TI5 A;  2E8A A;  3ATV A;  5AQG A;  2JDQ D;  1JZB A;  1S3X A;  1UGL A;  2QWL A;  2MN5 A;  3FZH A;  2N69 A;  2KYQ A;  1ZUT A;  2KJA A;  1I6F A;  1BA0 A;  1QQN A;  3KP0 A;  3QML A;  4UJ0 A;  1B3C A;  2YBR C;  1B7D A;  2E88 A;  3A8Y A;  1HX1 A;  5AQF A;  1QQO A;  1ZU3 A;  2YIL A;  1NGF A;  1KV0 A;  3GKU A;  1BRZ A;  1QQM A;  1NPI A;  5AQY A;  1I2U A;  1KAX A;  1VNA A;  1N4N A;  2LY5 A;  2G2K A;  1KAY A;  2M8B B;  1BCG A;  1HJO A;  1NGD A;  2KBK A;  2QWQ A;  4KBO A;  1MYN A;  5AQO A;  5AR0 A;  2GL1 A;  2SN3 A;  5BPL A;  5BPN A;  2VY6 A;  1L4V A;  1OMY A;  2LN8 A;  4UAD E;  5AQV A;  3KOW A;  1GPT A;  1GPS A;  3L56 A;  1LQH A;  2N66 A;  1NGA A;  1SN1 A;  5BN9 A;  1WMT A;  1OZZ A;  2ATB A;  3FZF A;  3I33 A;  5AQU A;  1BMR A;  3FZK A;  4KYP A;  5AQS A;  1C56 A;  1NGE A;  1WT7 A;  2ASC A;  1HPM A;  2BRZ A;  2YEO A;  5AQT A;  3KOZ A;  3D2F A;  3FE1 A;  2YIP A;  4AB0 A;  2QWM A;  1ATR A;  1ZYW A;  5AQR A;  1NE5 A;  2MZ0 A;  4IO8 A;  2KPY A;  4H5R A;  3BK3 C;  1KAZ A;  2LY6 A;  3FZL A;  3LDQ A;  4GNI A;  5AQH A;  1AYJ A;  4CQK A;  1LQI A;  1DJT A;  1T1T A;  2N2R A;  2QWP A;  3E7R L;  2E3G A;  3KC6 A;  2NY8 X;  5AQX A;  5FPN A;  2KBJ A;  3D2F B;  1AHO A;  2KBH A;  3KP1 A;  1VNB A;  1JKZ A;  1NGI A;  1PTX A;  5FPD A;  3LDN A;  5AQP A;  1T7E A;  3LDP A;  1CN2 A;  1CHZ A;  1C55 A;  1BUP A;  4H5V A;  3ATU A;  1NGJ A;  1T0Z A;  1NGC A;  1NRA A;  3LDL A;  2E3F A;  3D2E A;  4AAZ A;  2QXL A;  2K35 A;  2LKB A;  2YC1 C;  5AQW A;  5BN8 A;  3IUC A;  5FPM A;  4FSV A;  1SN4 A;  3FZM A;  2V7Z A;  3AY9 A;  1I2V A;  5F1X A;  3L6Q A;  4H5W A;  1P0A A;  2QWO A;  2D56 A;  3QFU A;  3SF4 D;  2YIO A;  5EY4 A;  5BPM A;  1NGG A;  3QI7 A;  4HWI A;  4HE7 A;  1BK8 A;  1ATS A;  2QW9 A;  1BA1 A;  2E0H A;  2N2Q A;  3D2E B;  4UAF E;  3GL1 A;  3KHW A;  1NRB A;  3HSC A;  3KOX A;  5AQJ A;  1SEG A;  5CY0 A;  3C7N A;  1PE4 A;  1MR4 A;  2B68 A;  4H5T A;  1ZYV A;  5FPE A;  1DKG D;  1NH5 A;  2QWN A;  4HHF A;  4UAE F;  2LJM A;  1P00 A;  1JZA A;  3LDO A;  3PSM A;  5AQI A;  1T7A A;  3R2V A;  3KOY A;  2LT8 A;  1ICA A;  2GMO A;  1DQ7 A;  1ZVE A;  3KVG A;  3M3Z A;  1XRS B;  2NY9 X;  4H5N A;  2KGQ A;  2MBK A;  1POI A;  5AQN A;  3L4I A;  3E7U X;  3C7N B;  5F0X A;  2B3C A;  2KSK A;  3CW4 A;  4V1D C;  1WWN A;  1ZVG A;  3GDQ A;  2LJ7 A;  1FH3 A;  3JXU A;  5KK4 A;  2I61 A;  1LQQ A;  1PX9 A;  2E2F A;  2LR3 A;  2KHO A;  1YUW A;  5AQL A;  5EXW A;  2QWR A;  5AQK A;  5AQQ A;  5EVZ A;  1I6G A;  4FL9 A;  2BUP A;  3QFP A;  1ZFU A;  2A7T A;  3CQX A;  2LI7 A;  5F2R A;  1T7B A;  1SNB A;  4AEI A;  1K8B A; 
#chains in the Genus database with same CATH homology
 1JXC A;  1TI5 A;  1JZB A;  2N69 A;  2KYQ A;  1ZUT A;  2KJA A;  1I6F A;  4UJ0 A;  1B3C A;  2YBR C;  1B7D A;  1ZU3 A;  1KV0 A;  1BRZ A;  1I2U A;  1NPI A;  2M8B B;  1VNA A;  1N4N A;  2LY5 A;  2YC1 C;  1BCG A;  2KBK A;  1MYN A;  2GL1 A;  2SN3 A;  1L4V A;  1OMY A;  1GPS A;  1GPT A;  1LQH A;  2N66 A;  1SN1 A;  1WMT A;  1OZZ A;  2ATB A;  1BMR A;  4KYP A;  1C56 A;  1WT7 A;  2ASC A;  2BRZ A;  2YEO A;  4AB0 A;  1ZYW A;  1NE5 A;  2MZ0 A;  2KPY A;  2LY6 A;  1AYJ A;  4CQK A;  1LQI A;  1DJT A;  1T1T A;  2N2R A;  3E7R L;  2E3G A;  2NY8 X;  2KBJ A;  1AHO A;  2KBH A;  1VNB A;  1JKZ A;  1PTX A;  1T7E A;  1CN2 A;  1CHZ A;  1C55 A;  1T0Z A;  1NRA A;  2E3F A;  4AAZ A;  2LKB A;  1SN4 A;  1I2V A;  1P0A A;  1BK8 A;  4HE7 A;  2E0H A;  2N2Q A;  1NRB A;  1SEG A;  5CY0 A;  1PE4 A;  1MR4 A;  2B68 A;  1ZYV A;  1NH5 A;  4HHF A;  2LJM A;  1P00 A;  1JZA A;  3PSM A;  1T7A A;  2LT8 A;  1ICA A;  1DQ7 A;  1ZVE A;  2NY9 X;  2KGQ A;  3E7U X;  2B3C A;  2KSK A;  4V1D C;  1WWN A;  1ZVG A;  2LJ7 A;  1FH3 A;  5KK4 A;  2I61 A;  1LQQ A;  1PX9 A;  2LR3 A;  1I6G A;  1ZFU A;  2A7T A;  2LI7 A;  1T7B A;  1SNB A;  4AEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...